


| Basic Information | |
|---|---|
| Family ID | F061132 |
| Family Type | Metagenome |
| Number of Sequences | 132 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MRARSEPVRAFSTKDEAVRFAGRQLGGHYAVYHKHKKIWPAP |
| Number of Associated Samples | 110 |
| Number of Associated Scaffolds | 132 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 34.92 % |
| % of genes near scaffold ends (potentially truncated) | 77.27 % |
| % of genes from short scaffolds (< 2000 bps) | 87.88 % |
| Associated GOLD sequencing projects | 102 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (72.727 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (16.667 % of family members) |
| Environment Ontology (ENVO) | Unclassified (21.212 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (50.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 14.29% β-sheet: 11.90% Coil/Unstructured: 73.81% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 132 Family Scaffolds |
|---|---|---|
| PF09538 | FYDLN_acid | 2.27 |
| PF07813 | LTXXQ | 2.27 |
| PF13439 | Glyco_transf_4 | 1.52 |
| PF11154 | DUF2934 | 1.52 |
| PF07750 | GcrA | 1.52 |
| PF06577 | EipA | 1.52 |
| PF00550 | PP-binding | 0.76 |
| PF07568 | HisKA_2 | 0.76 |
| PF04392 | ABC_sub_bind | 0.76 |
| PF09992 | NAGPA | 0.76 |
| PF06725 | 3D | 0.76 |
| PF00534 | Glycos_transf_1 | 0.76 |
| PF09834 | DUF2061 | 0.76 |
| PF02922 | CBM_48 | 0.76 |
| PF13545 | HTH_Crp_2 | 0.76 |
| PF04290 | DctQ | 0.76 |
| PF08388 | GIIM | 0.76 |
| PF09335 | SNARE_assoc | 0.76 |
| PF08308 | PEGA | 0.76 |
| PF04800 | NDUS4 | 0.76 |
| PF00313 | CSD | 0.76 |
| PF11794 | HpaB_N | 0.76 |
| PF03706 | LPG_synthase_TM | 0.76 |
| PF07883 | Cupin_2 | 0.76 |
| PF03928 | HbpS-like | 0.76 |
| PF01068 | DNA_ligase_A_M | 0.76 |
| PF02838 | Glyco_hydro_20b | 0.76 |
| PF12244 | DUF3606 | 0.76 |
| COG ID | Name | Functional Category | % Frequency in 132 Family Scaffolds |
|---|---|---|---|
| COG3678 | Periplasmic chaperone Spy, Spy/CpxP family | Posttranslational modification, protein turnover, chaperones [O] | 9.09 |
| COG5352 | Uncharacterized conserved protein | Function unknown [S] | 1.52 |
| COG0392 | Predicted membrane flippase AglD2/YbhN, UPF0104 family | Cell wall/membrane/envelope biogenesis [M] | 0.76 |
| COG0398 | Uncharacterized membrane protein YdjX, related to fungal oxalate transporter, TVP38/TMEM64 family | Function unknown [S] | 0.76 |
| COG0586 | Membrane integrity protein DedA, putative transporter, DedA/Tvp38 family | Cell wall/membrane/envelope biogenesis [M] | 0.76 |
| COG1238 | Uncharacterized membrane protein YqaA, VTT domain | Function unknown [S] | 0.76 |
| COG1423 | ATP-dependent RNA circularization protein, DNA/RNA ligase (PAB1020) family | Replication, recombination and repair [L] | 0.76 |
| COG1793 | ATP-dependent DNA ligase | Replication, recombination and repair [L] | 0.76 |
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 0.76 |
| COG3525 | N-acetyl-beta-hexosaminidase | Carbohydrate transport and metabolism [G] | 0.76 |
| COG3920 | Two-component sensor histidine kinase, HisKA and HATPase domains | Signal transduction mechanisms [T] | 0.76 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 72.73 % |
| Unclassified | root | N/A | 27.27 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2088090014|GPIPI_16784926 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1204 | Open in IMG/M |
| 2124908045|KansclcFeb2_ConsensusfromContig815950 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 973 | Open in IMG/M |
