


| Basic Information | |
|---|---|
| Family ID | F061287 |
| Family Type | Metagenome |
| Number of Sequences | 132 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MYKNDREVMIKELMKLKLQRKLLDEMRDGEIRVLFSILKRYVK |
| Number of Associated Samples | 101 |
| Number of Associated Scaffolds | 132 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 82.58 % |
| % of genes near scaffold ends (potentially truncated) | 20.45 % |
| % of genes from short scaffolds (< 2000 bps) | 75.76 % |
| Associated GOLD sequencing projects | 81 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.61 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (51.515 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (50.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (93.182 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (86.364 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 45.07% β-sheet: 0.00% Coil/Unstructured: 54.93% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.61 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 132 Family Scaffolds |
|---|---|---|
| PF02195 | ParBc | 3.03 |
| PF12705 | PDDEXK_1 | 3.03 |
| PF06071 | YchF-GTPase_C | 2.27 |
| PF13384 | HTH_23 | 2.27 |
| PF01807 | zf-CHC2 | 1.52 |
| PF00196 | GerE | 0.76 |
| PF01930 | Cas_Cas4 | 0.76 |
| PF13936 | HTH_38 | 0.76 |
| COG ID | Name | Functional Category | % Frequency in 132 Family Scaffolds |
|---|---|---|---|
| COG0012 | Ribosome-binding ATPase YchF, GTP1/OBG family | Translation, ribosomal structure and biogenesis [J] | 2.27 |
| COG0358 | DNA primase (bacterial type) | Replication, recombination and repair [L] | 1.52 |
| COG1468 | CRISPR/Cas system-associated exonuclease Cas4, RecB family | Defense mechanisms [V] | 0.76 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 51.52 % |
| All Organisms | root | All Organisms | 48.48 % |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 50.00% |
| Deep Ocean | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean | 21.97% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 6.82% |
| Filtered Seawater | Environmental → Aquatic → Marine → Unclassified → Unclassified → Filtered Seawater | 5.30% |
| Marine Oceanic | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine Oceanic | 3.79% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 2.27% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 2.27% |
| Marine, Hydrothermal Vent Plume | Environmental → Aquatic → Marine → Hydrothermal Vents → Black Smokers → Marine, Hydrothermal Vent Plume | 1.52% |
| Macroalgal Surface | Host-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface | 1.52% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 0.76% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 0.76% |
| Diffuse Hydrothermal Fluids | Environmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Diffuse Hydrothermal Fluids | 0.76% |
| Hydrothermal Vent Fluids | Environmental → Aquatic → Marine → Hydrothermal Vents → Unclassified → Hydrothermal Vent Fluids | 0.76% |
| Marine Sediment | Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment | 0.76% |
| Deep Subsurface | Environmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface | 0.76% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000947 | Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY92 | Host-Associated | Open in IMG/M |
| 3300000973 | Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY93 | Host-Associated | Open in IMG/M |
| 3300001450 | Marine viral communities from the Pacific Ocean - LP-53 | Environmental | Open in IMG/M |
