


| Basic Information | |
|---|---|
| Family ID | F061158 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 132 |
| Average Sequence Length | 45 residues |
| Representative Sequence | FEVIADGERIAERGGNWLTRSFGAGYPDLDSVVEQLEKRRASGAAR |
| Number of Associated Samples | 113 |
| Number of Associated Scaffolds | 132 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 8.53 % |
| % of genes near scaffold ends (potentially truncated) | 68.94 % |
| % of genes from short scaffolds (< 2000 bps) | 87.12 % |
| Associated GOLD sequencing projects | 103 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.39 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (84.091 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (9.848 % of family members) |
| Environment Ontology (ENVO) | Unclassified (28.788 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (45.455 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 29.73% β-sheet: 9.46% Coil/Unstructured: 60.81% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.39 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 132 Family Scaffolds |
|---|---|---|
| PF01740 | STAS | 3.79 |
| PF07676 | PD40 | 3.03 |
| PF01887 | SAM_HAT_N | 2.27 |
| PF07505 | DUF5131 | 2.27 |
| PF04456 | DUF503 | 2.27 |
| PF00072 | Response_reg | 1.52 |
| PF01979 | Amidohydro_1 | 1.52 |
| PF12680 | SnoaL_2 | 1.52 |
| PF13620 | CarboxypepD_reg | 1.52 |
| PF08818 | DUF1801 | 1.52 |
| PF14559 | TPR_19 | 1.52 |
| PF14279 | HNH_5 | 1.52 |
| PF14534 | DUF4440 | 1.52 |
| PF00291 | PALP | 0.76 |
| PF01648 | ACPS | 0.76 |
| PF01663 | Phosphodiest | 0.76 |
| PF12034 | DUF3520 | 0.76 |
| PF00300 | His_Phos_1 | 0.76 |
| PF01084 | Ribosomal_S18 | 0.76 |
| PF02604 | PhdYeFM_antitox | 0.76 |
| PF00526 | Dicty_CTDC | 0.76 |
| PF03976 | PPK2 | 0.76 |
| PF13418 | Kelch_4 | 0.76 |
| PF00107 | ADH_zinc_N | 0.76 |
| PF03948 | Ribosomal_L9_C | 0.76 |
| PF07228 | SpoIIE | 0.76 |
| PF11005 | DUF2844 | 0.76 |
| PF00578 | AhpC-TSA | 0.76 |
| PF01656 | CbiA | 0.76 |
| PF13180 | PDZ_2 | 0.76 |
| PF00486 | Trans_reg_C | 0.76 |
| PF03544 | TonB_C | 0.76 |
| PF01494 | FAD_binding_3 | 0.76 |
| PF02371 | Transposase_20 | 0.76 |
| PF02954 | HTH_8 | 0.76 |
| PF00589 | Phage_integrase | 0.76 |
| PF13671 | AAA_33 | 0.76 |
| PF03169 | OPT | 0.76 |
| PF13795 | HupE_UreJ_2 | 0.76 |
| PF02517 | Rce1-like | 0.76 |
| PF00166 | Cpn10 | 0.76 |
| PF14329 | DUF4386 | 0.76 |
| PF13520 | AA_permease_2 | 0.76 |
| PF10012 | DUF2255 | 0.76 |
| PF13683 | rve_3 | 0.76 |
| COG ID | Name | Functional Category | % Frequency in 132 Family Scaffolds |
|---|---|---|---|
| COG4422 | Bacteriophage protein gp37 | Mobilome: prophages, transposons [X] | 2.27 |
| COG1550 | Stress-induced protein YlxP, DUF503 family | Function unknown [S] | 2.27 |
| COG1912 | Stereoselective (R,S)-S-adenosylmethionine hydrolase (adenosine-forming) | Defense mechanisms [V] | 2.27 |
| COG4430 | Uncharacterized conserved protein YdeI, YjbR/CyaY-like superfamily, DUF1801 family | Function unknown [S] | 1.52 |
| COG5646 | Iron-binding protein Fra/YdhG, frataxin family (Fe-S cluster biosynthesis) | Posttranslational modification, protein turnover, chaperones [O] | 1.52 |
| COG5649 | Uncharacterized conserved protein, DUF1801 domain | Function unknown [S] | 1.52 |
| COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 1.52 |
| COG2161 | Antitoxin component YafN of the YafNO toxin-antitoxin module, PHD/YefM family | Defense mechanisms [V] | 0.76 |
| COG2326 | Polyphosphate kinase 2, PPK2 family | Energy production and conversion [C] | 0.76 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.76 |
| COG4118 | Antitoxin component of toxin-antitoxin stability system, DNA-binding transcriptional repressor | Defense mechanisms [V] | 0.76 |
| COG4449 | Predicted protease, Abi (CAAX) family | General function prediction only [R] | 0.76 |
| COG0234 | Co-chaperonin GroES (HSP10) | Posttranslational modification, protein turnover, chaperones [O] | 0.76 |
| COG0238 | Ribosomal protein S18 | Translation, ribosomal structure and biogenesis [J] | 0.76 |
| COG0359 | Ribosomal protein L9 | Translation, ribosomal structure and biogenesis [J] | 0.76 |
| COG0578 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.76 |
| COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 0.76 |
| COG0665 | Glycine/D-amino acid oxidase (deaminating) | Amino acid transport and metabolism [E] | 0.76 |
| COG0810 | Periplasmic protein TonB, links inner and outer membranes | Cell wall/membrane/envelope biogenesis [M] | 0.76 |
| COG1266 | Membrane protease YdiL, CAAX protease family | Posttranslational modification, protein turnover, chaperones [O] | 0.76 |