| 2170459010|GIO7OMY01BDMP9 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 507 | Open in IMG/M |
| 2170459024|GZRSKLJ01D1L4Z | Not Available | 524 | Open in IMG/M |
| 3300000955|JGI1027J12803_100027869 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
| 3300000956|JGI10216J12902_112323506 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 527 | Open in IMG/M |
| 3300000956|JGI10216J12902_119806248 | Not Available | 620 | Open in IMG/M |
| 3300002906|JGI25614J43888_10080862 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → unclassified Pseudonocardia → Pseudonocardia sp. 73-21 | 901 | Open in IMG/M |
| 3300004479|Ga0062595_101567978 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
| 3300004633|Ga0066395_10442584 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 740 | Open in IMG/M |
| 3300005166|Ga0066674_10282508 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 782 | Open in IMG/M |
| 3300005180|Ga0066685_10325619 | All Organisms → cellular organisms → Bacteria | 1065 | Open in IMG/M |
| 3300005186|Ga0066676_10331502 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1014 | Open in IMG/M |
| 3300005186|Ga0066676_10765723 | Not Available | 656 | Open in IMG/M |
| 3300005332|Ga0066388_100979943 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi | 1412 | Open in IMG/M |
| 3300005332|Ga0066388_102141409 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1007 | Open in IMG/M |
| 3300005332|Ga0066388_104379997 | Not Available | 719 | Open in IMG/M |
| 3300005435|Ga0070714_101255914 | Not Available | 723 | Open in IMG/M |
| 3300005435|Ga0070714_102110393 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 549 | Open in IMG/M |
| 3300005436|Ga0070713_101202383 | Not Available | 734 | Open in IMG/M |
| 3300005439|Ga0070711_101778682 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 541 | Open in IMG/M |
| 3300005450|Ga0066682_10559757 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 722 | Open in IMG/M |
| 3300005468|Ga0070707_101196769 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 726 | Open in IMG/M |
| 3300005468|Ga0070707_101307198 | All Organisms → cellular organisms → Bacteria | 691 | Open in IMG/M |
| 3300005471|Ga0070698_101542771 | Not Available | 616 | Open in IMG/M |
| 3300005518|Ga0070699_100031907 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 4549 | Open in IMG/M |
| 3300005518|Ga0070699_100244837 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1601 | Open in IMG/M |
| 3300005536|Ga0070697_100870849 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 798 | Open in IMG/M |
| 3300005553|Ga0066695_10099629 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1780 | Open in IMG/M |
| 3300005557|Ga0066704_10465083 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 835 | Open in IMG/M |
| 3300005569|Ga0066705_10814483 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 556 | Open in IMG/M |
| 3300005764|Ga0066903_100784583 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1700 | Open in IMG/M |
| 3300005764|Ga0066903_101182448 | All Organisms → cellular organisms → Bacteria | 1418 | Open in IMG/M |
| 3300005764|Ga0066903_101995371 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1114 | Open in IMG/M |
| 3300005764|Ga0066903_103172868 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 889 | Open in IMG/M |
| 3300005764|Ga0066903_103913943 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 799 | Open in IMG/M |
| 3300005764|Ga0066903_103990607 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 791 | Open in IMG/M |
