


| Basic Information | |
|---|---|
| Family ID | F061147 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 132 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MNSPTRATTTPSNSLPAQLEQIGLHALAAEVDDFLARATKQRWSP |
| Number of Associated Samples | 114 |
| Number of Associated Scaffolds | 132 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 99.24 % |
| % of genes near scaffold ends (potentially truncated) | 99.24 % |
| % of genes from short scaffolds (< 2000 bps) | 93.94 % |
| Associated GOLD sequencing projects | 112 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.39 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (99.242 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil (9.848 % of family members) |
| Environment Ontology (ENVO) | Unclassified (18.182 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (41.667 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 31.51% β-sheet: 0.00% Coil/Unstructured: 68.49% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.39 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 132 Family Scaffolds |
|---|---|---|
| PF00665 | rve | 14.39 |
| PF13408 | Zn_ribbon_recom | 0.76 |
| PF13414 | TPR_11 | 0.76 |
| PF01695 | IstB_IS21 | 0.76 |
| PF13565 | HTH_32 | 0.76 |
| COG ID | Name | Functional Category | % Frequency in 132 Family Scaffolds |
|---|---|---|---|
| COG2801 | Transposase InsO and inactivated derivatives | Mobilome: prophages, transposons [X] | 14.39 |
| COG2826 | Transposase and inactivated derivatives, IS30 family | Mobilome: prophages, transposons [X] | 14.39 |
| COG3316 | Transposase (or an inactivated derivative), DDE domain | Mobilome: prophages, transposons [X] | 14.39 |
| COG4584 | Transposase | Mobilome: prophages, transposons [X] | 14.39 |
| COG1484 | DNA replication protein DnaC | Replication, recombination and repair [L] | 0.76 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 99.24 % |
| Unclassified | root | N/A | 0.76 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002568|C688J35102_117904452 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 514 | Open in IMG/M |
| 3300003541|JGI20214J51650_10294787 | All Organisms → cellular organisms → Bacteria | 1125 | Open in IMG/M |
| 3300004479|Ga0062595_101006706 | All Organisms → cellular organisms → Bacteria | 717 | Open in IMG/M |
| 3300004780|Ga0062378_10088468 | All Organisms → cellular organisms → Bacteria | 747 | Open in IMG/M |
| 3300005175|Ga0066673_10613472 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
| 3300005180|Ga0066685_10718541 | All Organisms → cellular organisms → Bacteria | 684 | Open in IMG/M |
| 3300005335|Ga0070666_10919400 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
| 3300005355|Ga0070671_101202962 | All Organisms → cellular organisms → Bacteria | 667 | Open in IMG/M |
| 3300005434|Ga0070709_11155792 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
| 3300005446|Ga0066686_10539110 | All Organisms → cellular organisms → Bacteria | 793 | Open in IMG/M |
| 3300005529|Ga0070741_11263735 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
| 3300005548|Ga0070665_100938159 | All Organisms → cellular organisms → Bacteria | 878 | Open in IMG/M |
| 3300005568|Ga0066703_10777143 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300005764|Ga0066903_102205375 | All Organisms → cellular organisms → Bacteria | 1062 | Open in IMG/M |
| 3300005764|Ga0066903_108150439 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300005764|Ga0066903_109160010 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300005878|Ga0075297_1024029 | All Organisms → cellular organisms → Bacteria | 666 | Open in IMG/M |
| 3300005883|Ga0075299_1001076 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → Myxococcus | 1423 | Open in IMG/M |
| 3300006057|Ga0075026_100137967 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1243 | Open in IMG/M |
| 3300006162|Ga0075030_100233457 | All Organisms → cellular organisms → Bacteria | 1477 | Open in IMG/M |
| 3300006174|Ga0075014_100762295 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
| 3300006572|Ga0074051_11236966 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 511 | Open in IMG/M |
| 3300006794|Ga0066658_10524608 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 644 | Open in IMG/M |
| 3300006797|Ga0066659_10564639 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 920 | Open in IMG/M |