| COG1297 | Predicted oligopeptide transporter, OPT family | General function prediction only [R] | 0.76 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 84.09 % |
| Unclassified | root | N/A | 15.91 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2189573004|GZGWRS402FQEJ3 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 549 | Open in IMG/M |
| 3300000724|JGI12581J11935_102026 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 732 | Open in IMG/M |
| 3300003218|JGI26339J46600_10007760 | All Organisms → cellular organisms → Bacteria | 3135 | Open in IMG/M |
| 3300003219|JGI26341J46601_10011703 | Not Available | 2873 | Open in IMG/M |
| 3300003351|JGI26346J50198_1034329 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300003372|JGI26336J50218_1009615 | All Organisms → cellular organisms → Bacteria | 664 | Open in IMG/M |
| 3300004005|Ga0055448_10229301 | Not Available | 728 | Open in IMG/M |
| 3300004091|Ga0062387_101374048 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
| 3300004092|Ga0062389_100283161 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium | 1711 | Open in IMG/M |
| 3300004092|Ga0062389_103125604 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 620 | Open in IMG/M |
| 3300005328|Ga0070676_10340454 | Not Available | 1028 | Open in IMG/M |
| 3300005439|Ga0070711_100385345 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1134 | Open in IMG/M |
| 3300005467|Ga0070706_101706141 | Not Available | 573 | Open in IMG/M |
| 3300005532|Ga0070739_10052370 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2636 | Open in IMG/M |
| 3300005534|Ga0070735_10336608 | All Organisms → cellular organisms → Bacteria | 907 | Open in IMG/M |
| 3300005547|Ga0070693_100523048 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 845 | Open in IMG/M |
| 3300005591|Ga0070761_10130188 | All Organisms → cellular organisms → Bacteria | 1465 | Open in IMG/M |
| 3300005616|Ga0068852_100155446 | All Organisms → cellular organisms → Bacteria | 2130 | Open in IMG/M |
| 3300005617|Ga0068859_101125358 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 864 | Open in IMG/M |
| 3300005843|Ga0068860_100314309 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 1536 | Open in IMG/M |
| 3300005843|Ga0068860_100647204 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1065 | Open in IMG/M |
| 3300006050|Ga0075028_100357322 | Not Available | 826 | Open in IMG/M |
| 3300006059|Ga0075017_101234769 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 586 | Open in IMG/M |
| 3300006086|Ga0075019_10164467 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1302 | Open in IMG/M |
| 3300006102|Ga0075015_100011356 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3763 | Open in IMG/M |
| 3300006102|Ga0075015_100226496 | All Organisms → cellular organisms → Bacteria | 1004 | Open in IMG/M |
| 3300006162|Ga0075030_101303468 | Not Available | 570 | Open in IMG/M |
| 3300006174|Ga0075014_100283211 | Not Available | 868 | Open in IMG/M |
| 3300006175|Ga0070712_101114116 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3 | 685 | Open in IMG/M |
| 3300006237|Ga0097621_102184946 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 529 | Open in IMG/M |
| 3300006844|Ga0075428_100245897 | All Organisms → cellular organisms → Bacteria | 1929 | Open in IMG/M |
| 3300006854|Ga0075425_100183674 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2402 | Open in IMG/M |
| 3300006854|Ga0075425_102828457 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300006904|Ga0075424_100336195 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1608 | Open in IMG/M |
| 3300006904|Ga0075424_100382128 | All Organisms → cellular organisms → Bacteria | 1501 | Open in IMG/M |
| 3300009087|Ga0105107_10833754 | Not Available | 642 | Open in IMG/M |
| 3300009162|Ga0075423_11565842 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 708 | Open in IMG/M |
| 3300010048|Ga0126373_10601090 | All Organisms → cellular organisms → Bacteria | 1152 | Open in IMG/M |
| 3300010343|Ga0074044_10358300 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → unclassified Granulicella → Granulicella sp. WH15 | 957 | Open in IMG/M |
| 3300010366|Ga0126379_11501288 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 779 | Open in IMG/M |
| 3300010373|Ga0134128_12477556 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 572 | Open in IMG/M |
| 3300010399|Ga0134127_12643827 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
| 3300010400|Ga0134122_11365892 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 720 | Open in IMG/M |
| 3300010403|Ga0134123_11100549 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 818 | Open in IMG/M |