| 3300001717 | Marine viral communities from the Pacific Ocean - LP-47 | Environmental | Open in IMG/M |
| 3300001721 | Marine viral communities from the Pacific Ocean - LP-54 | Environmental | Open in IMG/M |
| 3300001727 | Marine viral communities from the Pacific Ocean - LP-55 | Environmental | Open in IMG/M |
| 3300001736 | Marine viral communities from the Deep Pacific Ocean - MSP-131 | Environmental | Open in IMG/M |
| 3300001739 | Marine viral communities from the Deep Pacific Ocean - MSP-121 | Environmental | Open in IMG/M |
| 3300002231 | Marine sediment microbial communities from Santorini caldera mats, Greece - red mat | Environmental | Open in IMG/M |
| 3300002760 | Marine viral communities from the Pacific Ocean - ETNP_6_1000 | Environmental | Open in IMG/M |
| 3300003690 | Hydrothermal vent plume microbial communities from the Mid Cayman Rise - Piccard2013-Plume - Viral/microbial metagenome assembly | Environmental | Open in IMG/M |
| 3300005398 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV201 | Environmental | Open in IMG/M |
| 3300005427 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV65 | Environmental | Open in IMG/M |
| 3300005428 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F10-02SV253 | Environmental | Open in IMG/M |
| 3300005430 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV69 | Environmental | Open in IMG/M |
| 3300005514 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F12-01SV263 | Environmental | Open in IMG/M |
| 3300005516 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306PF49B | Environmental | Open in IMG/M |
| 3300005838 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S2LV_130m_DNA | Environmental | Open in IMG/M |
| 3300006076 | Microbial communities in diffuse hydrothermal fluids of Manus Basin, Bismarck Sea ? fluid A | Environmental | Open in IMG/M |
| 3300006164 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG002-DNA | Environmental | Open in IMG/M |
| 3300006736 | Marine viral communities from the Subarctic Pacific Ocean - 1_ETSP_OMZ_AT15124 metaG | Environmental | Open in IMG/M |
| 3300006738 | Marine viral communities from the Subarctic Pacific Ocean - 3_ETSP_OMZ_AT15126 metaG | Environmental | Open in IMG/M |
| 3300006751 | Marine viral communities from the Subarctic Pacific Ocean - 7_ETSP_OMZ_AT15161 metaG | Environmental | Open in IMG/M |
| 3300006752 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG | Environmental | Open in IMG/M |
| 3300006754 | Marine viral communities from the Subarctic Pacific Ocean - 10_ETSP_OMZ_AT15264 metaG | Environmental | Open in IMG/M |
| 3300006789 | Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG | Environmental | Open in IMG/M |
| 3300006793 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG | Environmental | Open in IMG/M |
| 3300006856 | Marine viral communities from Cariaco Basin, Caribbean Sea - 25B_WHOI_OMZ_CsCl | Environmental | Open in IMG/M |
| 3300006921 | Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG | Environmental | Open in IMG/M |
| 3300006924 | Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG | Environmental | Open in IMG/M |
| 3300006928 | Marine viral communities from the Subarctic Pacific Ocean - 8_ETSP_OMZ_AT15162 metaG | Environmental | Open in IMG/M |
| 3300006929 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG | Environmental | Open in IMG/M |
| 3300006947 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG017-DNA | Environmental | Open in IMG/M |
