


| Basic Information | |
|---|---|
| Family ID | F061246 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 132 |
| Average Sequence Length | 44 residues |
| Representative Sequence | FLAERHVGECPCRFDVMAIDNCPGQPPVVRLHKDAFSPQM |
| Number of Associated Samples | 113 |
| Number of Associated Scaffolds | 132 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 5.30 % |
| % of genes near scaffold ends (potentially truncated) | 87.88 % |
| % of genes from short scaffolds (< 2000 bps) | 87.12 % |
| Associated GOLD sequencing projects | 108 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.41 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (57.576 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (18.182 % of family members) |
| Environment Ontology (ENVO) | Unclassified (33.333 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (49.242 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 14.71% Coil/Unstructured: 85.29% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.41 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 132 Family Scaffolds |
|---|---|---|
| PF01087 | GalP_UDP_transf | 35.61 |
| PF16268 | DUF4921 | 12.12 |
| PF02744 | GalP_UDP_tr_C | 6.82 |
| PF00144 | Beta-lactamase | 3.79 |
| PF00072 | Response_reg | 3.03 |
| PF00202 | Aminotran_3 | 3.03 |
| PF11918 | Peptidase_S41_N | 1.52 |
| PF02021 | UPF0102 | 1.52 |
| PF03466 | LysR_substrate | 1.52 |
| PF16326 | ABC_tran_CTD | 0.76 |
| PF00380 | Ribosomal_S9 | 0.76 |
| PF02621 | VitK2_biosynth | 0.76 |
| PF01546 | Peptidase_M20 | 0.76 |
| PF00318 | Ribosomal_S2 | 0.76 |
| PF13529 | Peptidase_C39_2 | 0.76 |
| PF00990 | GGDEF | 0.76 |
| PF03065 | Glyco_hydro_57 | 0.76 |
| PF13520 | AA_permease_2 | 0.76 |
| PF13683 | rve_3 | 0.76 |
| PF01509 | TruB_N | 0.76 |
| PF01476 | LysM | 0.76 |
| PF01425 | Amidase | 0.76 |
| PF00126 | HTH_1 | 0.76 |
| PF00561 | Abhydrolase_1 | 0.76 |
| COG ID | Name | Functional Category | % Frequency in 132 Family Scaffolds |
|---|---|---|---|
| COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 3.79 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 3.79 |
| COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 3.79 |
| COG0792 | Predicted endonuclease distantly related to archaeal Holliday junction resolvase, YraN/UPF0102 family | Replication, recombination and repair [L] | 1.52 |
| COG0052 | Ribosomal protein S2 | Translation, ribosomal structure and biogenesis [J] | 0.76 |
| COG0103 | Ribosomal protein S9 | Translation, ribosomal structure and biogenesis [J] | 0.76 |
| COG0130 | tRNA U55 pseudouridine synthase TruB, may also work on U342 of tmRNA | Translation, ribosomal structure and biogenesis [J] | 0.76 |
| COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 0.76 |
| COG1427 | Chorismate dehydratase (menaquinone biosynthesis, futalosine pathway) | Coenzyme transport and metabolism [H] | 0.76 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 57.58 % |
| Unclassified | root | N/A | 42.42 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459002|FZY7DQ102G2WY7 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 527 | Open in IMG/M |
| 3300001593|JGI12635J15846_10038309 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 3759 | Open in IMG/M |
| 3300003223|JGI26343J46809_1001884 | All Organisms → cellular organisms → Bacteria | 1500 | Open in IMG/M |
| 3300004092|Ga0062389_102121341 | All Organisms → cellular organisms → Bacteria | 737 | Open in IMG/M |
| 3300004103|Ga0058903_1450794 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
| 3300005177|Ga0066690_10614932 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 725 | Open in IMG/M |
| 3300005542|Ga0070732_10162674 | All Organisms → cellular organisms → Bacteria | 1330 | Open in IMG/M |
| 3300005556|Ga0066707_10604820 | All Organisms → cellular organisms → Bacteria | 700 | Open in IMG/M |
| 3300005559|Ga0066700_10565592 | All Organisms → cellular organisms → Bacteria | 793 | Open in IMG/M |
| 3300005610|Ga0070763_10910879 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
| 3300005712|Ga0070764_10124891 | All Organisms → cellular organisms → Bacteria | 1396 | Open in IMG/M |
| 3300005952|Ga0080026_10224484 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300006086|Ga0075019_10730391 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
| 3300006172|Ga0075018_10079165 | All Organisms → cellular organisms → Bacteria | 1423 | Open in IMG/M |