| 3300012961|Ga0164302_11426735 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300014499|Ga0182012_10636899 | All Organisms → cellular organisms → Bacteria | 683 | Open in IMG/M |
| 3300016357|Ga0182032_11639179 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
| 3300016371|Ga0182034_12049850 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300016404|Ga0182037_10452787 | All Organisms → cellular organisms → Bacteria | 1067 | Open in IMG/M |
| 3300017659|Ga0134083_10144998 | All Organisms → cellular organisms → Bacteria | 958 | Open in IMG/M |
| 3300017946|Ga0187879_10503276 | All Organisms → cellular organisms → Bacteria | 672 | Open in IMG/M |
| 3300017970|Ga0187783_11378934 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300018034|Ga0187863_10903525 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300018040|Ga0187862_10323233 | All Organisms → cellular organisms → Bacteria | 967 | Open in IMG/M |
| 3300018044|Ga0187890_10037805 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2911 | Open in IMG/M |
| 3300018057|Ga0187858_10068578 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2483 | Open in IMG/M |
| 3300018057|Ga0187858_10402495 | All Organisms → cellular organisms → Bacteria | 850 | Open in IMG/M |
| 3300018062|Ga0187784_10345514 | All Organisms → cellular organisms → Bacteria | 1206 | Open in IMG/M |
| 3300018062|Ga0187784_11455297 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300018431|Ga0066655_10284350 | All Organisms → cellular organisms → Bacteria | 1071 | Open in IMG/M |
| 3300018468|Ga0066662_10551148 | All Organisms → cellular organisms → Bacteria | 1066 | Open in IMG/M |
| 3300018468|Ga0066662_11957019 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
| 3300019270|Ga0181512_1453890 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300019361|Ga0173482_10295294 | All Organisms → cellular organisms → Bacteria | 710 | Open in IMG/M |
| 3300020083|Ga0194111_10413868 | All Organisms → cellular organisms → Bacteria | 889 | Open in IMG/M |
| 3300020583|Ga0210401_11555372 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300021090|Ga0210377_10519439 | All Organisms → cellular organisms → Bacteria | 684 | Open in IMG/M |
| 3300021297|Ga0210369_1089757 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300021374|Ga0213881_10229124 | All Organisms → cellular organisms → Bacteria | 823 | Open in IMG/M |
| 3300021420|Ga0210394_10301428 | All Organisms → cellular organisms → Bacteria | 1406 | Open in IMG/M |
| 3300021478|Ga0210402_10770967 | All Organisms → cellular organisms → Bacteria | 886 | Open in IMG/M |
| 3300021560|Ga0126371_12318283 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
| 3300021860|Ga0213851_1545501 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300022213|Ga0224500_10395612 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300024295|Ga0224556_1187684 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300025161|Ga0209381_1095400 | All Organisms → cellular organisms → Bacteria | 1037 | Open in IMG/M |
| 3300025898|Ga0207692_11216047 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300025916|Ga0207663_10958554 | All Organisms → cellular organisms → Bacteria | 685 | Open in IMG/M |
| 3300025920|Ga0207649_10803670 | All Organisms → cellular organisms → Bacteria | 734 | Open in IMG/M |
| 3300025937|Ga0207669_11462372 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
| 3300025941|Ga0207711_12137653 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300025944|Ga0207661_10558789 | All Organisms → cellular organisms → Bacteria | 1049 | Open in IMG/M |
| 3300026035|Ga0207703_11358719 | All Organisms → cellular organisms → Bacteria | 683 | Open in IMG/M |
| 3300026078|Ga0207702_11149193 | All Organisms → cellular organisms → Bacteria | 770 | Open in IMG/M |
| 3300026095|Ga0207676_11341473 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 711 | Open in IMG/M |
| 3300026278|Ga0209018_1095276 | Not Available | 576 | Open in IMG/M |
| 3300026301|Ga0209238_1026863 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2157 | Open in IMG/M |
| 3300026309|Ga0209055_1137912 | All Organisms → cellular organisms → Bacteria | 877 | Open in IMG/M |
| 3300026317|Ga0209154_1200459 | All Organisms → cellular organisms → Bacteria | 768 | Open in IMG/M |
| 3300026927|Ga0207744_1007939 | All Organisms → cellular organisms → Bacteria | 1060 | Open in IMG/M |
| 3300027034|Ga0209730_1016950 | All Organisms → cellular organisms → Bacteria | 759 | Open in IMG/M |
| 3300027039|Ga0207855_1028888 | All Organisms → cellular organisms → Bacteria | 751 | Open in IMG/M |