| 3300010403|Ga0134123_12107595 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
| 3300011120|Ga0150983_11608886 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300011120|Ga0150983_13422053 | All Organisms → cellular organisms → Bacteria | 698 | Open in IMG/M |
| 3300011120|Ga0150983_16606757 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 766 | Open in IMG/M |
| 3300011430|Ga0137423_1132567 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 748 | Open in IMG/M |
| 3300012096|Ga0137389_11007877 | Not Available | 714 | Open in IMG/M |
| 3300012189|Ga0137388_10474468 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1161 | Open in IMG/M |
| 3300012202|Ga0137363_10934075 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 736 | Open in IMG/M |
| 3300012206|Ga0137380_10784610 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 823 | Open in IMG/M |
| 3300012361|Ga0137360_10668318 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis → Candidatus Koribacter versatilis Ellin345 | 891 | Open in IMG/M |
| 3300012361|Ga0137360_10985615 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 727 | Open in IMG/M |
| 3300012362|Ga0137361_10341233 | All Organisms → cellular organisms → Bacteria | 1374 | Open in IMG/M |
| 3300012582|Ga0137358_10002055 | All Organisms → cellular organisms → Bacteria | 11283 | Open in IMG/M |
| 3300012925|Ga0137419_10583253 | All Organisms → cellular organisms → Bacteria | 896 | Open in IMG/M |
| 3300012929|Ga0137404_11861717 | Not Available | 560 | Open in IMG/M |
| 3300012930|Ga0137407_10049757 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3396 | Open in IMG/M |
| 3300012984|Ga0164309_10578114 | All Organisms → cellular organisms → Bacteria | 874 | Open in IMG/M |
| 3300014200|Ga0181526_10117643 | All Organisms → cellular organisms → Bacteria | 1700 | Open in IMG/M |
| 3300014501|Ga0182024_12733090 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 527 | Open in IMG/M |
| 3300017823|Ga0187818_10081144 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1400 | Open in IMG/M |
| 3300017943|Ga0187819_10296861 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 939 | Open in IMG/M |
| 3300017955|Ga0187817_10252358 | Not Available | 1124 | Open in IMG/M |
| 3300017970|Ga0187783_10883342 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 644 | Open in IMG/M |
| 3300017970|Ga0187783_11125643 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 565 | Open in IMG/M |
| 3300017972|Ga0187781_10007225 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 8141 | Open in IMG/M |
| 3300017972|Ga0187781_10180648 | All Organisms → cellular organisms → Bacteria | 1486 | Open in IMG/M |
| 3300018006|Ga0187804_10171076 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 921 | Open in IMG/M |
| 3300018006|Ga0187804_10199906 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 854 | Open in IMG/M |
| 3300018012|Ga0187810_10066943 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → unclassified Granulicella → Granulicella sp. WH15 | 1376 | Open in IMG/M |
| 3300018089|Ga0187774_11243180 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae | 536 | Open in IMG/M |
| 3300019284|Ga0187797_1150643 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 618 | Open in IMG/M |
| 3300020579|Ga0210407_10068568 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → unclassified Edaphobacter → Edaphobacter sp. 4G125 | 2660 | Open in IMG/M |
| 3300020579|Ga0210407_10765757 | All Organisms → cellular organisms → Bacteria | 746 | Open in IMG/M |
| 3300020580|Ga0210403_10897175 | All Organisms → cellular organisms → Bacteria | 699 | Open in IMG/M |
| 3300020583|Ga0210401_10181193 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1962 | Open in IMG/M |
| 3300021181|Ga0210388_11356983 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
| 3300021420|Ga0210394_10042308 | All Organisms → cellular organisms → Bacteria | 4012 | Open in IMG/M |
| 3300021420|Ga0210394_11700981 | Not Available | 528 | Open in IMG/M |
| 3300021433|Ga0210391_10324604 | All Organisms → cellular organisms → Bacteria | 1208 | Open in IMG/M |
| 3300022532|Ga0242655_10272396 | Not Available | 543 | Open in IMG/M |
| 3300022717|Ga0242661_1134146 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
| 3300023250|Ga0224544_1007811 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1441 | Open in IMG/M |
| 3300024254|Ga0247661_1009159 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1632 | Open in IMG/M |
| 3300025311|Ga0209343_10600835 | All Organisms → cellular organisms → Bacteria | 660 | Open in IMG/M |