| 3300006755|Ga0079222_10574345 | All Organisms → cellular organisms → Bacteria | 852 | Open in IMG/M |
| 3300006954|Ga0079219_10095588 | All Organisms → cellular organisms → Bacteria | 1443 | Open in IMG/M |
| 3300007265|Ga0099794_10201671 | Not Available | 1019 | Open in IMG/M |
| 3300007265|Ga0099794_10667961 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium | 552 | Open in IMG/M |
| 3300009088|Ga0099830_10695449 | Not Available | 837 | Open in IMG/M |
| 3300009137|Ga0066709_103568296 | Not Available | 564 | Open in IMG/M |
| 3300009519|Ga0116108_1008383 | All Organisms → cellular organisms → Bacteria | 4059 | Open in IMG/M |
| 3300009660|Ga0105854_1382912 | Not Available | 509 | Open in IMG/M |
| 3300010046|Ga0126384_10926379 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 789 | Open in IMG/M |
| 3300010321|Ga0134067_10007454 | All Organisms → cellular organisms → Bacteria | 3004 | Open in IMG/M |
| 3300010359|Ga0126376_12859951 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 532 | Open in IMG/M |
| 3300010360|Ga0126372_11421417 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 727 | Open in IMG/M |
| 3300010360|Ga0126372_12483302 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium | 569 | Open in IMG/M |
| 3300010360|Ga0126372_12562357 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Legionellales → Legionellaceae → Legionella → Legionella pneumophila | 561 | Open in IMG/M |
| 3300010362|Ga0126377_10296290 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1593 | Open in IMG/M |
| 3300012201|Ga0137365_10468567 | Not Available | 927 | Open in IMG/M |
| 3300012202|Ga0137363_10316105 | Not Available | 1285 | Open in IMG/M |
| 3300012202|Ga0137363_11334329 | Not Available | 606 | Open in IMG/M |
| 3300012205|Ga0137362_10083444 | All Organisms → cellular organisms → Bacteria | 2669 | Open in IMG/M |
| 3300012205|Ga0137362_10218892 | Not Available | 1641 | Open in IMG/M |
| 3300012350|Ga0137372_10013904 | All Organisms → cellular organisms → Bacteria | 7660 | Open in IMG/M |
| 3300012361|Ga0137360_10283684 | Not Available | 1371 | Open in IMG/M |
| 3300012361|Ga0137360_11252569 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 641 | Open in IMG/M |
| 3300012918|Ga0137396_11007989 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 602 | Open in IMG/M |
| 3300012923|Ga0137359_11458465 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium | 572 | Open in IMG/M |
| 3300012923|Ga0137359_11522465 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium | 557 | Open in IMG/M |
| 3300012925|Ga0137419_10585684 | Not Available | 895 | Open in IMG/M |
| 3300012927|Ga0137416_10679167 | Not Available | 903 | Open in IMG/M |
| 3300012931|Ga0153915_12887514 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 561 | Open in IMG/M |
| 3300014166|Ga0134079_10014791 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2436 | Open in IMG/M |
| 3300014199|Ga0181535_10265282 | Not Available | 1032 | Open in IMG/M |
| 3300014655|Ga0181516_10504046 | Not Available | 621 | Open in IMG/M |
| 3300015053|Ga0137405_1278855 | Not Available | 1396 | Open in IMG/M |
| 3300015197|Ga0167638_1021435 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1507 | Open in IMG/M |
| 3300015264|Ga0137403_10157521 | All Organisms → cellular organisms → Bacteria | 2232 | Open in IMG/M |
| 3300015264|Ga0137403_10560322 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1010 | Open in IMG/M |
| 3300016294|Ga0182041_11690342 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Legionellales → Legionellaceae → Legionella → Legionella pneumophila | 586 | Open in IMG/M |
| 3300017822|Ga0187802_10164089 | Not Available | 850 | Open in IMG/M |
| 3300017934|Ga0187803_10006251 | All Organisms → cellular organisms → Bacteria | 4720 | Open in IMG/M |
| 3300017934|Ga0187803_10408134 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium | 551 | Open in IMG/M |
| 3300017940|Ga0187853_10294318 | Not Available | 735 | Open in IMG/M |
| 3300017955|Ga0187817_10028675 | All Organisms → cellular organisms → Bacteria | 3356 | Open in IMG/M |
| 3300017994|Ga0187822_10059613 | Not Available | 1091 | Open in IMG/M |
| 3300018007|Ga0187805_10136710 | Not Available | 1113 | Open in IMG/M |
| 3300018018|Ga0187886_1157706 | Not Available | 898 | Open in IMG/M |