| 3300027812|Ga0209656_10272157 | All Organisms → cellular organisms → Bacteria | 793 | Open in IMG/M |
| 3300027910|Ga0209583_10297049 | All Organisms → cellular organisms → Bacteria | 732 | Open in IMG/M |
| 3300028379|Ga0268266_10857200 | All Organisms → cellular organisms → Bacteria | 878 | Open in IMG/M |
| 3300028743|Ga0302262_10209732 | All Organisms → cellular organisms → Bacteria | 664 | Open in IMG/M |
| 3300028806|Ga0302221_10403566 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
| 3300028863|Ga0302218_10208674 | All Organisms → cellular organisms → Bacteria | 625 | Open in IMG/M |
| 3300028870|Ga0302254_10349976 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300028906|Ga0308309_10552266 | All Organisms → cellular organisms → Bacteria | 998 | Open in IMG/M |
| 3300029913|Ga0311362_10222959 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2108 | Open in IMG/M |
| 3300029922|Ga0311363_11047796 | All Organisms → cellular organisms → Bacteria | 708 | Open in IMG/M |
| 3300029939|Ga0311328_10467768 | All Organisms → cellular organisms → Bacteria | 892 | Open in IMG/M |
| 3300029939|Ga0311328_10807217 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
| 3300029953|Ga0311343_10978835 | All Organisms → cellular organisms → Bacteria | 667 | Open in IMG/M |
| 3300029954|Ga0311331_10085213 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4127 | Open in IMG/M |
| 3300029954|Ga0311331_11016303 | All Organisms → cellular organisms → Bacteria | 718 | Open in IMG/M |
| 3300029954|Ga0311331_11065210 | All Organisms → cellular organisms → Bacteria | 695 | Open in IMG/M |
| 3300029999|Ga0311339_10467087 | All Organisms → cellular organisms → Bacteria | 1294 | Open in IMG/M |
| 3300030002|Ga0311350_11718472 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300030011|Ga0302270_10469607 | All Organisms → cellular organisms → Bacteria | 661 | Open in IMG/M |
| 3300030503|Ga0311370_11014277 | All Organisms → cellular organisms → Bacteria | 924 | Open in IMG/M |
| 3300030507|Ga0302192_10042957 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2371 | Open in IMG/M |
| 3300030617|Ga0311356_11782462 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
| 3300030688|Ga0311345_11296813 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300031234|Ga0302325_10737136 | All Organisms → cellular organisms → Bacteria | 1408 | Open in IMG/M |
| 3300031236|Ga0302324_101477399 | All Organisms → cellular organisms → Bacteria | 884 | Open in IMG/M |
| 3300031344|Ga0265316_10559155 | All Organisms → cellular organisms → Bacteria | 814 | Open in IMG/M |
| 3300031524|Ga0302320_11965562 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
| 3300031525|Ga0302326_10468118 | All Organisms → cellular organisms → Bacteria | 1924 | Open in IMG/M |
| 3300031525|Ga0302326_12346098 | All Organisms → cellular organisms → Bacteria | 675 | Open in IMG/M |
| 3300031715|Ga0307476_11329927 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
| 3300031753|Ga0307477_10644822 | All Organisms → cellular organisms → Bacteria | 712 | Open in IMG/M |
| 3300031805|Ga0318497_10822677 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300031894|Ga0318522_10335228 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
| 3300031897|Ga0318520_10735544 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
| 3300031897|Ga0318520_10839343 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
| 3300031897|Ga0318520_11049679 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300031910|Ga0306923_12052800 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
| 3300031945|Ga0310913_11156134 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300031996|Ga0308176_11239944 | All Organisms → cellular organisms → Bacteria | 791 | Open in IMG/M |
| 3300032001|Ga0306922_10944192 | All Organisms → cellular organisms → Bacteria | 893 | Open in IMG/M |
| 3300032025|Ga0318507_10312559 | All Organisms → cellular organisms → Bacteria | 683 | Open in IMG/M |
| 3300032044|Ga0318558_10644933 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| 3300032053|Ga0315284_11017924 | All Organisms → cellular organisms → Bacteria | 931 | Open in IMG/M |
| 3300032060|Ga0318505_10587943 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
| 3300032160|Ga0311301_10697082 | All Organisms → cellular organisms → Bacteria | 1429 | Open in IMG/M |
| 3300032770|Ga0335085_10201297 | All Organisms → cellular organisms → Bacteria | 2438 | Open in IMG/M |