| 3300007963 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (version 2) | Environmental | Open in IMG/M |
| 3300008050 | Marine viral communities from the Subarctic Pacific Ocean - 15_ETSP_OMZ_AT15312 metaG | Environmental | Open in IMG/M |
| 3300008216 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_Geostar | Environmental | Open in IMG/M |
| 3300008217 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_215 | Environmental | Open in IMG/M |
| 3300008218 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s6 | Environmental | Open in IMG/M |
| 3300008219 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_b05 | Environmental | Open in IMG/M |
| 3300008220 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_908 | Environmental | Open in IMG/M |
| 3300009173 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_134 | Environmental | Open in IMG/M |
| 3300009418 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s17 | Environmental | Open in IMG/M |
| 3300009544 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean- Svalbard ARC20M Metagenome | Environmental | Open in IMG/M |
| 3300009602 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_231 | Environmental | Open in IMG/M |
| 3300009619 | Marine viral communities from the Southern Atlantic ocean transect to study dissolved organic matter and carbon cycling - metaG 3827_250 | Environmental | Open in IMG/M |
| 3300009622 | Marine viral communities from the Southern Atlantic ocean transect to study dissolved organic matter and carbon cycling - metaG 3321_4155 | Environmental | Open in IMG/M |
| 3300010149 | Marine viral communities from the Subarctic Pacific Ocean - 13B_ETSP_OMZ_AT15268_CsCl metaG | Environmental | Open in IMG/M |
| 3300010150 | Marine viral communities from the Subarctic Pacific Ocean - 17B_ETSP_OMZ_AT15314_CsCl metaG | Environmental | Open in IMG/M |
| 3300010151 | Marine viral communities from the Subarctic Pacific Ocean - 22_ETSP_OMZ_AT15343 metaG | Environmental | Open in IMG/M |
| 3300011013 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 4SBTROV10_white metaG | Environmental | Open in IMG/M |
| 3300017757 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 43 SPOT_SRF_2013-05-22 | Environmental | Open in IMG/M |
| 3300017772 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 53 SPOT_SRF_2014-04-10 | Environmental | Open in IMG/M |
| 3300017775 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 55 SPOT_SRF_2014-07-17 | Environmental | Open in IMG/M |
| 3300020348 | Marine microbial communities from Tara Oceans - TARA_B100000676 (ERX556089-ERR599161) | Environmental | Open in IMG/M |
| 3300020350 | Marine microbial communities from Tara Oceans - TARA_B100000676 (ERX556036-ERR599084) | Environmental | Open in IMG/M |
| 3300020364 | Marine microbial communities from Tara Oceans - TARA_B100000097 (ERX556021-ERR599037) | Environmental | Open in IMG/M |
| 3300021978 | Hydrothermal fluids microbial communities from Mariana Back-Arc Basin vent fields, Pacific Ocean - Perseverance_CTD_V16A_01_btl17 _150kmer | Environmental | Open in IMG/M |
| 3300022225 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014_SV_400_PacBio MetaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300022902 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_118_April2016_135_MG | Environmental | Open in IMG/M |
| 3300024517 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_3 | Environmental | Open in IMG/M |
| 3300024520 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_1 | Environmental | Open in IMG/M |