| 3300018085|Ga0187772_10168175 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1459 | Open in IMG/M |
| 3300018433|Ga0066667_11883718 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Legionellales → Legionellaceae → Legionella → Legionella pneumophila | 544 | Open in IMG/M |
| 3300018468|Ga0066662_11240630 | Not Available | 758 | Open in IMG/M |
| 3300018468|Ga0066662_12573247 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium | 537 | Open in IMG/M |
| 3300019789|Ga0137408_1382522 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Legionellales → Legionellaceae → Legionella → Legionella pneumophila | 935 | Open in IMG/M |
| 3300019890|Ga0193728_1142545 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1062 | Open in IMG/M |
| 3300020021|Ga0193726_1000049 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 236335 | Open in IMG/M |
| 3300020062|Ga0193724_1125385 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 505 | Open in IMG/M |
| 3300020199|Ga0179592_10297130 | Not Available | 718 | Open in IMG/M |
| 3300020583|Ga0210401_11012718 | Not Available | 689 | Open in IMG/M |
| 3300021088|Ga0210404_10164535 | Not Available | 1171 | Open in IMG/M |
| 3300021168|Ga0210406_10868806 | Not Available | 681 | Open in IMG/M |
| 3300021401|Ga0210393_11602091 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 516 | Open in IMG/M |
| 3300021420|Ga0210394_10065358 | Not Available | 3155 | Open in IMG/M |
| 3300021420|Ga0210394_11771429 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 515 | Open in IMG/M |
| 3300021433|Ga0210391_10189988 | Not Available | 1616 | Open in IMG/M |
| 3300021474|Ga0210390_10149817 | Not Available | 1964 | Open in IMG/M |
| 3300021478|Ga0210402_10939106 | Not Available | 792 | Open in IMG/M |
| 3300022557|Ga0212123_10003889 | All Organisms → cellular organisms → Bacteria | 29957 | Open in IMG/M |
| 3300024288|Ga0179589_10336161 | Not Available | 684 | Open in IMG/M |
| 3300025480|Ga0208688_1005009 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4358 | Open in IMG/M |
| 3300025898|Ga0207692_10363849 | All Organisms → cellular organisms → Bacteria | 894 | Open in IMG/M |
| 3300025922|Ga0207646_11131438 | Not Available | 688 | Open in IMG/M |
| 3300026281|Ga0209863_10234461 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300026297|Ga0209237_1077305 | Not Available | 1539 | Open in IMG/M |
| 3300026319|Ga0209647_1167108 | Not Available | 880 | Open in IMG/M |
| 3300026351|Ga0257170_1064427 | Not Available | 516 | Open in IMG/M |
| 3300026377|Ga0257171_1020398 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella tundricola | 1116 | Open in IMG/M |
| 3300026469|Ga0257169_1007334 | Not Available | 1318 | Open in IMG/M |
| 3300026496|Ga0257157_1056935 | Not Available | 661 | Open in IMG/M |
| 3300026499|Ga0257181_1020758 | Not Available | 975 | Open in IMG/M |
| 3300026552|Ga0209577_10205515 | Not Available | 1510 | Open in IMG/M |
| 3300026557|Ga0179587_10217956 | Not Available | 1213 | Open in IMG/M |
| 3300027173|Ga0208097_1013130 | Not Available | 910 | Open in IMG/M |
| 3300027546|Ga0208984_1015421 | Not Available | 1507 | Open in IMG/M |
| 3300027562|Ga0209735_1036922 | Not Available | 1032 | Open in IMG/M |
| 3300027565|Ga0209219_1132260 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 606 | Open in IMG/M |
| 3300027591|Ga0209733_1021123 | All Organisms → cellular organisms → Bacteria | 1757 | Open in IMG/M |
| 3300027660|Ga0209736_1001948 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 6813 | Open in IMG/M |
| 3300027684|Ga0209626_1156282 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium | 602 | Open in IMG/M |
| 3300027725|Ga0209178_1153805 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 795 | Open in IMG/M |
| 3300027727|Ga0209328_10001626 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 6268 | Open in IMG/M |
| 3300027795|Ga0209139_10175747 | Not Available | 758 | Open in IMG/M |
| 3300027812|Ga0209656_10062471 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2056 | Open in IMG/M |
| 3300027826|Ga0209060_10342878 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium | 681 | Open in IMG/M |
| 3300027846|Ga0209180_10778702 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 514 | Open in IMG/M |
| 3300027879|Ga0209169_10099632 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1504 | Open in IMG/M |