| 3300025915|Ga0207693_10458508 | All Organisms → cellular organisms → Bacteria | 996 | Open in IMG/M |
| 3300026041|Ga0207639_11622786 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 606 | Open in IMG/M |
| 3300026557|Ga0179587_10557361 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 753 | Open in IMG/M |
| 3300026760|Ga0207630_107756 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300026845|Ga0207760_121663 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300026869|Ga0207821_1008961 | All Organisms → cellular organisms → Bacteria | 1057 | Open in IMG/M |
| 3300026887|Ga0207805_1032173 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 504 | Open in IMG/M |
| 3300026921|Ga0207860_1020361 | Not Available | 806 | Open in IMG/M |
| 3300027645|Ga0209117_1073820 | Not Available | 965 | Open in IMG/M |
| 3300027655|Ga0209388_1037144 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1401 | Open in IMG/M |
| 3300027773|Ga0209810_1088750 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1427 | Open in IMG/M |
| 3300027783|Ga0209448_10049330 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1416 | Open in IMG/M |
| 3300027812|Ga0209656_10239141 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 863 | Open in IMG/M |
| 3300027818|Ga0209706_10417459 | Not Available | 622 | Open in IMG/M |
| 3300027829|Ga0209773_10386637 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 581 | Open in IMG/M |
| 3300027911|Ga0209698_10585789 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella aggregans | 858 | Open in IMG/M |
| 3300027986|Ga0209168_10236154 | All Organisms → cellular organisms → Bacteria | 907 | Open in IMG/M |
| 3300028746|Ga0302233_10201377 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 761 | Open in IMG/M |
| 3300028906|Ga0308309_10631471 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria | 930 | Open in IMG/M |
| 3300029636|Ga0222749_10580308 | All Organisms → cellular organisms → Bacteria | 611 | Open in IMG/M |
| 3300031231|Ga0170824_109874840 | Not Available | 739 | Open in IMG/M |
| 3300031231|Ga0170824_123940545 | All Organisms → cellular organisms → Bacteria | 1227 | Open in IMG/M |
| 3300031446|Ga0170820_11001304 | All Organisms → cellular organisms → Bacteria | 1442 | Open in IMG/M |
| 3300031715|Ga0307476_10412320 | All Organisms → cellular organisms → Bacteria | 998 | Open in IMG/M |
| 3300031715|Ga0307476_10593130 | All Organisms → cellular organisms → Bacteria | 821 | Open in IMG/M |
| 3300031720|Ga0307469_10328037 | All Organisms → cellular organisms → Bacteria | 1274 | Open in IMG/M |
| 3300031753|Ga0307477_10567177 | All Organisms → cellular organisms → Bacteria | 767 | Open in IMG/M |
| 3300031753|Ga0307477_10582908 | All Organisms → cellular organisms → Bacteria | 755 | Open in IMG/M |
| 3300031754|Ga0307475_11290235 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 566 | Open in IMG/M |
| 3300031820|Ga0307473_10785808 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 677 | Open in IMG/M |
| 3300031823|Ga0307478_10182600 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1680 | Open in IMG/M |
| 3300031954|Ga0306926_10983979 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 1005 | Open in IMG/M |
| 3300031962|Ga0307479_10449152 | All Organisms → cellular organisms → Bacteria | 1273 | Open in IMG/M |
| 3300032180|Ga0307471_102708493 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 629 | Open in IMG/M |
| 3300032782|Ga0335082_11671865 | Not Available | 510 | Open in IMG/M |
| 3300032782|Ga0335082_11717396 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300032892|Ga0335081_11587888 | All Organisms → cellular organisms → Bacteria | 719 | Open in IMG/M |
| 3300032895|Ga0335074_10348924 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1647 | Open in IMG/M |
| 3300032898|Ga0335072_10012383 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 12174 | Open in IMG/M |
| 3300032898|Ga0335072_10186088 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2485 | Open in IMG/M |