| 3300032770|Ga0335085_11472660 | All Organisms → cellular organisms → Bacteria | 710 | Open in IMG/M |
| 3300032770|Ga0335085_11557826 | All Organisms → cellular organisms → Bacteria | 686 | Open in IMG/M |
| 3300032783|Ga0335079_11108183 | All Organisms → cellular organisms → Bacteria | 801 | Open in IMG/M |
| 3300032783|Ga0335079_11434548 | All Organisms → cellular organisms → Bacteria | 684 | Open in IMG/M |
| 3300032783|Ga0335079_11978507 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300032892|Ga0335081_10114590 | All Organisms → cellular organisms → Bacteria | 3961 | Open in IMG/M |
| 3300032892|Ga0335081_11322789 | All Organisms → cellular organisms → Bacteria | 811 | Open in IMG/M |
| 3300032892|Ga0335081_12729035 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300032897|Ga0335071_11764034 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
| 3300032954|Ga0335083_10324742 | All Organisms → cellular organisms → Bacteria | 1342 | Open in IMG/M |
| 3300032954|Ga0335083_11394769 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300033402|Ga0326728_10330104 | All Organisms → cellular organisms → Bacteria | 1362 | Open in IMG/M |
| 3300033483|Ga0316629_11447263 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
| 3300034199|Ga0370514_124219 | All Organisms → cellular organisms → Bacteria | 662 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 9.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 9.09% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 8.33% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 6.82% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 5.30% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.30% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.79% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.79% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 3.03% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.03% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 3.03% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 3.03% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.27% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.27% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.52% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.52% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 1.52% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.52% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.52% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.76% |
| Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 0.76% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.76% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.76% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.76% |
| Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 0.76% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.76% |
| Wetland | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland | 0.76% |
| Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 0.76% |
| Anoxygenic And Chlorotrophic Microbial Mat | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Anoxygenic And Chlorotrophic Microbial Mat | 0.76% |
| Hot Spring Sediment | Environmental → Aquatic → Thermal Springs → Sediment → Unclassified → Hot Spring Sediment | 0.76% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.76% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.76% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.76% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.76% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.76% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.76% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.76% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.76% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.76% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.76% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.76% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.76% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.76% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.76% |