| 3300025027 | Marine viral communities from the Pacific Ocean - LP-31 (SPAdes) | Environmental | Open in IMG/M |
| 3300025038 | Marine viral communities from Cariaco Basin, Caribbean Sea - 24B_WHOI_OMZ_CsCl (SPAdes) | Environmental | Open in IMG/M |
| 3300025039 | Marine viral communities from the Pacific Ocean - LP-41 (SPAdes) | Environmental | Open in IMG/M |
| 3300025042 | Marine viral communities from the Pacific Ocean - LP-47 (SPAdes) | Environmental | Open in IMG/M |
| 3300025066 | Marine viral communities from the Subarctic Pacific Ocean - 15B_ETSP_OMZ_AT15312_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025072 | Marine viral communities from the Subarctic Pacific Ocean - 19_ETSP_OMZ_AT15317 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025078 | Marine viral communities from the Subarctic Pacific Ocean - 18_ETSP_OMZAT15316 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025082 | Marine viral communities from the Subarctic Pacific Ocean - 1_ETSP_OMZ_AT15124 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025103 | Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025109 | Marine viral communities from the Subarctic Pacific Ocean - 6_ETSP_OMZ_AT15160 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025110 | Marine viral communities from the Subarctic Pacific Ocean - 8_ETSP_OMZ_AT15162 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025112 | Marine viral communities from the Pacific Ocean - ETNP_2_130 (SPAdes) | Environmental | Open in IMG/M |
| 3300025128 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025131 | Marine viral communities from the Pacific Ocean - ETNP_6_100 (SPAdes) | Environmental | Open in IMG/M |
| 3300025133 | Marine viral communities from the Subarctic Pacific Ocean - 15_ETSP_OMZ_AT15312 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025168 | Marine viral communities from the Pacific Ocean - LP-53 (SPAdes) | Environmental | Open in IMG/M |
| 3300025251 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_906 (SPAdes) | Environmental | Open in IMG/M |
| 3300025259 | Marine viral communities from the Deep Pacific Ocean - MSP-146 (SPAdes) | Environmental | Open in IMG/M |
| 3300025264 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s12 (SPAdes) | Environmental | Open in IMG/M |
| 3300025267 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_Geostar (SPAdes) | Environmental | Open in IMG/M |
| 3300025277 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s16 (SPAdes) | Environmental | Open in IMG/M |
| 3300025280 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s17 (SPAdes) | Environmental | Open in IMG/M |
| 3300025287 | Marine viral communities from the Deep Pacific Ocean - MSP-131 (SPAdes) | Environmental | Open in IMG/M |
| 3300025300 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s6 (SPAdes) | Environmental | Open in IMG/M |
| 3300025301 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_908 (SPAdes) | Environmental | Open in IMG/M |
| 3300025305 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_b05 (SPAdes) | Environmental | Open in IMG/M |
| 3300026103 | Marine viral communities from the Southern Atlantic ocean transect to study dissolved organic matter and carbon cycling - metaG 3321_4155 (SPAdes) | Environmental | Open in IMG/M |
| 3300026115 | Marine viral communities from the Southern Atlantic ocean transect to study dissolved organic matter and carbon cycling - metaG 3827_250 (SPAdes) | Environmental | Open in IMG/M |