| 3300033134|Ga0335073_10224723 | All Organisms → cellular organisms → Bacteria | 2310 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 9.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 9.85% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 7.58% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 7.58% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 6.06% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 5.30% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 4.55% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 4.55% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.55% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 3.79% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.79% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.79% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 3.03% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.03% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.27% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.27% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 1.52% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.52% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.52% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.52% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.76% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater | 0.76% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.76% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.76% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 0.76% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.76% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.76% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.76% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.76% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.76% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.76% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.76% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.76% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.76% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.76% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.76% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2189573004 | Grass soil microbial communities from Rothamsted Park, UK - FG2 (Nitrogen) | Environmental | Open in IMG/M |
| 3300000724 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 29 | Environmental | Open in IMG/M |
| 3300003218 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 | Environmental | Open in IMG/M |
| 3300003219 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 | Environmental | Open in IMG/M |
| 3300003351 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 | Environmental | Open in IMG/M |
| 3300003372 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM1 | Environmental | Open in IMG/M |
| 3300004005 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Galinas_PWA_D2 | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005532 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1 | Environmental | Open in IMG/M |
| 3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
| 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005836 | Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBB | Environmental | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300009087 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011430 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT600_2 | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300014200 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018012 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5 | Environmental | Open in IMG/M |
| 3300018089 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300019284 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300022532 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022717 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-11-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300023250 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P1 10-14 | Environmental | Open in IMG/M |
| 3300024254 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK02 | Environmental | Open in IMG/M |
| 3300025311 | Groundwater microbial communities from Rifle, Colorado - Rifle CSP2_plank lowO2_0.2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300026760 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-SCHO22-B (SPAdes) | Environmental | Open in IMG/M |
| 3300026845 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 24 (SPAdes) | Environmental | Open in IMG/M |
| 3300026869 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 53 (SPAdes) | Environmental | Open in IMG/M |
| 3300026887 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 49 (SPAdes) | Environmental | Open in IMG/M |
| 3300026921 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 28 (SPAdes) | Environmental | Open in IMG/M |
| 3300027011 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 29 (SPAdes) | Environmental | Open in IMG/M |
| 3300027645 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027655 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027773 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027783 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027818 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm September2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027829 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027986 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028746 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_1 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