| Exposed Rock | Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock | 0.76% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.76% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.76% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.76% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.76% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.76% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300003541 | Wetland sediment microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Aug2011 Site B2 Bulk | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004780 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare1Fresh | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005878 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_80N_104 | Environmental | Open in IMG/M |
| 3300005883 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_80N_302 | Environmental | Open in IMG/M |
| 3300006057 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006572 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHPB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300014499 | Permafrost microbial communities from Stordalen Mire, Sweden - 612S2S metaG | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
| 3300018040 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150 | Environmental | Open in IMG/M |
| 3300018044 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10 | Environmental | Open in IMG/M |
| 3300018057 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150 | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300019270 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
| 3300020083 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015033 Kigoma Deep Cast 300m | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021090 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_b1 redo | Environmental | Open in IMG/M |
| 3300021297 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.669 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021374 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R08 | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300021860 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2014 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022213 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_4_1 | Environmental | Open in IMG/M |
| 3300024295 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 1-5 | Environmental | Open in IMG/M |
| 3300025161 | Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Dewar Creek DC9 2012 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026278 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP Bryant BLVA 2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300026301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026309 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes) | Environmental | Open in IMG/M |
| 3300026317 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes) | Environmental | Open in IMG/M |
| 3300026927 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 56 (SPAdes) | Environmental | Open in IMG/M |
| 3300027034 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027039 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 14 (SPAdes) | Environmental | Open in IMG/M |
| 3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027910 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes) | Environmental | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028743 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_E3_4 | Environmental | Open in IMG/M |
| 3300028806 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_1 | Environmental | Open in IMG/M |
| 3300028863 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_1 | Environmental | Open in IMG/M |
| 3300028870 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E1_4 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029913 | III_Bog_N3 coassembly | Environmental | Open in IMG/M |
| 3300029922 | III_Fen_E1 coassembly | Environmental | Open in IMG/M |
| 3300029939 | I_Bog_E3 coassembly | Environmental | Open in IMG/M |
| 3300029953 | II_Bog_E3 coassembly | Environmental | Open in IMG/M |
| 3300029954 | I_Bog_N3 coassembly | Environmental | Open in IMG/M |
| 3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030002 | II_Fen_N1 coassembly | Environmental | Open in IMG/M |
| 3300030011 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_E2_3 | Environmental | Open in IMG/M |
| 3300030503 | III_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030507 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E3_2 | Environmental | Open in IMG/M |
| 3300030617 | II_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300030688 | II_Bog_N2 coassembly | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Host-Associated | Open in IMG/M |