| 3300027879|Ga0209169_10143097 | Not Available | 1244 | Open in IMG/M |
| 3300027898|Ga0209067_10706780 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Aerophobetes → unclassified Aerophobetes → Candidatus Aerophobetes bacterium Ae_b3a | 584 | Open in IMG/M |
| 3300028047|Ga0209526_10286812 | All Organisms → cellular organisms → Bacteria | 1117 | Open in IMG/M |
| 3300028747|Ga0302219_10032293 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1955 | Open in IMG/M |
| 3300028906|Ga0308309_10711688 | Not Available | 872 | Open in IMG/M |
| 3300030057|Ga0302176_10239612 | Not Available | 726 | Open in IMG/M |
| 3300030399|Ga0311353_10600183 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 962 | Open in IMG/M |
| 3300030764|Ga0265720_1005349 | Not Available | 754 | Open in IMG/M |
| 3300031057|Ga0170834_112622704 | Not Available | 612 | Open in IMG/M |
| 3300031057|Ga0170834_113780090 | Not Available | 870 | Open in IMG/M |
| 3300031446|Ga0170820_17024064 | Not Available | 804 | Open in IMG/M |
| 3300031718|Ga0307474_10970935 | Not Available | 672 | Open in IMG/M |
| 3300031753|Ga0307477_10162982 | All Organisms → cellular organisms → Bacteria | 1554 | Open in IMG/M |
| 3300031754|Ga0307475_10362179 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1165 | Open in IMG/M |
| 3300031754|Ga0307475_10363622 | All Organisms → cellular organisms → Bacteria | 1163 | Open in IMG/M |
| 3300031754|Ga0307475_10663854 | Not Available | 832 | Open in IMG/M |
| 3300031754|Ga0307475_10999979 | Not Available | 657 | Open in IMG/M |
| 3300031823|Ga0307478_10930456 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 727 | Open in IMG/M |
| 3300031962|Ga0307479_10083283 | All Organisms → cellular organisms → Bacteria | 3096 | Open in IMG/M |
| 3300031962|Ga0307479_11695655 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 586 | Open in IMG/M |
| 3300032174|Ga0307470_10063563 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1956 | Open in IMG/M |
| 3300032180|Ga0307471_100836846 | Not Available | 1087 | Open in IMG/M |
| 3300032180|Ga0307471_101550206 | All Organisms → cellular organisms → Bacteria | 820 | Open in IMG/M |
| 3300032180|Ga0307471_101818283 | Not Available | 760 | Open in IMG/M |
| 3300033561|Ga0371490_1111274 | Not Available | 714 | Open in IMG/M |
| 3300034091|Ga0326724_0418213 | Not Available | 706 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 18.18% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 10.61% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 9.85% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 8.33% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 4.55% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.55% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 4.55% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.79% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 3.03% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.03% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.03% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.27% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.27% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.27% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 2.27% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.52% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.52% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 1.52% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.52% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.52% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 1.52% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.52% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 1.52% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.76% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.76% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.76% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.76% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.76% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.76% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.76% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459002 | Grass soil microbial communities from Rothamsted Park, UK - March 2009 direct MP BIO 1O1 lysis 0-21 cm | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300003223 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM2 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004103 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF242 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300005952 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-045 | Environmental | Open in IMG/M |