| 3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FG2_05070580 | 2189573004 | Grass Soil | KTGQFDVIADGERIAERGGNWFTRRFGAGYPDLDSLVEQLDEKRRASGAA |
| JGI12581J11935_1020261 | 3300000724 | Tropical Forest Soil | VERGGNWLTRSFGAGYPDLDSVVDQIEKYRVIDAAR* |
| JGI26339J46600_100077604 | 3300003218 | Bog Forest Soil | MKIAERGGNWFTRSFGAGYPDLENVVEQLEKRRASDAAR* |
| JGI26341J46601_100117032 | 3300003219 | Bog Forest Soil | GKHGQFEVIADGKRIAERGGNWLTRSLGAGYPDLDSVVEQLEKHRAIGAAR* |
| JGI26346J50198_10343292 | 3300003351 | Bog Forest Soil | VFVDGEKISERGGNWFTRSFGAGYPDLDSVIEQIEEHRAIDLAKPV* |
| JGI26336J50218_10096151 | 3300003372 | Bog Forest Soil | VVAAGKTGQFEVIADGERVAERGGNWFTRSFGAGYPDLESVVEQLEKRRGG* |
| Ga0055448_102293011 | 3300004005 | Natural And Restored Wetlands | DVIADGEKIAERGGNWLTRSFGVGYPNLDSVVDELERRQA* |
| Ga0062387_1013740482 | 3300004091 | Bog Forest Soil | FEVIADGERIAERGGNWLTRSFGAGYPDLDSVVEQLEKRRASGAAR* |
| Ga0062389_1002831613 | 3300004092 | Bog Forest Soil | KTGQFDVVADGEKIAERGGNWLTRSFGAGYPDLDSVVEKLEKHRK* |
| Ga0062389_1031256041 | 3300004092 | Bog Forest Soil | PGKTGQFEVIADGERIAERGGNWFTRSFGAGYPDLDSVVEQLEKYRAIDAAR* |
| Ga0070676_103404542 | 3300005328 | Miscanthus Rhizosphere | TTPGKTGQFEVIADGKRIAERGGNWFTRSFGVGYPDLESVVEELEKHRAGAAAT* |
| Ga0070711_1003853452 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | VIADGERIAERGGNWFTRSFGGGYPDLDSLVQQLDKKRREGGAA* |
| Ga0070706_1017061411 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | KIADGERISERSGSWFTRSFGAGAGYSDLDNMVEQLEKHRANDLAR* |
| Ga0070739_100523703 | 3300005532 | Surface Soil | VIADGKRIAERGGNWLTRRFRAGYPDLDSVVDLIAKWRADATARETAR* |
| Ga0070735_103366082 | 3300005534 | Surface Soil | VIRPGRTGQFEVIADGQSIAERGGNWFTRSFGAGYPSLDRVLEELENRAARS* |
| Ga0070693_1005230481 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | VVTPGKTGQFEVIADGETVAQRGGNWLTRSLGAGYPDLDGVVEQLEKRRASNAG* |
| Ga0070761_101301884 | 3300005591 | Soil | QFDVVADGEKIAERGGNWLTRSFGAGYPDLEGVVEKLEKQRK* |
| Ga0068852_1001554462 | 3300005616 | Corn Rhizosphere | VVTPGKTGQFTVLADGEPVVERGGNWFTRSFGAGYPDLDSVIDQLQKRSG* |
| Ga0068859_1011253582 | 3300005617 | Switchgrass Rhizosphere | GQFEVIADGERIAERGGNWFTRIFGAGYPDLDSLVQQLDKKRLRVAQLD* |
| Ga0074470_1033593015 | 3300005836 | Sediment (Intertidal) | LADGRKVAERGGNWMTRSFGAGYPDPDRVVEQLEKLRAADAAR* |
| Ga0068860_1003143092 | 3300005843 | Switchgrass Rhizosphere | KRGGNWFTRRFGAGYPDLDSVVEQLVEKRRADGAA* |
| Ga0068860_1006472042 | 3300005843 | Switchgrass Rhizosphere | VIAEGERIAKRGGNWFTRRFGAGYPDLDSVVEQLNEKRRAGGAA* |
| Ga0075028_1003573221 | 3300006050 | Watersheds | ERGGNWFTRRFGAGYPDLESVVEQLEKHRTSGTAP* |
| Ga0075017_1012347691 | 3300006059 | Watersheds | GERIAERGGNWFTRSFGAGYPDLDSVVEQLEKHRAIDASR* |
| Ga0075019_101644672 | 3300006086 | Watersheds | VIADGETIAERGGNWFTRSFGAGYPDLESVVDQLEKRRG* |
| Ga0075015_1000113561 | 3300006102 | Watersheds | GDTGQFDVLADGQRIARRGGNFLTRRFGAGYPDLDSVVELLVEKRRVSDAAP* |
| Ga0075015_1002264963 | 3300006102 | Watersheds | QFEVIADGKRIAERGGNWLTRSFGAGYPDLEGVVEQLKKHRGSDAAR* |
| Ga0075030_1013034681 | 3300006162 | Watersheds | PVLTPGKTGQFEVIADGKKIAERGGNWFSRKFGAGYPDLNGVVEELEKQRR* |
| Ga0075014_1002832112 | 3300006174 | Watersheds | QRIARRGGNFLTRRFGAGYPDLDSVVELLVEKRRVSDAAP* |
| Ga0070712_1011141161 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | AKIAERGGNWITRSFGAGYPDLESVVEQLENRRAGEASR* |
| Ga0097621_1021849462 | 3300006237 | Miscanthus Rhizosphere | VVTPGKTGQFTVLADGQMVAERGGNWLTRSFGAGYPDLNSVVDQLQKRS* |
| Ga0075428_1002458972 | 3300006844 | Populus Rhizosphere | VVTPGKTGQFDVFADGKKIAERGGNVITRRFGAGYPDLEVVVQQLARLTG* |
| Ga0075425_1001836741 | 3300006854 | Populus Rhizosphere | VIADGEKIAERGGNWFTRIFGAGYPDFDSLVQQLDKKRRAGGTA* |
| Ga0075425_1028284571 | 3300006854 | Populus Rhizosphere | TPGKTGQFEVIADGEKIAERGGNWFTRSLGAGYPDLESVVEKLEKRRARDAAP* |
| Ga0075424_1003361953 | 3300006904 | Populus Rhizosphere | VIAEGERIAKRGGNWFTRRFGAGYPDLDSVVEQLVEKRRADGAA* |
| Ga0075424_1003821281 | 3300006904 | Populus Rhizosphere | VITPGKTGQFEVIADGDTVAERGGNWLTRSFGAGYPDLEGVVQKLERRDK* |
| Ga0105107_108337542 | 3300009087 | Freshwater Sediment | ADGKRIAERGGNWFTRSFGGGYPDVDVVIEQLEKHRTSDAAR* |
| Ga0075423_115658422 | 3300009162 | Populus Rhizosphere | QFEVIADSQTIAKRGGNWFTRSFGAGYPDLDRVVEQLDKHRKSDTAR* |
| Ga0126373_106010901 | 3300010048 | Tropical Forest Soil | GNKGQFDVIADGQMIAKRGGNFITRSFGVGYPDLDGVVELLVKKQHASGEAR* |