| 3300031524 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_3 | Environmental | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031894 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
| 3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
| 3300032053 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16 | Environmental | Open in IMG/M |
| 3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032897 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300033402 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MN | Environmental | Open in IMG/M |
| 3300033483 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D1_A | Environmental | Open in IMG/M |
| 3300034199 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_01D_14 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| C688J35102_1179044522 | 3300002568 | Soil | MSSPIRATTTPNNSLPAQLEQIGLHALAAGVDDFLARATKQRWSPRQILEHLA |
| JGI20214J51650_102947872 | 3300003541 | Wetland | MSSPATMTTTSLMNSLAAQLQQIGLRALPAGLDDFLARATKSR |
| Ga0062595_1010067062 | 3300004479 | Soil | MNSPIRATTTQINSLPAQLEQIGLHTLAAGVDDFLARATKQRWSPRQILE |
| Ga0062378_100884682 | 3300004780 | Wetland Sediment | MSSPIRATTTPSNSLPAQLEQIGLHAVAAEVDDFLARATKQRWS |
| Ga0066673_106134722 | 3300005175 | Soil | MNSPTRATTTTPSNSLPAQLEQIGLHTLATEVNDFLARATKQRW |
| Ga0066685_107185411 | 3300005180 | Soil | MNSPTRATTTTPSNSLPAQLEQIGLHALGTEVNDFLARAIKQRWSPRQVLEHL |
| Ga0070666_109194002 | 3300005335 | Switchgrass Rhizosphere | MSSPALKTTTPTPNNSLPAQLQQIGLRALPAQLDDFLARAAKARWSPH |
| Ga0070671_1012029621 | 3300005355 | Switchgrass Rhizosphere | MNSPTRATTTPSNSLPVQLEQVGLHAVASGVDDFLARATKQRWSP |
| Ga0070709_111557921 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MNSPATMTMTTIPMNNLPAQLQQLGLRALPVELDDFLARATKARWSPRV |
| Ga0066686_105391101 | 3300005446 | Soil | MNSPATMTMTPMISLAAQLQQIGLCALPAELDDFLARATKARWSPRV |
| Ga0070741_112637352 | 3300005529 | Surface Soil | MNSPTRTTTNPSNSLPAQLEQIGLHALASEVDDFLARA |
| Ga0070665_1009381592 | 3300005548 | Switchgrass Rhizosphere | MSSPIPTTTTLSNSLPAQLEQIGLHVVAGELDDFLARATK |
| Ga0066703_107771431 | 3300005568 | Soil | MNSRTRTTTTPSNSLAAQLEQIGLHALAGEVDDFLARATKQRW |
| Ga0066903_1022053752 | 3300005764 | Tropical Forest Soil | MMSSPIPKTTTPISLSAQLEHIGLCALPQQLDDFLARATKARWSPHQI |
| Ga0066903_1081504392 | 3300005764 | Tropical Forest Soil | MNSPTSTTTTPRSSLPAQLEQIGLHALATEVDDFLARATKQRWS |
| Ga0066903_1091600101 | 3300005764 | Tropical Forest Soil | MNSPTPMTMTPRNDLPAQLEQIGLRALPAELDDFLARA |
| Ga0075297_10240292 | 3300005878 | Rice Paddy Soil | MSSPTPTTTTLSNSLPAQLEQIGLHVVAGELDDFLARATKQRWSPR |
| Ga0075299_10010761 | 3300005883 | Rice Paddy Soil | MSSPTPTTTTLSNSLPAQLEQIGLHVVAGELDDFLARATKQRWSPRQMLERL |
| Ga0075026_1001379672 | 3300006057 | Watersheds | MNSPTRVTTTPSNNLPAQLEQIGLHALATEVDDFLARATKQRWSPRQTLE |
| Ga0075030_1002334571 | 3300006162 | Watersheds | MNSPAIKTTTIPRNSLPAQLQQIGLRAVPAQLDDFLAR |
| Ga0075014_1007622951 | 3300006174 | Watersheds | MTSPNPPSSSLSLLLQQIGLRALPAQLDDFLARAAKA |
| Ga0074051_112369661 | 3300006572 | Soil | MNSPTRATTTPSNSLPAQLEQIGLHTLAAEVNDFLARATKQRWSPRQIL |
| Ga0066658_105246081 | 3300006794 | Soil | MNSPIRATTTTTPSNSLPAQLEQIGLHALAAEIDDFLARATKQRWSPRQIL |
| Ga0066659_105646392 | 3300006797 | Soil | MNSRTRTTTTPSNSLAAQLEQIGLHALAGEVDDFLARATKQRWSPRQILEHLVQ |
| Ga0164302_114267352 | 3300012961 | Soil | MSSPTRATTTPSNSLPAQLEQIGLHALAAGMDDFLTRATRQRWSPRQILEHLAQ |
| Ga0182012_106368992 | 3300014499 | Bog | MNTTAPLVKTPSSSLSAQLRLIGLRAVPADLDDFLTRATKSRWSPQQLIEHLV |
| Ga0182032_116391791 | 3300016357 | Soil | MSSPAPKTTTIPSNSLLAQLEQIGLRALPAQLDDFLARAAKS |
| Ga0182034_120498501 | 3300016371 | Soil | MNLPITATTIPTNSLPAQLQQIGLRSLPANLDDFLAHATKAR |
| Ga0182037_104527872 | 3300016404 | Soil | MSSPIRATMTPSNNLPAQLEQIGLHAVAAEVDDFLARATKQRWSPRQMLEH |
| Ga0134083_101449982 | 3300017659 | Grasslands Soil | MNSPTRTTTTPSNSLPAQLEQIGLHTVAAGVDDFL |
| Ga0187879_105032762 | 3300017946 | Peatland | MSSPATTIHPMNNLTAQLKQIGLRAVAADLDDFLARAT |
| Ga0187783_113789342 | 3300017970 | Tropical Peatland | MNSPVPNAKNPNNLAALLQQIGLRSLPSELDDFLARAVKARWSP |
| Ga0187863_109035251 | 3300018034 | Peatland | MNSPTRATTTPSSSLPAQLEQIGLHALATEMDDFLARATKQRW |
| Ga0187862_103232331 | 3300018040 | Peatland | MNSPTRVTTTPSNSLPAQLEQIGLHALATEVDDFLAR |
| Ga0187890_100378051 | 3300018044 | Peatland | MSSPTLPTTTPNNNLPAQLQQLGLRALPAQLDDFLARAS |
| Ga0187858_100685784 | 3300018057 | Peatland | MNSPAPTTTIPSNSLPAQLQQIGLRALPAELDDFLARATKARWSP |
| Ga0187858_104024952 | 3300018057 | Peatland | MSSPIRATTTPSNSLPAQLEQIGLHAVAAEVDDFLARA |