| 3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009519 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_150 | Environmental | Open in IMG/M |
| 3300009660 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-058 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
| 3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
| 3300014199 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_30_metaG | Environmental | Open in IMG/M |
| 3300014655 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_10_metaG | Environmental | Open in IMG/M |
| 3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015197 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G6B, Proglacial plain, adjacent to northern proglacial tributary) | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300017934 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3 | Environmental | Open in IMG/M |
| 3300017940 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_100 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017994 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2 | Environmental | Open in IMG/M |
| 3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
| 3300018018 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_150 | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300019890 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1 | Environmental | Open in IMG/M |
| 3300020021 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c1 | Environmental | Open in IMG/M |
| 3300020062 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a1 | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300025480 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026281 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 (SPAdes) | Environmental | Open in IMG/M |
| 3300026297 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026319 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026351 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-05-B | Environmental | Open in IMG/M |
| 3300026377 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-B | Environmental | Open in IMG/M |
| 3300026469 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-17-B | Environmental | Open in IMG/M |
| 3300026496 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-69-A | Environmental | Open in IMG/M |
| 3300026499 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-06-B | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027173 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF036 (SPAdes) | Environmental | Open in IMG/M |
| 3300027546 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027562 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027565 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027591 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027660 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027684 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027725 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes) | Environmental | Open in IMG/M |
| 3300027727 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027795 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027826 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
| 3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028747 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_2 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300030057 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_1 | Environmental | Open in IMG/M |
| 3300030399 | II_Palsa_E2 coassembly | Environmental | Open in IMG/M |
| 3300030764 | Metatranscriptome of plant litter microbial communities from Maridalen valley, Oslo, Norway - NLI1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300033561 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB28FN SIP fraction | Environmental | Open in IMG/M |
| 3300034091 | Peat soil microbial communities from McLean, Ithaca, NY, United States - MB00N | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| E1_07442770 | 2170459002 | Grass Soil | MERHVKECPVRFDVVAIEEFPGQAPVVRLHKNAFRPRM |