| 3300005764|Ga0066903_104152207 | All Organisms → cellular organisms → Bacteria | 775 | Open in IMG/M |
| 3300005764|Ga0066903_108074131 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300006031|Ga0066651_10512908 | Not Available | 635 | Open in IMG/M |
| 3300006032|Ga0066696_10190516 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1303 | Open in IMG/M |
| 3300006046|Ga0066652_101839261 | Not Available | 546 | Open in IMG/M |
| 3300006175|Ga0070712_100285197 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1331 | Open in IMG/M |
| 3300006800|Ga0066660_11015023 | Not Available | 665 | Open in IMG/M |
| 3300006854|Ga0075425_100198373 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2306 | Open in IMG/M |
| 3300006871|Ga0075434_100203631 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1999 | Open in IMG/M |
| 3300006904|Ga0075424_101366902 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 752 | Open in IMG/M |
| 3300006969|Ga0075419_10212489 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1284 | Open in IMG/M |
| 3300007076|Ga0075435_100484529 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1068 | Open in IMG/M |
| 3300009147|Ga0114129_13268419 | Not Available | 525 | Open in IMG/M |
| 3300010041|Ga0126312_10477976 | Not Available | 890 | Open in IMG/M |
| 3300010376|Ga0126381_101281175 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1059 | Open in IMG/M |
| 3300012199|Ga0137383_10041657 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3261 | Open in IMG/M |
| 3300012199|Ga0137383_10676033 | All Organisms → cellular organisms → Bacteria | 754 | Open in IMG/M |
| 3300012202|Ga0137363_10127123 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1975 | Open in IMG/M |
| 3300012204|Ga0137374_10064211 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3663 | Open in IMG/M |
| 3300012204|Ga0137374_10375827 | Not Available | 1138 | Open in IMG/M |
| 3300012204|Ga0137374_10712597 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → unclassified Comamonadaceae → Comamonadaceae bacterium | 752 | Open in IMG/M |
| 3300012209|Ga0137379_11437065 | Not Available | 592 | Open in IMG/M |
| 3300012210|Ga0137378_10440095 | All Organisms → cellular organisms → Bacteria | 1208 | Open in IMG/M |
| 3300012211|Ga0137377_10583982 | All Organisms → cellular organisms → Bacteria | 1055 | Open in IMG/M |
| 3300012353|Ga0137367_10158700 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1648 | Open in IMG/M |
| 3300012355|Ga0137369_10225954 | All Organisms → cellular organisms → Bacteria | 1431 | Open in IMG/M |
| 3300012355|Ga0137369_10300085 | All Organisms → cellular organisms → Bacteria | 1192 | Open in IMG/M |
| 3300012356|Ga0137371_10780828 | All Organisms → cellular organisms → Bacteria | 729 | Open in IMG/M |
| 3300012357|Ga0137384_11593287 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 503 | Open in IMG/M |
| 3300012361|Ga0137360_10006594 | All Organisms → cellular organisms → Bacteria | 7155 | Open in IMG/M |
| 3300012362|Ga0137361_10634840 | All Organisms → cellular organisms → Bacteria | 978 | Open in IMG/M |
| 3300012582|Ga0137358_10095472 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2011 | Open in IMG/M |
| 3300012948|Ga0126375_11152025 | Not Available | 642 | Open in IMG/M |
| 3300012951|Ga0164300_10525764 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 682 | Open in IMG/M |
| 3300012960|Ga0164301_11894069 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 504 | Open in IMG/M |