| 3300026206 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201310SV74 (SPAdes) | Environmental | Open in IMG/M |
| 3300026209 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV65 (SPAdes) | Environmental | Open in IMG/M |
| 3300026257 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV69 (SPAdes) | Environmental | Open in IMG/M |
| 3300027704 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG017-DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027838 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300027847 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_126 (SPAdes) | Environmental | Open in IMG/M |
| 3300029319 | Marine viral communities collected during Tara Oceans survey from station TARA_032 - TARA_A100001516 | Environmental | Open in IMG/M |
| 3300031627 | Marine microbial communities from Western Arctic Ocean, Canada - AG5_33.1 | Environmental | Open in IMG/M |
| 3300034628 | Seawater viral communities from Mid-Atlantic Ridge, Atlantic Ocean - 543_2961 | Environmental | Open in IMG/M |
| 3300034629 | Seawater viral communities from Mid-Atlantic Ridge, Atlantic Ocean - 543_2600 | Environmental | Open in IMG/M |
| 3300034654 | Seawater viral communities from Mid-Atlantic Ridge, Atlantic Ocean - 487_2244 | Environmental | Open in IMG/M |
| 3300034656 | Seawater viral communities from Mid-Atlantic Ridge, Atlantic Ocean - 502_2477 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| BBAY92_102036582 | 3300000947 | Macroalgal Surface | SMDKNDREVMIKVLMKVKLQRKLLDKLTDTEIQRLFSVLKGYSI* |
| BBAY93_101795632 | 3300000973 | Macroalgal Surface | MYKNDREIMIKELMKLRLQRKLLDEMRDGEIRRLFSILKRYVK* |
| JGI24006J15134_100022519 | 3300001450 | Marine | MYKNDREVMIQELIKLKLQRKLLDEMSDGEIRRLFSILKRYVK* |
| JGI24522J20083_10053771 | 3300001717 | Marine | MDKHDREIMIEVLMELKLQRKILDRMSDNEISSLFSLLKKYAT* |
| JGI24528J20060_10124411 | 3300001721 | Marine | MDKHDREIMIXVLMELKLQRKILDRMSDNEISSLFSLLKKYAT* |
| JGI24529J20061_1009077 | 3300001727 | Marine | MDKSDRETMIKVLIKLKLDRKLLDRMKDSEIQGLFSILNGYVTNEKN* |
| JGI24659J20068_10087202 | 3300001736 | Deep Ocean | MMDKNDREVMIEQLMKLKLERKILDVMRDTEIRRLFSILKRYVK* |
| JGI24658J20074_10044845 | 3300001739 | Deep Ocean | MDKQDRETMMKVLMKLKLDRKLLDRMKDSEIQILFSILNGYVTNEKN* |
| KVRMV2_1017360432 | 3300002231 | Marine Sediment | MYKNDREIMIKELMKLRLQRKLLDEMRDGEIRVLFSILKRYVK* |
| JGI25136J39404_10692891 | 3300002760 | Marine | MDKHDREIMIEVLMELKLQRKILDRMSDNEISSLFSLLKKYAT*K* |
| PicViral_100027432 | 3300003690 | Marine, Hydrothermal Vent Plume | MDKNDREVMIEQLMKLKLERKILDVMRDTEIRRLFSILKRYVK* |
| PicViral_10055168 | 3300003690 | Marine, Hydrothermal Vent Plume | MYKNDREIMIEELMKLKLQRKLLDEMSDGEIRRLFSILKRYVK* |
| Ga0066858_1000325711 | 3300005398 | Marine | MDKHDRETMIKVLMKLKLQRKILDRMRDNEISSLFSLLKKYVT* |
| Ga0066851_102552431 | 3300005427 | Marine | MHKGDREVMTKLLMRLKLQRKLLDRLKDTEIQRLFSVLKGTQYES |
| Ga0066863_100510806 | 3300005428 | Marine | HDRETMIKVLMKLKLQRKILDRMRDNEISSLFSLLKKYVT* |
| Ga0066849_100455882 | 3300005430 | Marine | MDKHDRKIMIKELMKVKLQKKLLDTLRDSEIVRLFGILRRHIP* |
| Ga0066866_101233544 | 3300005514 | Marine | MHKSDREVMTKLLMKLKLQRKLLDRLKDTEIQRLFS |
| Ga0066831_100547643 | 3300005516 | Marine | MDKHDRETMIKVLMKLKLQRKILDRMRDNEISNLFSLLKKYVT* |
| Ga0008649_100389737 | 3300005838 | Marine | MDKHDREIMIKVLMELKLQRKILDRMSDNEISSLFSLLKKYAT* |
| Ga0081592_12336473 | 3300006076 | Diffuse Hydrothermal Fluids | MDKQDRETMMKVLMKLKLDRKLLDRMKDSEIQGLFSILNGYVTNEKN* |
| Ga0075441_100087174 | 3300006164 | Marine | MDKNDRELMIKELMKLKLQRKVLNMMRDTEIRRLFSILKRYVK* |