| Ga0187784_103455141 | 3300018062 | Tropical Peatland | MNSPTPKTTTPNSNSLLTQLAQIGLRALPGELDDF |
| Ga0187784_114552971 | 3300018062 | Tropical Peatland | MNSRTRTMTTPSSSLPAQLEQIGLHALAGELDDFLARA |
| Ga0066655_102843501 | 3300018431 | Grasslands Soil | MSSPTRATTTPSNSLPAQLEQIGLHALGATMDDFLARATKQR |
| Ga0066662_105511481 | 3300018468 | Grasslands Soil | MNSPAPKTTTPNSSLSAQLQQIGLRALPAHLDDFVAHA |
| Ga0066662_119570192 | 3300018468 | Grasslands Soil | MNSPSKTTTRNDLTAQLQQIGLRPLPQNLDDFLAR |
| Ga0181512_14538902 | 3300019270 | Peatland | MNSPTRVTTTTPSNSLPAQLEQIGLHALASEVDDFLTRATKLRWSP |
| Ga0173482_102952942 | 3300019361 | Soil | MNSPTRATTTPSNSLPAQLEQIGLHALAAEVNDFLARATKQRWSPRQ |
| Ga0194111_104138681 | 3300020083 | Freshwater Lake | MSSPARTMTMPSHSLPAQLEQIGLRAVPGELDDFLARAAKLRWSP |
| Ga0210401_115553721 | 3300020583 | Soil | MNSPATMTVTMTPGNSLSAQLRQIGLRAIPADLDDFLARATKNRWSPQQ |
| Ga0210377_105194392 | 3300021090 | Groundwater Sediment | MSSPTRTTTPINSLAVQLQQIGLRAVPVELDDFLA |
| Ga0210369_10897572 | 3300021297 | Estuarine | MNSRTRTTTTPSHSLAALLEQIGLHALAGEVDDFVARATKQRW |
| Ga0213881_102291241 | 3300021374 | Exposed Rock | MNSPTPLTMSPRNELPAQLEQIGLRALPAELDDFL |
| Ga0210394_103014281 | 3300021420 | Soil | MNSPTRATTTPSNNLPAQLEQIGLHALATEVDDFLARATKQRWSPRQTLEHLAQT |
| Ga0210402_107709672 | 3300021478 | Soil | MNSPTRATTTPSNSLPAQLEQIGLHALATEVDDFLARATKQRWSPRQTLEHLAQT |
| Ga0126371_123182832 | 3300021560 | Tropical Forest Soil | MNLPVTETTIPTNSLAAQLQQIGLRSLPANLDDFVA |
| Ga0213851_15455011 | 3300021860 | Watersheds | MNSPTLRTTTIPSNSLPSQLQQLGLRALPAQLDDF |
| Ga0224500_103956122 | 3300022213 | Sediment | MNSPAPMTTTMMNPANSLPANLTQIGLRALPGQLDDFLARATKARWS |
| Ga0224556_11876842 | 3300024295 | Soil | MNSPATTTMTTTPSNSLPAQLRQIGLCAIPADLDDFLARATKNR |
| Ga0209381_10954002 | 3300025161 | Hot Spring Sediment | MNSRTRTTTAPSPSLQAQLAQIGLDAVAAELDDFLARATKQRWSPRQ |
| Ga0207692_112160472 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MNSPASNTTILSNSLSTQLQQIGLRALPAGLDDFLARATKAR |
| Ga0207663_109585541 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MSSPTLKTTTPSNNLPAQLQQIGLHALPAQLDDFL |
| Ga0207649_108036701 | 3300025920 | Corn Rhizosphere | MNSPVPNAKNPNNLAALLQQIGLRSLPSELDDFLARAV |
| Ga0207669_114623722 | 3300025937 | Miscanthus Rhizosphere | MNSPTRATTTPSNSLPAQLEQIGLHTLAAEVNDFLARATKQRWSPR |
| Ga0207711_121376531 | 3300025941 | Switchgrass Rhizosphere | MNSPTRATTTPNNSLPAQLEQIGLHALAAGMDDFLARAIKQRWSP |
| Ga0207661_105587892 | 3300025944 | Corn Rhizosphere | MSSPTRATTTPSNSLPAQLEQIGLHALAAGVDDFLA |
| Ga0207703_113587192 | 3300026035 | Switchgrass Rhizosphere | MNSPASNTMIPSHSLSAQLQQIGLRALPAGLDDFLARATKA |
| Ga0207702_111491932 | 3300026078 | Corn Rhizosphere | MNSPTRATTTPSNSLPVQLEQVGLHAVASGVDDFLARATKQR |
| Ga0207676_113414731 | 3300026095 | Switchgrass Rhizosphere | MNSPAPRTTTQSNSLPAQLQQIGLRALPAELDDFLARAAKS |
| Ga0209018_10952762 | 3300026278 | Anoxygenic And Chlorotrophic Microbial Mat | MNSRTHTTTAPSPSLQAQLAQIGLDAVAAELDDFLARATKQRWSP |
| Ga0209238_10268633 | 3300026301 | Grasslands Soil | MNSPSKTTTKNDLTAQLQQIGLRALPENLDDFLARASKAR |
| Ga0209055_11379121 | 3300026309 | Soil | MNSPTRATTTPSNSLPAQLEQIGLHALASEVDDFL |
| Ga0209154_12004592 | 3300026317 | Soil | MNSPSKTTTKNDLTAQLQQIGLRALPENLDDFLAR |
| Ga0207744_10079391 | 3300026927 | Tropical Forest Soil | MSSPTRTTTNPSNSLPAQLEQIGLHALASEVDDFLARATKQRWSPRQI |
| Ga0209730_10169501 | 3300027034 | Forest Soil | MNSASKTTTKNDLPAQLQQIGLRALPENLDDFLAR |
| Ga0207855_10288881 | 3300027039 | Tropical Forest Soil | MSSPIRTTTTPSNSLPAQLEQIGLHAVAGEVDDFL |
| Ga0209656_102721572 | 3300027812 | Bog Forest Soil | MRSPAVKTTIPSNSLLSQLQQIGLRALPSGLDDFL |
| Ga0209583_102970491 | 3300027910 | Watersheds | MPLPALKTATTTHSNSLASQLQQIGLRALPTQLDDFLAHAIK |
| Ga0268266_108572002 | 3300028379 | Switchgrass Rhizosphere | MSSPIPTTTTLSNSLPAQLEQIGLHVVAGELDDFLARATKQRW |
| Ga0302262_102097322 | 3300028743 | Fen | MPSPAPATTTNPMSSLAAQLQQIGLRAVPAELDDFLARAIKARWSPRV |
| Ga0302221_104035661 | 3300028806 | Palsa | MSSPVTTKTPTNNLPQLLQQIGLRALPSNLDDFLARA |
| Ga0302218_102086742 | 3300028863 | Palsa | MTPSNSLSSQLRQIGLCAIPADLDDFLARAAKNRWSPQQLIEQLV |
| Ga0302254_103499761 | 3300028870 | Fen | MPSPAPATTTNPMSSLAAQLQQIGLRAVPAELDDFLARAIK |
| Ga0308309_105522661 | 3300028906 | Soil | MNSPTLKTTTLSNSLPTQLQQIGLRSLPAQLDDFLAH |
| Ga0311362_102229591 | 3300029913 | Bog | MTTTPSNSLSSQLRQIGMCAIPADLDDFLARATKNRWSPQQLI |
| Ga0311363_110477962 | 3300029922 | Fen | MTPSNSLSSQLRQIGLCAIPADLDDFLARATKNRWSPQQ |
| Ga0311328_104677682 | 3300029939 | Bog | MNSAARMTMTPGNSLAAQLRQIGLRAIPADLDDFLARATKHRWSPQQL |