| 3300012971|Ga0126369_11389415 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 792 | Open in IMG/M |
| 3300013306|Ga0163162_11766170 | Not Available | 707 | Open in IMG/M |
| 3300015371|Ga0132258_11216163 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1904 | Open in IMG/M |
| 3300015372|Ga0132256_100164458 | Not Available | 2240 | Open in IMG/M |
| 3300016270|Ga0182036_11428107 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 580 | Open in IMG/M |
| 3300016319|Ga0182033_11688014 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 574 | Open in IMG/M |
| 3300016341|Ga0182035_11976184 | Not Available | 530 | Open in IMG/M |
| 3300016371|Ga0182034_10656303 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 889 | Open in IMG/M |
| 3300016387|Ga0182040_10893519 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 736 | Open in IMG/M |
| 3300016445|Ga0182038_10459991 | All Organisms → cellular organisms → Bacteria | 1079 | Open in IMG/M |
| 3300018482|Ga0066669_11461376 | Not Available | 620 | Open in IMG/M |
| 3300020579|Ga0210407_10426420 | All Organisms → cellular organisms → Bacteria | 1038 | Open in IMG/M |
| 3300020581|Ga0210399_10103860 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2327 | Open in IMG/M |
| 3300021168|Ga0210406_10371868 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1150 | Open in IMG/M |
| 3300021560|Ga0126371_13358585 | Not Available | 541 | Open in IMG/M |
| 3300025898|Ga0207692_10974481 | Not Available | 559 | Open in IMG/M |
| 3300025905|Ga0207685_10033380 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1860 | Open in IMG/M |
| 3300025905|Ga0207685_10693396 | Not Available | 554 | Open in IMG/M |
| 3300025906|Ga0207699_11442126 | Not Available | 509 | Open in IMG/M |
| 3300025910|Ga0207684_10508759 | All Organisms → cellular organisms → Bacteria | 1032 | Open in IMG/M |
| 3300025910|Ga0207684_11454571 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 559 | Open in IMG/M |
| 3300025916|Ga0207663_10976600 | Not Available | 679 | Open in IMG/M |
| 3300025922|Ga0207646_11101857 | All Organisms → cellular organisms → Bacteria | 699 | Open in IMG/M |
| 3300025929|Ga0207664_11755299 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 543 | Open in IMG/M |
| 3300025939|Ga0207665_10834011 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 729 | Open in IMG/M |
| 3300026304|Ga0209240_1251951 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 540 | Open in IMG/M |
| 3300026507|Ga0257165_1077766 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 609 | Open in IMG/M |
| 3300026524|Ga0209690_1206447 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 623 | Open in IMG/M |
| 3300026551|Ga0209648_10303621 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1139 | Open in IMG/M |
| 3300028047|Ga0209526_10969308 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 511 | Open in IMG/M |
| 3300028768|Ga0307280_10101299 | Not Available | 958 | Open in IMG/M |
| 3300031543|Ga0318516_10685804 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 582 | Open in IMG/M |
| 3300031573|Ga0310915_11220947 | Not Available | 519 | Open in IMG/M |
| 3300031724|Ga0318500_10617296 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
| 3300031744|Ga0306918_10402315 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1067 | Open in IMG/M |
| 3300031748|Ga0318492_10014142 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 3341 | Open in IMG/M |