| Ga0075441_100815441 | 3300006164 | Marine | VDKNDRETMTEVLIKLKLDRKLLDRMKDSEIQGLFSILNGYAV* |
| Ga0075441_100972121 | 3300006164 | Marine | GVTVDKNDRETMTEVLIKLKLDRKLLDRMKDSEIQGLFSILNGYAV* |
| Ga0098033_10268755 | 3300006736 | Marine | MHKGDREVMIKALMKLKLQRKLLDRLKDTEIQRLFSILKRYTI* |
| Ga0098035_10543436 | 3300006738 | Marine | MHKSDREVMTKLLMKLKLQRKLLDRLKDTEIQRLFSVLKRYTI* |
| Ga0098035_11332353 | 3300006738 | Marine | MDKDDRETMIKSLMKVKLQRKLLERLKETEIQRLFSILKGHTA* |
| Ga0098040_10447704 | 3300006751 | Marine | MDKYDRETMIKSLMKLKLQRKLLDRLKDTEIQRLFSVLKGYSI* |
| Ga0098040_11797002 | 3300006751 | Marine | MDKDDRETMIKSLMKVKLQRKLLERLKDTEIQRLFSILKGHTA* |
| Ga0098048_11230731 | 3300006752 | Marine | RETMIKELMTVKLRRRLLEKMKDSEIQNLFFILKRHFK* |
| Ga0098048_12066271 | 3300006752 | Marine | YKNHRELMIKELMKLKLQRKVLDVMGDREIRRLFSILKRYVK* |
| Ga0098044_10722504 | 3300006754 | Marine | MDKNDREVMIKVLMKVKLQRKLLDKLTDTEIQRLFSVLKGYSI* |
| Ga0098044_10821354 | 3300006754 | Marine | MHKNDRETMIKELMTVKLRRRLLEKMKDSEIQNLFFILKRHFK* |
| Ga0098044_11613014 | 3300006754 | Marine | MDKHDREVKIKVLMKLKLKRKILDKMSNNEISSLFSILKRYST* |
| Ga0098044_13583832 | 3300006754 | Marine | MDKHDRKIIIKELMKVKLQKKLLDTLKDSEIVILFGILRRHTL* |
| Ga0098054_10353942 | 3300006789 | Marine | MHKSDREVMTKLLMRLKLQRRLLDRLKDTEIQRLFSVLKRYTT* |
| Ga0098054_10374376 | 3300006789 | Marine | MYKNDREIMIKELMKLKLQRKLLDEMRDGEIRVLFSILKRYVK* |
| Ga0098055_10563506 | 3300006793 | Marine | MTKLLMKLKLQRKLLDRLKDTEIQRLFSVLKRYTI* |
| Ga0098066_10059274 | 3300006856 | Marine | MHKNDRETMIKELMTVKLRRKLLETMRDSEIQSLFSILKRYFR* |
| Ga0098060_10350935 | 3300006921 | Marine | MHKSDREVMTKLLMRLKLQRKLLDRLKDTEIQRLFSVLKGYSI* |
| Ga0098051_10749832 | 3300006924 | Marine | MYKNDREIMIKELMKLKLQRKVLDVMGDREIRRLFSILKRYVK* |
| Ga0098041_10045295 | 3300006928 | Marine | MHKSDREVMTKLLMRLKLQRKLLDRLKDTEIQRLFSVLKRHTI* |
| Ga0098041_10062904 | 3300006928 | Marine | MYKNDREIMIKELMKLKLQRKLLNEMRDGEIRVLFSILKRYVK* |
| Ga0098036_10451605 | 3300006929 | Marine | MYKNDRELMIKELMKLKLQRKVLDVMGDREIRRLFSILKRYVK* |
| Ga0098036_10828702 | 3300006929 | Marine | MHKGDREVMTKLLMRLKLQRKLLDRLKDTEIQRLFSVLKRYTI* |
| Ga0098036_11177754 | 3300006929 | Marine | MDRHDRETMIKVLMELKLQRKVLDRMNDNEISSLFSLLKRYAT* |
| Ga0075444_101903911 | 3300006947 | Marine | EMMDKNDRELMIKELMKLKLQRKVLNMMRDTEIRRLFSILKRYVK* |
| Ga0110931_10079796 | 3300007963 | Marine | MMYKNDREIMIKELMKLRLQRKLLDEMRDGEIRRLFSILKRYVK* |
| Ga0110931_10438481 | 3300007963 | Marine | MYKNDREIMIKELMKLKLQRKVLDVMGDREIRRLFSILK |
| Ga0098052_10757595 | 3300008050 | Marine | MMYKNDREIMIKELMKLKLQRKLLDEMRDGEIRVLFSILKRYVK* |
| Ga0114898_10250683 | 3300008216 | Deep Ocean | MDKSDRETMIKVLMKLKLDRKLLDRMKDSEIQGLFSILNGYAI* |
| Ga0114898_10444834 | 3300008216 | Deep Ocean | MHKSDREVMIKVLMKLKLQRKLLDKLKDTEIQRLFSVLKRYTI* |
| Ga0114898_10479501 | 3300008216 | Deep Ocean | GFIMDKHDREVMIKELMKVKLQRKLLDKLKDSEIIRLFATLRRYMP* |
| Ga0114899_10070765 | 3300008217 | Deep Ocean | MDRHDREVMIKQLMKVRLRRKLLEKMRDSEIQNLFSTLKGYFR* |
| Ga0114899_10087274 | 3300008217 | Deep Ocean | MMYKNDREIMIKELMKLRLQRKLLDEMRDGEIRVLFSILKRYVK* |
| Ga0114899_10810063 | 3300008217 | Deep Ocean | MDKHDREVMIKELMRVKLQRKLLDKLKDSEIIRLFATLRRYMP* |
| Ga0114904_10662012 | 3300008218 | Deep Ocean | MDKHDREVMIKQLMKVRLRRKLLEKMRDSEIQNLFSTLKRYSR* |
| Ga0114905_10250575 | 3300008219 | Deep Ocean | MDRHDREVMIKQLMKVRLRRKLLEKMRDSEIQNLFSTLKRYSR* |
| Ga0114910_10121286 | 3300008220 | Deep Ocean | MDKHDREVMIKELMKVKLQRKLLDKLKDSEIIRLFATLRRYMP* |
| Ga0114996_100537938 | 3300009173 | Marine | MMDKNDRELMIKELMKLKLQRKILDVMRDTEIRRLFSILKRYVR* |