| Ga0074044_103583001 | 3300010343 | Bog Forest Soil | PGKAGQFEVIADGRKIAERGGNWLTRTFGAGYPDLDAVVEQLKKRGAGGAAR* |
| Ga0126379_115012883 | 3300010366 | Tropical Forest Soil | VITPGKTGQFEVIADGDTVAERGGNWLTRSFGAGYPDLEGVVEKLERRSK* |
| Ga0134128_124775561 | 3300010373 | Terrestrial Soil | RGKIGQFEVRVDGEKIVERGGNWITRLFGAGYPDLDKVVDLVQSRTSELR* |
| Ga0134127_126438273 | 3300010399 | Terrestrial Soil | VTTPGKTGQFEVIADGKTIAERGGNWFTRSFGAGYPDLEGVVEDLEKQRAGT* |
| Ga0134122_113658921 | 3300010400 | Terrestrial Soil | VDGKKIAERGGNWFTRSFGAGYPSLDKVVEQLVQKHRAIDSA* |
| Ga0134123_111005491 | 3300010403 | Terrestrial Soil | IAERGGNWFTRSFGAGYPSLDKVVEQLVQKHRAIDSA* |
| Ga0134123_121075951 | 3300010403 | Terrestrial Soil | KTGQFDVIADGTKIATRGGNWFTRQLGAGYPDLDEVVTLLEKHRTGTAQ* |
| Ga0150983_116088862 | 3300011120 | Forest Soil | VVTPGKTGQFEVLADGERIAERGGNWFTRSFGAGYPDLDNVVELLQKRITK* |
| Ga0150983_134220531 | 3300011120 | Forest Soil | VPGKTGQFDVMADGEKIAERGGNWLTRSFGAGYPDLDSVIEKLENHRT* |
| Ga0150983_166067571 | 3300011120 | Forest Soil | TGQFEVIADGERIAERGGNWITRSFGAGYPDLNGVVEQLQRRATDAAPRQQVC* |
| Ga0137423_11325671 | 3300011430 | Soil | VIADGERIAERGGNWVTRRFGAGYPELDGVVEQLERRRGRAV* |
| Ga0137389_110078771 | 3300012096 | Vadose Zone Soil | RIAERGGNWFTRSFGAGYPDLESVVEQLAKHRANDAAR* |
| Ga0137388_104744681 | 3300012189 | Vadose Zone Soil | PGKTGQFEVIADGETIAERGGSWFTRSFGAGYPDLDSVVEQLVEKHRTSDAAR* |
| Ga0137363_109340752 | 3300012202 | Vadose Zone Soil | FEVLADGERIAERGGNWFTRSFGAGYPDLDNVVEQLQKRITK* |
| Ga0137380_107846102 | 3300012206 | Vadose Zone Soil | GQFEVIADGKRIAERGGNWFTRSFGAGYPDLESVVEQLAKHRANDAAR* |
| Ga0137360_106683181 | 3300012361 | Vadose Zone Soil | VIADGERIAERGGNWFTRSFGAGYPDLDSVVEQLEKHRANDLAR* |
| Ga0137360_109856152 | 3300012361 | Vadose Zone Soil | VIADGERIAERGGNWFTRSFGAGYPDLDSVVEQLEKHRANDTAR* |
| Ga0137361_103412333 | 3300012362 | Vadose Zone Soil | ADGEKIAERGGNWFTRSFGAGYPDLESVVEQLEKQRD* |
| Ga0137358_1000205514 | 3300012582 | Vadose Zone Soil | MPDKTGQLEVIADGERIAERGGNWFTRSFGAGYPDLDSVVEQLEKHRANDTAR* |
| Ga0137419_105832531 | 3300012925 | Vadose Zone Soil | TPGKLGQFEVIADSERIVERGGNWLTRSFGAGYPDLESVVEQLEKHRKSRSAS* |
| Ga0137404_118617171 | 3300012929 | Vadose Zone Soil | IADGEKIAERGGNWFTRSFGAGYPDLESVVEQLEKHRA* |
| Ga0137407_100497572 | 3300012930 | Vadose Zone Soil | VKTPGRTGQFEVIADGKRIAERGGNWLTRSFGAGYPDLDGVVDQLEKHRAGEAAR* |
| Ga0164309_105781141 | 3300012984 | Soil | ITHGKTGQFDVIADGERIAERGGNWFTRRFGAGYPDLDSLVEQLDEKRRASGAA* |
| Ga0181526_101176431 | 3300014200 | Bog | IADGERIAERGGNWLTRSFGAGYPDFDSVVEQLEKYRASHAAR* |
| Ga0182024_127330901 | 3300014501 | Permafrost | TGQFEIIADGERIAERGGNWLTRSFGAGYPDLDRVVERLEQKQTGRVRSG* |
| Ga0187818_100811442 | 3300017823 | Freshwater Sediment | VVTPGKTGQFDVIADGEKIVERGGNWLTRSFGAGYPDWDNVVKLLEQRRALRG |
| Ga0187819_102968611 | 3300017943 | Freshwater Sediment | DGERIAERGGNWFTRRFGAGYPDLDSVVEQLDEKRRASGAA |
| Ga0187817_102523581 | 3300017955 | Freshwater Sediment | ERGGNWFTRSFGAGYPDLNSVVERLEQRRASDTAR |
| Ga0187783_108833421 | 3300017970 | Tropical Peatland | FDVIADGEKIAERGGNWFTRSFGAGYPDLDNLVELLEKRRDLRG |
| Ga0187783_111256431 | 3300017970 | Tropical Peatland | FDVIADGEKIAERGGNWFTRSFGAGYPDLDNLVELLEKRRALRG |
| Ga0187781_100072256 | 3300017972 | Tropical Peatland | VVRSGSTGQFQVIADGETIAERGGNWLTRRFGAGYPDLEGVVSQIEKRLNSQ |
| Ga0187781_101806482 | 3300017972 | Tropical Peatland | MADGQKIAERGGNWFTRSFGAGYPDLNNVVALLEKRGSARD |
| Ga0187804_101710762 | 3300018006 | Freshwater Sediment | GQFEVIADGERIAERGGNWFTRRFGAGYPDLDSVVEQLDEKRRASGAG |
| Ga0187804_101999062 | 3300018006 | Freshwater Sediment | VVTPGKTGQFDVIADGEKIVERGGNWLTRSFGAGYPDLDNVVKLLEQRRALRG |
| Ga0187810_100669432 | 3300018012 | Freshwater Sediment | GKRIAERGGNWFTRSFGAGYPDLDSVVEQLEKHRASDAAR |
| Ga0187774_112431802 | 3300018089 | Tropical Peatland | GQFDVIADGKRIAQRGGNWFTRSFGGGYPDLESVVEQLEKNRTSDAAR |
| Ga0187797_11506431 | 3300019284 | Peatland | QFEVLADGQKIAARGGNWLTRKFGAGYPDLESVLTLLEKRSAGQ |
| Ga0210407_100685682 | 3300020579 | Soil | KTGQFTVVADGEKIAERGGNWLTRSFGAGYPDLDRVVEKLEN |
| Ga0210407_107657571 | 3300020579 | Soil | QFEVIADGERIAERGGNWLTRSLGAGYPDLNSVIKQLEQRRTGGTAR |
| Ga0210403_108971752 | 3300020580 | Soil | DVVADGEKIAERGGNWLTRSFGAGYPDLDSVIEKLEKHRK |
| Ga0210401_101811932 | 3300020583 | Soil | VIADGEMIAARGGNWFTRRFGAGYPDLDSLVEQLDEKRRASDAD |
| Ga0210388_113569831 | 3300021181 | Soil | FDVVADGEKIAERGGNWLTRSFGAGYPDLNSVIEKLEKHQK |
| Ga0210383_107759371 | 3300021407 | Soil | ERGGNWLTRSFGAGYPDLNSVIEQLEHRRASGTAR |
| Ga0210394_100423081 | 3300021420 | Soil | DEKIAERGGNWLTRSFGAGYPDLDSVIEKLEKHRK |
| Ga0210394_117009811 | 3300021420 | Soil | TGQFEVIADGERVVERGGNWFTRKLGAGYPDLESVVEQLEKRRAGGGGR |
| Ga0210391_103246041 | 3300021433 | Soil | ERIAERGGNWLTRSLGAGYPDLNSVIKQLEQRRTGGTAR |