| 3300031765|Ga0318554_10550030 | All Organisms → cellular organisms → Bacteria | 652 | Open in IMG/M |
| 3300031771|Ga0318546_10055113 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2489 | Open in IMG/M |
| 3300031771|Ga0318546_11182203 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 537 | Open in IMG/M |
| 3300031781|Ga0318547_10618200 | Not Available | 672 | Open in IMG/M |
| 3300031795|Ga0318557_10319554 | All Organisms → cellular organisms → Bacteria | 713 | Open in IMG/M |
| 3300031799|Ga0318565_10498087 | Not Available | 588 | Open in IMG/M |
| 3300031833|Ga0310917_10382518 | All Organisms → cellular organisms → Bacteria | 956 | Open in IMG/M |
| 3300031890|Ga0306925_10474244 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1335 | Open in IMG/M |
| 3300031896|Ga0318551_10636193 | All Organisms → cellular organisms → Bacteria | 616 | Open in IMG/M |
| 3300031910|Ga0306923_10307946 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1810 | Open in IMG/M |
| 3300031941|Ga0310912_10920540 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 672 | Open in IMG/M |
| 3300032025|Ga0318507_10055248 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1572 | Open in IMG/M |
| 3300032063|Ga0318504_10170265 | All Organisms → cellular organisms → Bacteria | 1009 | Open in IMG/M |
| 3300032094|Ga0318540_10469068 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 608 | Open in IMG/M |
| 3300032180|Ga0307471_103284194 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 573 | Open in IMG/M |
| 3300032261|Ga0306920_104045174 | Not Available | 531 | Open in IMG/M |
| 3300033289|Ga0310914_11891794 | Not Available | 501 | Open in IMG/M |
| 3300033290|Ga0318519_10431029 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 788 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 16.67% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 15.91% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 13.64% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 12.88% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 9.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 7.58% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.55% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.79% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.03% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.27% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 2.27% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.76% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.76% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.76% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.76% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.76% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.76% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.76% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.76% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.76% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.76% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2088090014 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 2124908045 | Soil microbial communities from Great Prairies - Kansas assembly 1 01_01_2011 | Environmental | Open in IMG/M |
| 2170459010 | Grass soil microbial communities from Rothamsted Park, UK - December 2009 direct MP BIO1O1 lysis 0-9cm (no DNA from 10 to 21cm!!!) | Environmental | Open in IMG/M |
| 2170459024 | Grass soil microbial communities from Rothamsted Park, UK - FD1 (NaCl 300g/L 5ml) | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002906 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