| Ga0114996_101610184 | 3300009173 | Marine | MDNNDRETMTKVLIKLKLDRKLLDRMKDSEIQGLFSILNGYAI* |
| Ga0114908_10550931 | 3300009418 | Deep Ocean | RETMIKSLMKLKLQRKLLDRLKDTEIQRLFSVLKGYSI* |
| Ga0115006_112697201 | 3300009544 | Marine | GGTMYKNDREVMIKELMKLKLQRKVLDVMGDREIRRLFSILKRYVK* |
| Ga0114900_10520261 | 3300009602 | Deep Ocean | MMYKNEREIIIKELMKLRLQRKLLDEMRDGEIRVLFSILKRY |
| Ga0105236_10093971 | 3300009619 | Marine Oceanic | DKHDREIKIKVLMKLKLQRKLLDEMRDGEIRVLFSILKRYVK* |
| Ga0105236_10192204 | 3300009619 | Marine Oceanic | MDKDDRETMIKSLMKLKLQRKLLDKLTDTEIQRLFSVLKRYTI* |
| Ga0105173_10522131 | 3300009622 | Marine Oceanic | MDKSDRETMIKVLIKLKLDRKLLDRMKDLEIQILFSTLNKYVTNEKN* |
| Ga0098049_10130451 | 3300010149 | Marine | MHKSDREVMTKLLMRLKLQRKLLDRLKDTEIQRLFSVLKRYTT* |
| Ga0098056_10628293 | 3300010150 | Marine | MHKSDREVMTKLLMRLKLQRKLLDRLKDTEIQRLFSVLKRYTI* |
| Ga0098061_13400401 | 3300010151 | Marine | MHKSDREVMTKLLMKLKLQRKLLDRLKDTEIQRLFSVLKRHTI* |
| Ga0114934_105142432 | 3300011013 | Deep Subsurface | MHKSDREVMIKVLMKLKLQRKLLDKLKDTEIQRLFSVLKGYTI* |
| Ga0181420_11539733 | 3300017757 | Seawater | MYKNDREVMIKELMKLKLQRKLLDEMRDGEIRVLFSILKRYVK |
| Ga0181430_10509055 | 3300017772 | Seawater | MDKHDREIMIKVLMELKLQRKVLDRMSDNEISSLFSLLKRYAT |
| Ga0181432_10957094 | 3300017775 | Seawater | MMDKNDRELMIKELMKLKLQRKILDMMRDTEIRRLFSILKRYVR |
| Ga0211600_100680010 | 3300020348 | Marine | MDKDDRETMIKSLMKLKLQRKLLDKLTDTEIQRLFSVLKGYSI |
| Ga0211599_10356215 | 3300020350 | Marine | MDKDDRETMIKSLMKLKLQRKLLDKLTDTEIQRLFSVLKG |
| Ga0211538_100413714 | 3300020364 | Marine | MDKHDREIMIKVLMELKLDRKLLDRMKDSEIQILFSTLNRHVTNEKN |
| Ga0232646_13311961 | 3300021978 | Hydrothermal Vent Fluids | MDKQDRETMIKVLIKLKLDRKLLDRMKDSEIQGLFSILNGYVTNEKN |
| Ga0187833_100229024 | 3300022225 | Seawater | MDKHDRETMIKVLMKLKLQRKILDRMRDNEISSLFSLLKKYVT |
| (restricted) Ga0233429_11565581 | 3300022902 | Seawater | MDKHDREIMIKVLMELKLQRKILDRMSDNEISSLFSLLKKYAT |
| (restricted) Ga0255049_103485132 | 3300024517 | Seawater | MDKNDRELMIKELMKLKLQRKVLDVMGDREIRRLFSILKRYVK |
| (restricted) Ga0255047_101024166 | 3300024520 | Seawater | MYKNDREIMIKELMKLKLQRKVLDVMGDREIRRLFSILKRYVK |
| Ga0207885_1123321 | 3300025027 | Marine | MDKSDRETMIKVLIKLKLDRKLLDRMKDSEIQGLFSILNGYVTNEKN |
| Ga0208670_1022765 | 3300025038 | Marine | MHKNDRETMIKELMKVKLRRKLLETMRDSEIQSLFSILKRYFR |
| Ga0207878_1225914 | 3300025039 | Marine | DREIMIEVLMELKLQRKILDRMSDNEISSLFSLLKKYAT |
| Ga0207889_10084163 | 3300025042 | Marine | MDKHDREIMIEVLMELKLQRKILDRMSDNEISSLFSLLKKYAT |
| Ga0208012_10368822 | 3300025066 | Marine | MDKYDRETMIKSLMKLKLQRKLLDRLKDTEIQRLFSVLKGYSI |
| Ga0208920_10093085 | 3300025072 | Marine | MHKSDREVMTKLLMRLKLQRKLLDRLKDTEIQRLFSVLKRYTI |
| Ga0208668_10165012 | 3300025078 | Marine | MHKGDREVMIKALMKLKLQRKLLDRLKDTEIQRLFSVLKRYTI |
| Ga0208156_10298944 | 3300025082 | Marine | MHKGDREVMIKALMKLKLQRKLLDRLKDTEIQRLFSILKRYTI |
| Ga0208013_10533412 | 3300025103 | Marine | MYKNDREIMIKELMKLKLQRKLLDEMRDGEIRVLFSILKRYVK |
| Ga0208553_10426071 | 3300025109 | Marine | DREVMTKLLMRLKLQRKLLDRLKDTEIQRLFSVLKRYTI |
| Ga0208158_10056387 | 3300025110 | Marine | MYKNDREIMIKELMKLKLQRKLLNEMRDGEIRVLFSILKRYVK |
| Ga0208158_10176091 | 3300025110 | Marine | KGDREVMTKLLMRLKLQRKLLDRLKDTEIQRLFSVLKRYTI |
| Ga0209349_10381425 | 3300025112 | Marine | MMYKNDREIMIKELMKLKLQRKLLDEMRDGEIRVLFSILKRYIK |
| Ga0208919_100980114 | 3300025128 | Marine | MMYKNDREIMIKELMKLKLQRKLLNEMRDGEIRVLFSILKRYVK |
| Ga0208919_10709933 | 3300025128 | Marine | MDRHDRETMIKVLMELKLQRKVLDRMNDNEISSLFSLLKRYAT |