| Ga0311328_108072172 | 3300029939 | Bog | MNSPATTTPNNSLSAQLRQIGLRAIPADLDDFLTRATKNRWSPQQLIE |
| Ga0311343_109788352 | 3300029953 | Bog | MRSPATTTHPMNNLVAQLEQIGLRALPANLDDFLARATRAHWSPLM |
| Ga0311331_100852131 | 3300029954 | Bog | MTPSNSLSSQLRQIGLCAIPADLDDFLARATKNRWSP |
| Ga0311331_110163031 | 3300029954 | Bog | MNSPATTTMTTTPSNSLSSQLRQIGMCAIPADLDDFLARAT |
| Ga0311331_110652101 | 3300029954 | Bog | MNSPVTVTTTPSNSLSAQLRQIGLRAIPADLDDFLARATKNRWS |
| Ga0311339_104670872 | 3300029999 | Palsa | MNSSAPKTTTPSHSLSAQLQQIGLRALPAQLDDFI |
| Ga0311350_117184722 | 3300030002 | Fen | MPLPALKTMTTTTHSNSLASQLEQIGLRALPAQLDDFLAHA |
| Ga0302270_104696072 | 3300030011 | Bog | MSSPATTNHPRNSLAAQMEQIGLRALAANLDDFLARATRSHWSPLML |
| Ga0311370_110142772 | 3300030503 | Palsa | MSSPVTTKTPTNNLPQLLQQIGLRALPSNLDDFLARAIRGRWSPHT |
| Ga0302192_100429573 | 3300030507 | Bog | MMNSPATTTPSNSLSAQLRQIGLQAIPADLDDFLARATKNR |
| Ga0311356_117824621 | 3300030617 | Palsa | MNSLASKTTTRNNLAAQLQQIGLCAVPQNLDDFLARGTKARWSL |
| Ga0311345_112968131 | 3300030688 | Bog | MNSPITMPMTTTPSNSLSAQLRQIGLRALPADLDDFVARATK |
| Ga0302325_107371361 | 3300031234 | Palsa | MNSPAANAKNPNNLAVLLQQIGLRSLPSELDDFLARAVKARWS |
| Ga0302324_1014773992 | 3300031236 | Palsa | MNSPVTVTTTPSNSLSAQLRQIGLRAIPADLDDVLARATKNRWS |
| Ga0265316_105591552 | 3300031344 | Rhizosphere | MNSPTRATTTPSNSLPAQLEQIGLHALAAEVDDFLARATKQRWSP |
| Ga0302320_119655621 | 3300031524 | Bog | MNSPATTMTTPGNNLSAQLRQIGLRAIPADLDDFLTRATKN |
| Ga0302326_104681183 | 3300031525 | Palsa | MNSPAMTTPSNSLSGQLRQIGLRAIPADLDDFLARATKS |
| Ga0302326_123460981 | 3300031525 | Palsa | MINTPAPQTTTTPTNNLPDQLRQIGLRALPAQLDD |
| Ga0307476_113299271 | 3300031715 | Hardwood Forest Soil | MNSPAPKTTTPNHSLAAQLQQIGMRALPAQLDDFIARATKARWSPH |
| Ga0307477_106448222 | 3300031753 | Hardwood Forest Soil | MSSPARKTTTPTNSLPAQLQQIGLCALPMQLDDFL |
| Ga0318497_108226771 | 3300031805 | Soil | MSSPIRATMTPSNSLPAQLEQIGLHAVAAEVDDFLARATKQR |
| Ga0318522_103352282 | 3300031894 | Soil | MNLPVTTTTIPTNSLAAQLQQIGLRSLPANLDDFLARA |
| Ga0318520_107355442 | 3300031897 | Soil | MTSPVTMMTPMSSLATQLRQIGLRALPANLDDFLARAIKA |
| Ga0318520_108393432 | 3300031897 | Soil | MSSPIRATMTPSNNLPAQLEQIGLHAVAAEVDDFLARATKQRWSPRQML |
| Ga0318520_110496792 | 3300031897 | Soil | MSSHATANVPVNNLAAQLAQIGLRSLPDQLDDFLARAVKAR |
| Ga0306923_120528002 | 3300031910 | Soil | MNSRTRTTTTPSNSLPAQLEQIGLHALAGELDDFLARATKQRWSSRQVL |
| Ga0310913_111561341 | 3300031945 | Soil | MSSPTAKTTTPNSNSLLTQLQQIGLRALPAELDDFLARAAKARWSPL |
| Ga0308176_112399441 | 3300031996 | Soil | MNLPTRAMTTPSNSLPAQLEQIGLHAMASEVDDFLARAAKQ |
| Ga0306922_109441922 | 3300032001 | Soil | MNSPSKTTTKNDLTAQLQQIGLWALPQNLDDFLARASKARW |
| Ga0318507_103125592 | 3300032025 | Soil | MTSPVTTMSPMNSLVTQLRQIGLRALPANLDDFLARAIKTRWSPHQL |
| Ga0318558_106449331 | 3300032044 | Soil | MNSPVPAKSPTNNLSQLLQQIGLRALPANLDDFLARAMKGHWSP |
| Ga0315284_110179241 | 3300032053 | Sediment | MNSPATKNTTTPKNNLPVQLQQLGLRALPAQLDDFLARAIK |
| Ga0318505_105879431 | 3300032060 | Soil | MSSPIRATMTPSNSLPAQLEQIGLHAVAAEVDDFLARATKQRWSPRQM |
| Ga0311301_106970821 | 3300032160 | Peatlands Soil | MNSPTRVTTTPSNSLPAQLEQIGLHALATEVDDFLARATK |
| Ga0335085_102012974 | 3300032770 | Soil | MNSPTRATTTPSHSLPAQLEQIGLHALAADVDDFLSRATKQRWSPRQILEHLAQTEA |
| Ga0335085_114726601 | 3300032770 | Soil | MNSPAPTMTMPSHSLPAQLEQIGLRAVPTELDDFLARATKLRWSPRQ |
| Ga0335085_115578261 | 3300032770 | Soil | MTSPIVKTTQTTITNPSPSLIDQLQQIGLRSLPAQLDDFLARAAK |
| Ga0335079_111081832 | 3300032783 | Soil | MNSPAPTMTTPSNSLPAQLEQIGLHALAGELDDFLAR |
| Ga0335079_114345481 | 3300032783 | Soil | MSSPARTMTMSSHSLPAQLEQIGLRAVPAELDDFLARATKQ |
| Ga0335079_119785072 | 3300032783 | Soil | MNSPVTATTITNNLPAQLQQIGLRSLPANLDDFLARATKARWP |
| Ga0335081_101145901 | 3300032892 | Soil | MSSPTLKTTAMTTPNPSLTAQLAQIGLRSLPSQLDDFLARAAKARWSALQI |
| Ga0335081_113227892 | 3300032892 | Soil | MSSPTPTTTTPSNSLPAQLQQIGLHVVAGELDDFLAR |
| Ga0335081_127290352 | 3300032892 | Soil | MNSPTPTTTTLSNSLPVQLEQIGLHALAGELDDFLAR |
| Ga0335071_117640342 | 3300032897 | Soil | MNSPTPTMTTPSNSLPAQLEQIGLHALAGELDDFLSRAIKQHWSPRQVLEHL |
| Ga0335083_103247421 | 3300032954 | Soil | MNSPTPTTTTLSNSLPVQLEQIGLHALAGELDDFLARAAKQRWSP |
| Ga0335083_113947692 | 3300032954 | Soil | MNSPTRSMTPNNSLPTELEQIGLHAVAAELDDFLSRATKQRWSPRQILEHLAQTEAAERA |
| Ga0326728_103301041 | 3300033402 | Peat Soil | MSSPTTMTTTSPMNSLATQLQQIGLRAVPAGLDDFLARATKSRW |
| Ga0316629_114472631 | 3300033483 | Soil | MNSRTRTTTTPSNSLPAQLEQIGLHALAGELNDFLA |
| Ga0370514_124219_2_139 | 3300034199 | Untreated Peat Soil | MNSPAPEKPTIPTSNLPDQLRQIGLRALPAQLDDFLARATKARWSP |
| ⦗Top⦘ |