| 3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes) | Environmental | Open in IMG/M |
| 3300026507 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-12-B | Environmental | Open in IMG/M |
| 3300026524 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028768 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119 | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
| 3300031799 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
| 3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
| 3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| GPIPI_03954450 | 2088090014 | Soil | RVMRARSEPVRAFSTKDEAVRFAGRQLGGHYAVYHKDKKIWPAS |
| KansclcFeb2_15724970 | 2124908045 | Soil | MRARSEPVRAFSTKDEAVRFAGRQLGGHYAVYHKHKKIWPAP |
| F62_01667410 | 2170459010 | Grass Soil | RSGPVRAFSTKDEAIRFASRQLGGHYAVYHKHKKIWPAP |
| FD1_00893840 | 2170459024 | Grass Soil | AFATKDEAVRFAGRQLGDHYAVYHKDRKIWPAPEDGMFSS |
| JGI1027J12803_1000278692 | 3300000955 | Soil | RAGRLMRARSEPVRAFATKDEAVRFAGRQLGDHYAVYHKDRKIWPPP* |
| JGI10216J12902_1123235062 | 3300000956 | Soil | VHLLTRAGRLMRARSEPVRAFATKDEAVRFASRQLGEHYAVYHKDRKIWPAP* |
| JGI10216J12902_1198062482 | 3300000956 | Soil | LTRAGRVMRARSEPVRAFSNKDEAVRFAGRQLGGHYAVYHKDKKIWPAP* |
| JGI25614J43888_100808622 | 3300002906 | Grasslands Soil | HLLTRAGRVMRARSEPVRAFSNKDEAVRFAGRQLGGHYAVYHKHKKIWPAP* |
| Ga0062595_1015679781 | 3300004479 | Soil | HLLTRAGRLMRARSEPVRAFATKDEAIRFAGRQLGEHYAVYHKDRKIWPAS* |
| Ga0066395_104425842 | 3300004633 | Tropical Forest Soil | MRARSEPVRAFSTKDEAVRFAGRQLGGNYAVYHKDRKIWPISHDAPR* |
| Ga0066674_102825081 | 3300005166 | Soil | MRVRSGPVRAFSTKDEAVRFAGRQLGGDYAVYHKHRKIWPVS* |
| Ga0066683_100750252 | 3300005172 | Soil | MVRAGRVLRACGGPVREFSTKDEAVKFVGRQLGGYYAVYRNHKKIWPVS* |
| Ga0066685_103256191 | 3300005180 | Soil | MRARSEPVRAFSTKDEAVRFAARQLGEHYAVYHKDRKIWPAP* |
| Ga0066676_103315021 | 3300005186 | Soil | PAPFKVRLMVRAGRVLRACGGPVREFSTKDEAVKFVGRQLGGYYAVYRNHKKIWPVS* |
| Ga0066676_107657232 | 3300005186 | Soil | KIHLLTRAGRVMRARSEPVRAFSTKDEAVRFAARQLGEHYAVYHKDRKIWPAP* |
| Ga0066388_1009799433 | 3300005332 | Tropical Forest Soil | FKVHLLTRAGRVMRARSEPVRAFSNKDEAVRFAGRQLGGDYAVYHKHKKIWPAP* |
| Ga0066388_1021414092 | 3300005332 | Tropical Forest Soil | TRAGRVMRARSEPVRAFSTKDEAVRFAGRQLGGHYAVYHKDRKIWPTS* |
| Ga0066388_1043799972 | 3300005332 | Tropical Forest Soil | MRGEPVRAFSTKDEAVRFAGRQLGGNYAVYHKDRKIWPIPHDVPR* |
| Ga0070714_1012559142 | 3300005435 | Agricultural Soil | MRVRSGPVRAFSTKEEAVRFAGRQLGGDYAVYHNHRKIWPAEQ |
| Ga0070714_1021103931 | 3300005435 | Agricultural Soil | RLMRARSEPVRAFATKDEAIRFAGRQLGEHYAVYHKDRKIWPAS* |
| Ga0070713_1012023833 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | KVHLLTKAGRVMRARSQPLRAFCTKDEAVRFAGRQLGEHYAVYHKDRKIWPIR* |
| Ga0070711_1017786821 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | VSCARSEPVRAFFTKDEAVRFAGLGGHYAVYHKDRKIWPIP* |
| Ga0066682_105597571 | 3300005450 | Soil | MRARSEPVRAFSNKDEAVRFAGRQLGGHYAVYHKHKKIWPAP* |
| Ga0070707_1011967692 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MRARSEPVRAFSTKDEAVRFACRQLGGHYAVYRKHKKIWPAP* |
| Ga0070707_1013071982 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | HLLTRAGRLMRARSEPVRAFATKDEAIRFAGRQLGGHYAAYHRHKKIWPAP* |
| Ga0070698_1015427712 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MRARSGAVRAFSTKDEAVRFAGRQLGGHYAVYHKDRKIWPTP* |
| Ga0070699_1000319078 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | PFKVHLLTRAGRLMRARSEPVRAFATKDEAIRFAGRQLGGHYAAYHRHKKIWPAP* |