| JGI12635J15846_100383091 | 3300001593 | Forest Soil | MVVRTAQRFLAERHVRECPRRFDVVAIDNRPGSSPALRLHKDAFSPQL* |
| JGI26343J46809_10018842 | 3300003223 | Bog Forest Soil | LWERRVPECPCRFDVVAIDNSPGKPPIVRLHKDAFSPQM* |
| Ga0062389_1021213411 | 3300004092 | Bog Forest Soil | LFLMERRVPVCPCRFDVVAIDNEIGAAPVVRLHKDAFSPQM* |
| Ga0058903_14507941 | 3300004103 | Forest Soil | FLSERHVGNCPCRFDVLAIDNRPGMTPEVRLHKDAFSPQM* |
| Ga0066690_106149322 | 3300005177 | Soil | KQHVVARTAQRFLAERHVKDVSLRFDVLAIDNIPGSPPEVRLHKDAFSPQM* |
| Ga0070732_101626742 | 3300005542 | Surface Soil | HVRDCPCRFDVVAIDNRPGSPPELRLHKDAFSPQL* |
| Ga0066707_106048201 | 3300005556 | Soil | AQRFLAERHVKDIPLRFDVLAIDNIPGSPLEVRLHKDAFSPQM* |
| Ga0066700_105655922 | 3300005559 | Soil | TPESPCRFDVVAIDNKPGQPPEVRLHKGAFSPQI* |
| Ga0070763_109108791 | 3300005610 | Soil | RVRECPCRFDVVAIDNSPGKPPVVRLHKDAFSPEM* |
| Ga0070764_101248912 | 3300005712 | Soil | ERRVAECPCRFDVVAIDNSPGKPPVVRLHKDAFSPQM* |
| Ga0080026_102244841 | 3300005952 | Permafrost Soil | DCPTRFDVLAIDNVPGSHPVVRLHKDAFSPQWRRH* |
| Ga0075019_107303911 | 3300006086 | Watersheds | VGECPCRFDVMAIDNCPGKAPVVRLHKDAFSPKT* |
| Ga0075018_100791651 | 3300006172 | Watersheds | HVVVRTAQRFLAERHVGECPCRFDVMAIDNCPGQAPVVRLHKDAFSPQM* |
| Ga0079222_105743451 | 3300006755 | Agricultural Soil | ERHVKKCPVRFDVVAIDNTPGKPPVVRLRKDALGPRA* |
| Ga0079219_100955881 | 3300006954 | Agricultural Soil | RFLAERHVEECPLRFDVVAIDNHPGKPPVVRLHKDAFSPQLDRQF* |
| Ga0099794_102016712 | 3300007265 | Vadose Zone Soil | PELSVTREKQSVVIRTAQRFPAERRPPESPCWFDVVAIDNIPWQPPVVRLHKDAFGPQM* |
| Ga0099794_106679612 | 3300007265 | Vadose Zone Soil | FMAERHIKDCPLRFDVVAIEESPNGPPVVRLHKDAFHPVMQREI* |
| Ga0099830_106954492 | 3300009088 | Vadose Zone Soil | VTKEKQHVVVRTAQRFLAERHVGEGPCRFDVLAIDNYPGQPPIVRLHKDAFSPQI* |
| Ga0066709_1035682961 | 3300009137 | Grasslands Soil | ERHIRECPMRFDVVAIDNEPGRAPVVRLHKDAFSPQM* |
| Ga0116108_10083835 | 3300009519 | Peatland | AHYFLRERHLKECPLRFDVVAIDNTPGQPPAVRLHKAALSPQA* |
| Ga0105854_13829121 | 3300009660 | Permafrost Soil | DCPTRFDVLAIDNIPGQSPVVCLHKDAFSPQLRR* |
| Ga0126384_109263792 | 3300010046 | Tropical Forest Soil | TAKYFLSERHVRECPMRFDVLAIDNEPGRSPVVRLHKDAFSPQMR* |
| Ga0134067_100074541 | 3300010321 | Grasslands Soil | AERHVEECPLRFDVVAIDNLPGKPPVVRLHKDAFSPQLDRQY* |
| Ga0126376_128599511 | 3300010359 | Tropical Forest Soil | KQRVLVRTAQRFLAERHVAECPCRFDVLAIDNRPGQPPIVCLHKDAFSPDLGRRD* |
| Ga0126372_114214172 | 3300010360 | Tropical Forest Soil | AERHVKERSIRFDVLAIDNIPGRPPEVRLHKDAFSPQMY* |
| Ga0126372_124833021 | 3300010360 | Tropical Forest Soil | TAKRFLAERHVRDCPMRFDVVAIDNEPGRPPVVRLNKDALSPQM* |
| Ga0126372_125623571 | 3300010360 | Tropical Forest Soil | RTAQRFLAERHVKDGAIRFDVLAIDNIPGSPPEVRLHKDAFSPQM* |
| Ga0126377_102962901 | 3300010362 | Tropical Forest Soil | AQRFLSERHVKGTPLRFDGLAIDNLPGGPPEVRLHKDAFSPQI* |
| Ga0137365_104685671 | 3300012201 | Vadose Zone Soil | QRFLAERHVGESPCRFDVLAIDNYPGQPPIVRLHKDAFSPQI* |
| Ga0137363_103161052 | 3300012202 | Vadose Zone Soil | MERHVKECPLRFDVVAIEEFPGQSPVVRLHKNAFNPRI* |
| Ga0137363_113343291 | 3300012202 | Vadose Zone Soil | TAQRFLAERHIGDGPLRFDVLAIDNQPGHSPAVRLHKDAFSPQL* |
| Ga0137362_100834441 | 3300012205 | Vadose Zone Soil | VTEKQHVVARTARRFPAERHVKDIPLRFDVLAIDNIHGGPPEVRLHKDAFSPQI* |
| Ga0137362_102188921 | 3300012205 | Vadose Zone Soil | ERHVGESPCRFDVLAIDNYPGQPPIVRLHKDAFSPQI* |
| Ga0137372_100139041 | 3300012350 | Vadose Zone Soil | RFLAERHVGEGPCRFDVLAIDNYPGQPPIVRLHKDAFSPQI* |
| Ga0137360_102836841 | 3300012361 | Vadose Zone Soil | VGECPCRFDVMAIDNCPGQPPVVRLHKDAFSPQM* |
| Ga0137360_112525691 | 3300012361 | Vadose Zone Soil | MERHVKECPLRFDVVAIEEFPGQSPVVRLHQNAFNPR |
| Ga0137396_110079892 | 3300012918 | Vadose Zone Soil | VKKCPVRFDVVAIDNTPGKPPVVRLHKDALSPRA* |
| Ga0137359_114584652 | 3300012923 | Vadose Zone Soil | AERHIKDCPLRFDVVAIEESPNGPPVVRLHKDAFHPVMQREM* |
| Ga0137359_115224652 | 3300012923 | Vadose Zone Soil | AQRFLAERRTPESPYRFDVVAIDNKPGQPPEVRLHKDAFSPQM* |
| Ga0137419_105856841 | 3300012925 | Vadose Zone Soil | EKQLLVVCTAQRFLAERQGECPGRFDVMAIDNCPGQPPVVRLHKDAFSPQV* |
| Ga0137416_106791672 | 3300012927 | Vadose Zone Soil | VVIRTAQRFIAERHIGDGPLRFDVLAIDNQPGHSPAVRLHKDAFSPQL* |
| Ga0153915_128875141 | 3300012931 | Freshwater Wetlands | TAQVFLAGRRVPETVVRFDVLAIENHPGRAPVVRLHKDAFPAHL* |
| Ga0134079_100147911 | 3300014166 | Grasslands Soil | ECPLRFDVVAIDNHPGKPPVVRLHKDAFSPQLDRQY* |
| Ga0181535_102652821 | 3300014199 | Bog | RERHLKECPVRFDVVAIDNIPGQPPAVRLHKAALSPRA* |