| Ga0242655_102723961 | 3300022532 | Soil | GKTGQFEVIADGERIVERGGNWFTRSLGAGYPDLDSLVDQLEKRRASGAAR |
| Ga0242661_11341462 | 3300022717 | Soil | PGKTGQFEVIADGERVAERGGNWFTRKFGAGYPGLDSVVEQLEKRRASGTDR |
| Ga0224544_10078113 | 3300023250 | Soil | TGQFEVIADGKRIAERGGNWFTRSFGAGYPDLKGVVEQLEKRRGSDAAR |
| Ga0247661_10091592 | 3300024254 | Soil | VIADGEKIAERGGNWFTRMFGAGYPDFDSLVQQLDKKRRAGGTA |
| Ga0209343_106008352 | 3300025311 | Groundwater | MVDGKKIAERGGNLITRSFGAGYPDPSNIVDMIEKQAGSDKTS |
| Ga0207693_104585081 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | AKIAERGGNWITRSFGAGYPDLESVVEQLENRRAGEASR |
| Ga0207639_116227861 | 3300026041 | Corn Rhizosphere | DVFADGEKVVERGGNWFTRSFGAGYPDLDSVVDQLEKRRG |
| Ga0179587_105573611 | 3300026557 | Vadose Zone Soil | LADGERIAERGGNWFTRSFGAGYPDLDNVVALLENRITK |
| Ga0207630_1077561 | 3300026760 | Soil | ADGEKIAERGGNWLTRSFGAGYPDLDSVIEKLEKHRK |
| Ga0207760_1216631 | 3300026845 | Tropical Forest Soil | FEVIADGKRVAERGGNWLTRSFGAGYPDLESVVEQIEKYRAIDAAR |
| Ga0207821_10089612 | 3300026869 | Tropical Forest Soil | EVIADGKRVAERGGNWLTRSFGAGYPDLESVVEQIEKYRAIDAAR |
| Ga0207805_10321732 | 3300026887 | Tropical Forest Soil | ERGGNWLTRRFGAGYPDLERVVNRLAEKNRAAARQ |
| Ga0207860_10203612 | 3300026921 | Tropical Forest Soil | ADGKRVAERGGNWLTRSFGAGYPDLESVVEQIEKYRAIDAAR |
| Ga0207740_10029072 | 3300027011 | Tropical Forest Soil | VERGGNWLTRSFGAGYPDLDSVVDQIEKYRVIDAAR |
| Ga0209117_10738201 | 3300027645 | Forest Soil | LFAAEEDGERIAEGGGNWFTRSFGTGYPDLDSVVEQLVEKRRASDVP |
| Ga0209388_10371442 | 3300027655 | Vadose Zone Soil | DGERVAERGGNWLTRSFGAGYPDLDSVVEQLEKRRRPQG |
| Ga0209810_10887502 | 3300027773 | Surface Soil | VIADGKRIAERGGNWLTRRFRAGYPDLDSVVDLIAKWRADATARETAR |
| Ga0209448_100493302 | 3300027783 | Bog Forest Soil | VFVDGEKISERGGNWFTRSFGAGYPDLDSVIEQIEEHRAIDLAKPV |
| Ga0209656_102391412 | 3300027812 | Bog Forest Soil | MKIAERGGNWFTRSFGAGYPDLENVVEQLEKRRASDAAR |
| Ga0209706_104174592 | 3300027818 | Freshwater Sediment | ERGGNWFTRSFGGGYPDVDVVIEQLEKHRTSDAAR |
| Ga0209773_103866371 | 3300027829 | Bog Forest Soil | VPGKTGQFDVVADGEKIAERGGNWFTRSFGVGYPDLDSVVETLEKHRK |
| Ga0209698_105857893 | 3300027911 | Watersheds | GERIAERGGNWFTRSFGAGYPDLNRVVEQLEKRRASDTAR |
| Ga0209168_102361542 | 3300027986 | Surface Soil | VIRPGRTGQFEVIADGQSIAERGGNWFTRSFGAGYPSLDRVLEELENRAARS |
| Ga0302233_102013771 | 3300028746 | Palsa | GKTGQFEVIADGKRIAERGGNWFTRSFGAGYPDLKGVVEQLEKRRGSDAAR |
| Ga0308309_106314712 | 3300028906 | Soil | LTPVKTGQFDVVADGEKIAERGGNWLTRSFGAGYPDLDSIVEKLEKHRK |
| Ga0222749_105803082 | 3300029636 | Soil | GQFEVIADGERIAERGGNWFTRSFGVGYPDLDSVVKQLEQRRARDAAR |
| Ga0170824_1098748401 | 3300031231 | Forest Soil | GERITQRGGNWFTRSFGADYPDLDSVVEQIAKRRVSDAAR |
| Ga0170824_1239405451 | 3300031231 | Forest Soil | MIAERGGNWFTRSFGLGYPDLEYVVEQLEKRRASDAAR |
| Ga0170820_110013042 | 3300031446 | Forest Soil | MIAERGGNWFTRSFGLGYPDLENVVEQLEKRRASDAAR |
| Ga0307476_104123202 | 3300031715 | Hardwood Forest Soil | MADGEKIAERGGNWFTRSFGAGYPDLNNVVALLEKQRSARG |
| Ga0307476_105931302 | 3300031715 | Hardwood Forest Soil | DVVADGEKIAERGGNWLTRSFGAGYPDLEGVVEKLEKHRT |
| Ga0307469_103280371 | 3300031720 | Hardwood Forest Soil | IAERAGNWFTRSFGAGYPDVETVVEQLEKYHASEAAR |
| Ga0307477_105671772 | 3300031753 | Hardwood Forest Soil | ADGERIAERGGNWFTQKFGAGYPDLDSVVEQLEEKRRASGAA |
| Ga0307477_105829082 | 3300031753 | Hardwood Forest Soil | IAERGGNWFTRSFGAGYPDLDSVLEQLEKRRSSMK |
| Ga0307475_112902351 | 3300031754 | Hardwood Forest Soil | IADGEKIAERGGNLFTRRFGGGYPDLDSVVEQLGKHRESHSA |
| Ga0307473_107858082 | 3300031820 | Hardwood Forest Soil | EVIADGEKIAERGGNWFTRSFGAGYPDLDSVVEQLVEKHRASGAT |
| Ga0307478_101826002 | 3300031823 | Hardwood Forest Soil | VIADGETIAERGGNWFTRKFGAGYPDLDSLVEQLDKKRRASGAA |
| Ga0306926_109839792 | 3300031954 | Soil | VITPGKTGQFEVIADGETVAERGGNWITRSFGAGYPDLQSVVEELEKRAG |
| Ga0307479_104491521 | 3300031962 | Hardwood Forest Soil | GKTGQFEVIADGERIAERGGNWLTRSFGAGYPDLNSVIEQLEHRRASGPAR |
| Ga0307471_1027084931 | 3300032180 | Hardwood Forest Soil | GERIAERGGNWFTRSFGAGYPDLDSVVEQLEKHRRPQG |
| Ga0335082_116718651 | 3300032782 | Soil | ERGGNWLTRSFGAGYPDLEGVVKQLEKHRTTDAAQ |
| Ga0335082_117173961 | 3300032782 | Soil | FDVIADGARIARRGGNWLTRSFGAGYPDLDRVVEQLEKIRASRSAR |
| Ga0335081_115878881 | 3300032892 | Soil | KSGRTGQFEVFADGERIAERGGNWLTRSFGLGYPTLDVIIQQLVQKRQTETNSK |
| Ga0335074_103489242 | 3300032895 | Soil | MCCSPPGKTGQFDVVADGEKFAERGGNWFTRSFGAGYPDLESVVEKLEKHSK |
| Ga0335072_1001238311 | 3300032898 | Soil | VIADGEKIASRGGNWFTQRFGAGYPDLDRVVEQIEKRRASDAQR |
| Ga0335072_101860882 | 3300032898 | Soil | MWMCCSPPGKTGQFDVVADGEKFAERGGNWFTRSFGAGYPDLESVVEKLEKHSK |
| Ga0335073_102247231 | 3300033134 | Soil | CSPPGKTGQFDVVADGEKFAERGGNWFTRSFGAGYPDLESVVEKLEKHSK |
| ⦗Top⦘ |