| Ga0070699_1002448374 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | PFKVHLLTRAGRLMRARSEPVRAFATKDEAIRFAGRQLGEHYAVYHKDRKIWPAS* |
| Ga0070697_1008708492 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MRARSEPVRAFATKDEAIRFAGRQLGEHYAVYHKDRKIWPAS* |
| Ga0066697_100842984 | 3300005540 | Soil | MVRAGRVLRACGGPVREFSTKDEAVKFVGRQLGGYDAVYRNHKKIWPVS* |
| Ga0066695_100996293 | 3300005553 | Soil | MRARSEPVRAFSNKDEAVRFAGRQLGGHYAVYHKHKKVWPAP* |
| Ga0066704_104650834 | 3300005557 | Soil | MRARSEPVRAFATKDEAIRFAGRQLGEHYAVYHKDRKIWP |
| Ga0066705_108144832 | 3300005569 | Soil | MRARSEPVRAFSTKDEAVRFAARQLGEHYAVYHKDRKIWP |
| Ga0066903_1007845836 | 3300005764 | Tropical Forest Soil | MRARSEPVRAFSTKDEAVRFAGRQLGGNYAVYHKDKKIWPA |
| Ga0066903_1011824484 | 3300005764 | Tropical Forest Soil | RVMRARSEPVRAFSTKDEAVRFAGRQLGGNYAVYHKDRKTWPTP* |
| Ga0066903_1019953713 | 3300005764 | Tropical Forest Soil | MRACSEPVRAFSTKDEAVRFAGRQLGGNYAVYRKDRKIWPISH |
| Ga0066903_1031728682 | 3300005764 | Tropical Forest Soil | MRARSEPVRAFSTKDEAVRFAGRQLGGNYAVYHKDRKIWPIS |
| Ga0066903_1039139432 | 3300005764 | Tropical Forest Soil | RARSEPVRAFSTKDEAVRFAGRQLGGNYAVYHKDRKTWPTP* |
| Ga0066903_1039906071 | 3300005764 | Tropical Forest Soil | MRARSDPVRAFSNKDEAVRFAGRQLGGHYAVYHKHKKIWPAP* |
| Ga0066903_1041522072 | 3300005764 | Tropical Forest Soil | LMRARSEPVRAFATKDEAIRFAGRQLGEHYAVYHKDRKIWPAS* |
| Ga0066903_1060316371 | 3300005764 | Tropical Forest Soil | PFKIHLMTRAGRVMRARSGPVRAFSTKDEAVRFAGRQLGGH* |
| Ga0066903_1080741312 | 3300005764 | Tropical Forest Soil | VRAFSTKDEAVRFAGRQLGGHYAVYHKDRKIWPTS* |
| Ga0066651_105129081 | 3300006031 | Soil | RVLRACGGPVREFSTKDEAVKFVGRQLGGYYAVYRNHKKIWPVS* |
| Ga0066696_101905161 | 3300006032 | Soil | MRARSGLVRAFSTKDEAIRYAGRQLGGHYAVYHKHKKI |
| Ga0066652_1018392611 | 3300006046 | Soil | MRARSGLVRAFSTKDEAIRFAGRQLGGHYAVYHKHKKIWPGPPFRNPS |
| Ga0070712_1002851972 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | LMRARSEPVRAFATKDEAVRFAGRQLGGHYAVYHKDRKIWPAP* |
| Ga0066660_110150232 | 3300006800 | Soil | TKAGRVMRARSEPVRAFFTKDEAVRFAGRQLGGHYAVYHKDRKIWPIP* |
| Ga0075425_1001983732 | 3300006854 | Populus Rhizosphere | MRARSEPVRAFSTKDEAVRFAARQLGGHYAVYHKERKIWPTS* |
| Ga0075434_1002036312 | 3300006871 | Populus Rhizosphere | MRARSEPVRAFSTKDEAVRFAGRQLGGHYAVYHKDRKIWPIP* |
| Ga0075424_1013669023 | 3300006904 | Populus Rhizosphere | MRVRSGPVRAFSTKEEAVRFAGRQLGGDYAVYHNHRKIWPAS* |
| Ga0075419_102124892 | 3300006969 | Populus Rhizosphere | MRARTEPVRAFSTKDEAVRFAGRQLGGHYAVYHKHRKIWPAP* |
| Ga0075435_1004845291 | 3300007076 | Populus Rhizosphere | PVRAFSNKDEALRFAGRQLGGHYAVYHKHKKIWPAP* |
| Ga0114129_132684191 | 3300009147 | Populus Rhizosphere | MRARSGPVRAFSTKDEAVRFAGRQLGGHYAVYHKHRKIWP |
| Ga0126312_104779761 | 3300010041 | Serpentine Soil | HLMTRAGRVMRARSEPVRAFSTKDEAVRFAGRQLGDHYAVYHKDRKIWPPP* |
| Ga0134082_104837622 | 3300010303 | Grasslands Soil | VLRACGGPVREFSTKDEAVKFVGRQLGGYYAVYRNHKKIWPVS* |
| Ga0126381_1012811753 | 3300010376 | Tropical Forest Soil | PFKVHLLTRAGRVMRARSEPVRAFSTKDEAVRFAGRQLGGHYAVYHKHKKIWPPS* |
| Ga0137383_100416575 | 3300012199 | Vadose Zone Soil | MRARSEPVRAFSTKDEAVRFACRQLGGHYAVYRKHNKIWPAP |
| Ga0137383_106760332 | 3300012199 | Vadose Zone Soil | FKVHLLTRAGRLMRARSEPVRAFATKDEAIRFAGRQLGGHYAAYHRHKKIWPAP* |
| Ga0137363_101271233 | 3300012202 | Vadose Zone Soil | GRVMRARSEPVRAFSNKDEAVRFAGRQLGGHYAVYHKHKKIWPAP* |
| Ga0137374_100642111 | 3300012204 | Vadose Zone Soil | MRARSEPVRAFSTKDEAVRFAGRQLGGDYAVYHKDRKIWPTP* |
| Ga0137374_103758272 | 3300012204 | Vadose Zone Soil | KVHLLTRAGRLMRARSEPVRAFATKDEAIRFAGRQLGEHYAVYHKDRKIWPAS* |