| Ga0181516_105040462 | 3300014655 | Bog | RRVKAGPVRFDVVAIDNEMGRAPEVRLHKDAFSPEV* |
| Ga0137405_12788551 | 3300015053 | Vadose Zone Soil | KQHVVVRTAQRFLAERHVGECPCRFDVMAIDNCPGQPPVVRLHKDAFSPQM* |
| Ga0167638_10214351 | 3300015197 | Glacier Forefield Soil | RHPKNDTCRFDVLAIDNHPGMPPVVRLHKDAFSPQL* |
| Ga0137403_101575213 | 3300015264 | Vadose Zone Soil | MERHVKGCPVRFDVVAIEESHGQPPLVRLHKNAFNPRM* |
| Ga0137403_105603221 | 3300015264 | Vadose Zone Soil | MERHVKECPLRFDVVAIEEFPGQSPVVRLHKNAFNPRM* |
| Ga0182041_116903422 | 3300016294 | Soil | ARRFLAERHIKDTPLRFDVLAIDNIPGRPPEVRLHKDAFSPHL |
| Ga0187802_101640891 | 3300017822 | Freshwater Sediment | RTSKRFLAERHTGECPCRFDVLAIDNRPGQPPLVRLHKDAFSPQV |
| Ga0187803_100062516 | 3300017934 | Freshwater Sediment | FLAERHVGDCPCRFDVLAIDNRPGHAPVVRLHKDAFSPQS |
| Ga0187803_104081342 | 3300017934 | Freshwater Sediment | EHVLVRTAKRFLAERHTGECPCRFDVLAIDNRPGQPPLVRLHKDAFSPQV |
| Ga0187853_102943181 | 3300017940 | Peatland | HYFLRERHLKECPVRFDVVAIDNIPGQPPAVRLHKAALSPRA |
| Ga0187817_100286751 | 3300017955 | Freshwater Sediment | TAHYFLRERHIQPCPLRFDVVALENTPGQPPVVRLHKAALSPQLPVFAR |
| Ga0187822_100596131 | 3300017994 | Freshwater Sediment | AKHFLMERHVKECPMRFDVVAIDEMSGRAPEVRLHKAAFSPQM |
| Ga0187805_101367102 | 3300018007 | Freshwater Sediment | LRTAHYFLRERHIQPCPLRFDVVAIENTPGQPPVVRLHKAALSPQLPVFAR |
| Ga0187886_11577061 | 3300018018 | Peatland | RTAHYFLRERHLKECPLRFDVVAIDNTPGQPPAVRLHKAALSPQA |
| Ga0187772_101681751 | 3300018085 | Tropical Peatland | RHISPCPVRFDVIAIDNLPGHPPVVRLHKAALPPIIN |
| Ga0066667_118837182 | 3300018433 | Grasslands Soil | QHVVARTAQRFLAERHVKDIPLRFDVLAIDNIPGSPLEVRLHKDAFSPQM |
| Ga0066662_112406301 | 3300018468 | Grasslands Soil | QHVVIRTAQRFLAEHRVRECPCRFDVVAIDNRPGQPPMVRLHKDAFGPQV |
| Ga0066662_125732471 | 3300018468 | Grasslands Soil | ERRAGDNPVRFDVLAIDNRPGRPPEVRLHKDAFSSQI |
| Ga0137408_13825222 | 3300019789 | Vadose Zone Soil | QHVVARTARRFPAERHVKDIPLRFDVLAIDNIHGGPPEVRLHKDAFSPQI |
| Ga0193728_11425453 | 3300019890 | Soil | ADRHLSDCPCRFDVLAIDNIPGQLPAVRLHKDAFSPQLH |
| Ga0193726_1000049130 | 3300020021 | Soil | MLIRTARRFLADRRISDGRARFDVLAIDNVPGHPPNVRLHKDAFGPQLRR |
| Ga0193724_11253852 | 3300020062 | Soil | MLVRTAQRFLADRHLHDCPTCFDVLAIDNIPGRPPEIRLHKDAFSPQLRRSR |
| Ga0179592_102971302 | 3300020199 | Vadose Zone Soil | FLAERHVGECPMRFDVVAIDNEPGHPPVVRLHKDAFSPQM |
| Ga0210401_110127182 | 3300020583 | Soil | LVERRVPECPCRFDVVAIDNSPGKPPVVRLHKDAFSPQK |
| Ga0210404_101645352 | 3300021088 | Soil | FLAERHVGECPCRFDVMAIDNCPGQPPVVRLHKDAFSPKM |
| Ga0210406_108688062 | 3300021168 | Soil | AERHVRECPLRFDVVAIDNEPGHPPVVRLHKDAFSPQM |
| Ga0210393_116020911 | 3300021401 | Soil | LSVTRGKQHLLARTAQHFLAERRVRECPRRFDAVAIDNSPGKPPGVRLHKDAFSPQM |
| Ga0210394_100653584 | 3300021420 | Soil | YFLRERHIGECPMRFDVVAIDNAPGRLPLVRLHKDALSPRV |
| Ga0210394_117714291 | 3300021420 | Soil | RHVGDCPCRFDVLAIDNRPGMPPEVRLHKDAFSPQMS |
| Ga0210391_101899881 | 3300021433 | Soil | LASRHLNDCPTRFDALAIDNIPGRPPEIRLHKDAFSPQLRRSR |
| Ga0210390_101498173 | 3300021474 | Soil | RTARRFLGERHVGDCPCRFDVLAIDNRPGMPPEVRLHKDAFSPQIS |
| Ga0210402_109391061 | 3300021478 | Soil | LAERHVSNRPCRFDVLAIDNHPGHAPAVRLHKDAFSPQL |
| Ga0212123_1000388927 | 3300022557 | Iron-Sulfur Acid Spring | MDRHLRDCPTRFDVLAIDNIPGRPPKIRLHKDAFSPQIRRSR |
| Ga0179589_103361612 | 3300024288 | Vadose Zone Soil | FLAERHIGDGPLRFDVLAIDNQPGHAPAVRLHKDAFSPQL |
| Ga0208688_10050091 | 3300025480 | Peatland | AHYFLRERHLKECPLRFDVVAIDNTPGQPPAVRLHKAALSPQA |
| Ga0207692_103638491 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | AEKQHVVARTARRFLAERHVKDVPLRFDVLAINNIPASPPEVRLHKDAFSPQI |
| Ga0207646_111314382 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | VIRAARRFPGERHVRDCPCRFDVPAIDNRPGMPPEVRLHKDAFSPQM |
| Ga0209863_102344612 | 3300026281 | Prmafrost Soil | AERRVKESACRFDVLAIDNHPGLPPEVRLHKDAFSPQM |
| Ga0209237_10773051 | 3300026297 | Grasslands Soil | RVLVRTAQRFLRERRAGDNPVRFDVLAIDNRPGRPPEVRLHKDAFSSQI |
| Ga0209647_11671082 | 3300026319 | Grasslands Soil | RRFMAERHIKDCPLRFDVVAIEESPNGPPVVRLHKDAFHPVMPREM |
| Ga0257170_10644271 | 3300026351 | Soil | ITREKQHLVVRTAQRFLAERHVGECPCRFDVMAIDNCLGQPPVVRLHKDAFSPQI |
| Ga0257171_10203981 | 3300026377 | Soil | RHVKKCPVRFDVVAIDNTPGKPPVVRLHKDALSRRA |
| Ga0257169_10073341 | 3300026469 | Soil | LMERHVEECPVRFAVVAIEEFSGQAPVVRLHKNAFNPRM |
| Ga0257157_10569351 | 3300026496 | Soil | FLAERHVGECPCRFDVMAIDNCPGQPPVVRLHKDAFSPQM |