| Ga0209128_11892901 | 3300025131 | Marine | MMDKHDREIKIKVLMKLKLQRKVLDKMSNNEISSLFSILKRYAT |
| Ga0208299_11762603 | 3300025133 | Marine | MDKNDREVMIKVLMKVKLQRKLLDKLTDTEIQRLFSVLKGYSI |
| Ga0209337_10152887 | 3300025168 | Marine | MYKNDREVMIQELIKLKLQRKLLDEMSDGEIRRLFSILKRYVK |
| Ga0208182_10083523 | 3300025251 | Deep Ocean | MDKSDRETMIKVLMKLKLDRKLLDRMKDSEIQGLFSILNGYAI |
| Ga0208182_10117124 | 3300025251 | Deep Ocean | MDKHDREVMIKELMRVKLQRKLLDKLKDSEIIRLFATLRRYMP |
| Ga0208182_10175235 | 3300025251 | Deep Ocean | MMYKNDREIMIKELMKLRLQRKLLDEMRDGEIRRLFSILKRYVK |
| Ga0208182_10397324 | 3300025251 | Deep Ocean | MDKHDREVMIKQLMKVRLRRKLLEKMRDSEIQNLFSTLKRYSR |
| Ga0207876_10151792 | 3300025259 | Deep Ocean | MDKQDRETMMKVLMKLKLDRKLLDRMKDSEIQILFSTLNKYVTNEKN |
| Ga0208029_10134077 | 3300025264 | Deep Ocean | MDKHDREVMIKELMKVKLQRKLLDKLKDSEIIRLFATLRRYMP |
| Ga0208029_10489474 | 3300025264 | Deep Ocean | MHKSDREVMIKVLMKLKLQRKLLDKLKDTEIQRLFSVLKRYTI |
| Ga0208179_10377351 | 3300025267 | Deep Ocean | GFIMDKHDREVMIKELMKVKLQRKLLDKLKDSEIIRLFATLRRYMP |
| Ga0208180_10625071 | 3300025277 | Deep Ocean | MMYKNDREIMIKELMKLRLQRKLLDGMRDGEIRVLFSILKRYVK |
| Ga0208449_10640772 | 3300025280 | Deep Ocean | MDRHDREVMIKQLMKVRLRRKLLEKMRDSEIQNLFSTLKGYFR |
| Ga0207903_10130394 | 3300025287 | Deep Ocean | MDKNDREVMIEQLMKLKLERKILDVMRDTEIRRLFSILKRYVK |
| Ga0208181_10477293 | 3300025300 | Deep Ocean | MDKHDREVMIKELMKVKLQRKLLDKLKDSEIIRLFATLRR |
| Ga0208450_10231744 | 3300025301 | Deep Ocean | MMYKNDREIMIKELMKLKLQRKLLDEMRDGEIRVLFSILKRYVK |
| Ga0208450_10457551 | 3300025301 | Deep Ocean | DKNDREVMIKALIKLKLKRKLLNKLKDTEIQRLFSVLKGYTI |
| Ga0208450_11090031 | 3300025301 | Deep Ocean | MHKSDREVMIKVLMKLKLQRKLLDKLKDTEIQRLFSVLKR |
| Ga0208684_10286472 | 3300025305 | Deep Ocean | MDRHDREVMIKQLMKVRLRRKLLEKMRDSEIQNLFSTLKRYSR |
| Ga0208451_10025234 | 3300026103 | Marine Oceanic | VDKNDRETMTEVLIKLKLDRKLLDRMKDSEIQGLFSILNGYAV |
| Ga0208560_10110193 | 3300026115 | Marine Oceanic | MDKDDRETMIKSLMKVKLQRKLLERLKDTEIQRLFSILKGHTA |
| Ga0207988_10064661 | 3300026206 | Marine | MDKHDRETMIKVLMKLKLERKILDRMRDNEISSLFSLLKKYVT |
| Ga0207989_11561763 | 3300026209 | Marine | MHKGDREVMTKLLMRLKLQRKLLDRLKDTEIQRLFSV |
| Ga0208407_10917772 | 3300026257 | Marine | MDKHDRKIMIKELMKVKLQKKLLDTLRDSEIVRLFGILRRHIP |
| Ga0209816_11853322 | 3300027704 | Marine | MMDKNDRELMIKELMKLKLQRKVLNMMRDTEIRRLFSILKRYVK |
| Ga0209089_105539201 | 3300027838 | Marine | MDNNDRETMTKVLIKLKLDRKLLDRMKDSEIQGLFSILNGYAI |
| Ga0209402_103945192 | 3300027847 | Marine | MDKNDRELMIKELMKLKLQRKILDVMRDTEIRRLFSILKRYVR |
| Ga0183748_10056746 | 3300029319 | Marine | MDKRDREIMVKELMKLKLQKKLLNKLKDSEIVILFGILRRHTL |
| Ga0302118_101720335 | 3300031627 | Marine | MMDKNDRELMIKELMKLKLQRKILDVMRDTEIRRLFSILKRYVR |
| Ga0326755_017709_156_302 | 3300034628 | Filtered Seawater | MMDKHDRETMIKVLMKLKLDRKLLDRMKDLEIQILFSTLNKYVTNEKN |
| Ga0326755_029952_161_292 | 3300034628 | Filtered Seawater | MYKNDREIMIEELMKLKLQRKLLDEMSDGEIRRLFSILKRYVK |
| Ga0326756_003795_499_633 | 3300034629 | Filtered Seawater | MMDKNDREVMIEQLMKLKLERKILDVMRDTEIRRLFSILKRYVK |
| Ga0326741_008190_517_660 | 3300034654 | Filtered Seawater | MDKSDRETMIKVLMKLKLDRKLLDRMKDSEIQGLFSILNGYVTNEKN |
| Ga0326741_082199_385_516 | 3300034654 | Filtered Seawater | MYKNDREIMIKELMKLRLQRKLLDEMRDGEIRRLFSILKRYVK |
| Ga0326748_022197_338_481 | 3300034656 | Filtered Seawater | MDKSDRETMIKVLMKLKLDRKLLDRMKDLEIQILFSTLNKYVTNEKN |
| Ga0326748_055551_350_493 | 3300034656 | Filtered Seawater | MDKSDRETMIKVLIKLKLDRKLLDRMKDSEIQGLFSILNGYITNEKN |
| ⦗Top⦘ |