| Ga0257181_10207582 | 3300026499 | Soil | QRIVIRTAQRFLAERRTPESPYRFDVVAIDNKPGQPPEVRLHKDAFSPQM |
| Ga0209577_102055153 | 3300026552 | Soil | TREKQHVVVRTAQRFLAERHVGECPCRFDVTADVTAMDNCPGQPPVVRLHKDAFSPQV |
| Ga0179587_102179561 | 3300026557 | Vadose Zone Soil | FLADRHVSNRPCRFDVLAIDNHPGHSPAVRLHKDAFSPQL |
| Ga0208097_10131301 | 3300027173 | Forest Soil | KQHLVVRTAQRFLAERHIGDCSCRFDVVAIDNRAGQPPVARLHKDAFSPQI |
| Ga0208984_10154213 | 3300027546 | Forest Soil | GLPELSVSYARQSVLVRTAQRFLADRHLRDCPMRLDVLAIDNIPGRPPEIRLHKDA |
| Ga0209735_10369221 | 3300027562 | Forest Soil | HDCPTRFDVLAIDNIPRRPPEIRPHKDAFSPQWRGSR |
| Ga0209219_11322602 | 3300027565 | Forest Soil | RLVIRTAQRFIAERHINTDPCRFDVLAIDNQPGHSPEVRLHKDAFSAQL |
| Ga0209733_10211231 | 3300027591 | Forest Soil | SVTTDKQRVVIRTAQRFLAERHVSSDSCRFDVLAIDNHPGHAPEVRLHKDAFSPQL |
| Ga0209736_10019485 | 3300027660 | Forest Soil | MVVRTAQRFLAERHVRECPRRFDVVAIDNRPGSSPALRLHKDAFSPQL |
| Ga0209626_11562822 | 3300027684 | Forest Soil | LVHTAQRFLADRHLHDSPTRFDVLAIDNIPGRPPEIRLHKDAFSPQLRRSR |
| Ga0209178_11538051 | 3300027725 | Agricultural Soil | RTARRFLAERHVKDCPCRFDVVAIDNSPGRPPEVRLHKDAFSPQFRRPF |
| Ga0209328_100016262 | 3300027727 | Forest Soil | VLVRTAQRFLADRQLHDCTTRFDVLAIDNILGHQLEIRLHKDAFSPQLRRSR |
| Ga0209139_101757471 | 3300027795 | Bog Forest Soil | ARTAKLFLMERRVAVCPCRFDVVAIDNEVGRPPVVRLHKDAFSPQM |
| Ga0209656_100624714 | 3300027812 | Bog Forest Soil | VTPGKQHVLARTAQHFLAERRVPECPCRFDVVAIDNVSGKPPLLRLHKDASSPQM |
| Ga0209060_103428781 | 3300027826 | Surface Soil | ERHMPELPCRFDVVAIDNEPGRPPELRLHKDAFSPQLRE |
| Ga0209180_107787022 | 3300027846 | Vadose Zone Soil | SITTDKQRLVTRTAQRFLAERHVGDGPLRFDVLAIDNKPGHSPAVRLHKDAFSPQL |
| Ga0209169_100996323 | 3300027879 | Soil | QRLVVRTALRFLGERHVKECPCRFDVVAIDNYMGMPPELRLHKDAFSAHIDHW |
| Ga0209169_101430972 | 3300027879 | Soil | ERRVAECPCRFDVVAIDNSPGKPPVVRLHKDAFSPQM |
| Ga0209067_107067802 | 3300027898 | Watersheds | HLVVRTAQRFLAERHVGECPCRFDVMAIDNCPGKAPVVRLHKDAFSPKT |
| Ga0209526_102868121 | 3300028047 | Forest Soil | MHGDRVVVRTAWRFLSERHVGNCPCRFDVLAIDNRPGMTPEVRLHKDAFSPQM |
| Ga0302219_100322931 | 3300028747 | Palsa | FLRERRIKSDCPLRFDVVAIDNEIGRSPIVRLHKDAFSPQV |
| Ga0308309_107116882 | 3300028906 | Soil | GERHVKECPCRFDVVAIDNRVGAPPEIRLHKDAFSPQLKAW |
| Ga0302176_102396122 | 3300030057 | Palsa | MHERRVKAGPVRFDVVAIDNEIGRAPEVRLHKDAFSPEV |
| Ga0311353_106001832 | 3300030399 | Palsa | KQQMLVRTAKLFMHERRVKAGPVRFDVVAIDNEIGRAPEVRLHKDAFSPEV |
| Ga0265720_10053491 | 3300030764 | Soil | HVLARTAQHFLAERRVPECPCRFDVVAIDNSPGKPPVVRLHKDAFSPQM |
| Ga0170834_1126227041 | 3300031057 | Forest Soil | RHVKEGPVRFDGVAIEELPGQAPLVRLHKNAFNPRI |
| Ga0170834_1137800901 | 3300031057 | Forest Soil | REKQHVVVRTAQRFLAERHVGECPCRFDVMAIDNCPGQPPVVRLHKDAFSPRV |
| Ga0170820_170240642 | 3300031446 | Forest Soil | HVKKCPVRFDVVAIDDTPGKPPLVRLHRDALSPRA |
| Ga0307474_109709352 | 3300031718 | Hardwood Forest Soil | AKMFLMERRMKECPCRFDVLAIDNEIGRAPVVRLHKDAFSPQM |
| Ga0307477_101629823 | 3300031753 | Hardwood Forest Soil | RVVARTAQRFLAERHVSNRPCRFDVLAIDNHPGHAPAVRLHKDAFSPQL |
| Ga0307475_103621791 | 3300031754 | Hardwood Forest Soil | VRTAQLFLASRHLNDCPTRFDVLAIDNILGRPPEIRLHKDAFSPPLRRSR |
| Ga0307475_103636223 | 3300031754 | Hardwood Forest Soil | DKQRVVVRTARRFLSERHAGNCPCRFDVLAIDNRPGMTPEVRLHKDAFSPQM |
| Ga0307475_106638542 | 3300031754 | Hardwood Forest Soil | LAERHVSDRPCRFDVLAIDNHPGHAPAVRLHKDAFSPQL |
| Ga0307475_109999792 | 3300031754 | Hardwood Forest Soil | RTAQRFLAERHVSNRPCRFDVLAIDNRPGHSPAVRLHKDAFSPQL |
| Ga0307478_109304561 | 3300031823 | Hardwood Forest Soil | VLVCTAQRFLADRHLNDCPTRFDVLAIDNIPGHPPQIRLHKDTFSPQLRRSR |
| Ga0307479_100832836 | 3300031962 | Hardwood Forest Soil | ARTAQRFLAERHVSDRPCRFDVLAIDNRPGRSPAVRLHKDAFSPQL |
| Ga0307479_116956551 | 3300031962 | Hardwood Forest Soil | QHLVVRTAQRFMAERHVGECPCRFDVMAIDNRPGKAPVVRLHKDAFSPKM |
| Ga0307470_100635633 | 3300032174 | Hardwood Forest Soil | MERHVKECPLRFDVVAIEEFPGQSPVVRLHKNAFNPRM |
| Ga0307471_1008368462 | 3300032180 | Hardwood Forest Soil | HAGDCPCRFDVLAIDNCPGHPPAVRLHKDAFSPQQ |
| Ga0307471_1015502062 | 3300032180 | Hardwood Forest Soil | MSIWAKRFLAERHVKDIPLRFDVLAIDNIPGSPPEVRLHKDAFSPQM |
| Ga0307471_1018182832 | 3300032180 | Hardwood Forest Soil | KQRVVIRTAQRFLAERRAPESPYRFDVVAIDNKPGQPPTVRLHKDAFSPQM |
| Ga0371490_11112741 | 3300033561 | Peat Soil | AHYFLRERHLKECPLRFDVVAIDNTPGKAPIVRLHKAALSPRA |
| Ga0326724_0418213_1_114 | 3300034091 | Peat Soil | ERHLKECPVRFDVVAIDNTPGQAPVVRLHKAALSPRA |
| ⦗Top⦘ |