| Ga0137374_107125972 | 3300012204 | Vadose Zone Soil | KVHLLTRAGRLMRARSEPVRAFATKDEAIRFAGRQLGEHYEVYHKDRKIWPAS* |
| Ga0137379_114370651 | 3300012209 | Vadose Zone Soil | ARSEPVRAFSTKDEAVRFAGRQLGGDYAVYHKDRKIWPTP* |
| Ga0137378_104400951 | 3300012210 | Vadose Zone Soil | PVRAFSNKDEAVRFAGRQLGGHYAVYHKHKKVWPAP* |
| Ga0137377_105839823 | 3300012211 | Vadose Zone Soil | RSEPVRAFSNKDEAVRFAGRQLGGHYAVYHKHKKVWPAP* |
| Ga0137367_101587001 | 3300012353 | Vadose Zone Soil | MRARSEPVRVFSNKDEAVRFAGRQLGGHYAVYHKHKKVWPAP* |
| Ga0137369_102259542 | 3300012355 | Vadose Zone Soil | RAFSTKDEAVRFAGRQLGDHYAVYHKDRKIWPPP* |
| Ga0137369_103000851 | 3300012355 | Vadose Zone Soil | APFKVHLLTRAGRLMRARSEPVRAFATRDEAIRFAGRQLGEHYAVYHKDRKIWPAS* |
| Ga0137371_107808282 | 3300012356 | Vadose Zone Soil | VRAFSNKDEAVRFAGRQLGGHYAVYHKHKKVWPAP* |
| Ga0137384_115932871 | 3300012357 | Vadose Zone Soil | PVRAFATKDEAIRFAGRQLGEHYAVYHKDRKIWPAS* |
| Ga0137360_100065947 | 3300012361 | Vadose Zone Soil | RAFSNKDEAVRFAGRQLGGHYAVYHKHKKIWPAP* |
| Ga0137361_106348402 | 3300012362 | Vadose Zone Soil | MRARSDPVRAFSNKDEALRFAGRQLGGHYAVYHKHKKIWPAP* |
| Ga0137358_100954724 | 3300012582 | Vadose Zone Soil | RLMRARSEPVRAFATKDEAVRFAGRQLGEHYAVYHKDRKTWPAP* |
| Ga0126375_111520252 | 3300012948 | Tropical Forest Soil | ARSEPVRAFSTKDEAVKFAGRQLGGHYAVYHKHRKIWPVP* |
| Ga0164300_105257642 | 3300012951 | Soil | MRARSEPVRAFSNKDEAVRFAGRQLGGHYAVYHKDRKIWPAP* |
| Ga0164301_118940691 | 3300012960 | Soil | TRAGRVMRARSEPVRAFSTKDEAVRFAGRQLGGDYAVYHKHRKIWPAP* |
| Ga0126369_113894151 | 3300012971 | Tropical Forest Soil | MRGEPVRAFSTKDEAVRFAGRQLGGNYAVYHKDRKIWPISHDAPR* |
| Ga0163162_117661701 | 3300013306 | Switchgrass Rhizosphere | FKVHLLTRAGRVMRARSEPVRAFSTKDEAVRFAGRQLGGHYAVYHKHKKIWPAS* |
| Ga0132258_112161632 | 3300015371 | Arabidopsis Rhizosphere | MRARSEPVRAFATKDEAVRFAGRQLGGHYAVYHKHKKIWPAL* |
| Ga0132256_1001644584 | 3300015372 | Arabidopsis Rhizosphere | MRARSEPVRAFSTKDEAVRFAGRQLGGDYAVYHKDRKIWPTS* |
| Ga0182036_114281073 | 3300016270 | Soil | FKVHLLTRAGRLMRARSEPVRAFAPKDEAIRFAGRQLGEHYAVYHKDRKIWLAS |
| Ga0182033_116880141 | 3300016319 | Soil | MRAHTEPVRAFSTKDEAVRFAGRQLGGNYAVYHKDRKIWPISHDA |
| Ga0182035_119761841 | 3300016341 | Soil | SEPVRAFATKDEAIRFAGRQLGEHYAVYHKDRKIWQA |
| Ga0182034_106563031 | 3300016371 | Soil | MRAHTEPVRAFSTKDEAVRFAGRQLGGNYAVYHKDRKIW |
| Ga0182040_108935192 | 3300016387 | Soil | MRAHTEPVRAFSTKDEAVRFAGRQLGGNYAVYHKDRKIWP |
| Ga0182038_104599911 | 3300016445 | Soil | RAGRLMRARSEPVRAFATKDEAIRFAGRQLGEHYEVYHKDRKIWPAS |
| Ga0066655_100522301 | 3300018431 | Grasslands Soil | MVRAGRVLRACGGPVREFSTKDEAVKFVGRQLGGYYAVYRNHKKIWPVS |
| Ga0066669_114613761 | 3300018482 | Grasslands Soil | GRVMRVRSGPVRAFFTKDEAVRFAGRQLGGHYAVYHKDRKIWPIP |
| Ga0210407_104264204 | 3300020579 | Soil | PFKVHLLMRAGRLMRARSEPVRAFATKDEAIRFAGRQLGEHYAVYHKDRKIWPAS |
| Ga0210399_101038603 | 3300020581 | Soil | MRARTEPVRTFSTKDEAVRFAGRQLGGHYAVYHKDRKIWPTP |
| Ga0210406_103718683 | 3300021168 | Soil | RARSEPVRAFATKDEAIRFAGRQLGEHYAVYHKDRKIWPAS |
| Ga0126371_133585851 | 3300021560 | Tropical Forest Soil | MRVHSGPVRAFSTKDEAVRFAGRQLGGNYAVYHKNRKI |
| Ga0207692_109744811 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | RSEPVRAFATKDEAVRFAGRQLGGHYAVYHKDRKIWPAP |
| Ga0207685_100333803 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | ARSEPVRAFFTKDEAVRFAGLGGHYAVYHKDRKIWPIP |
| Ga0207685_106933961 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | GPVRAFSTKDEAIRFASRQLGGHYAVYHKHKKIWPAP |
| Ga0207699_114421262 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MRARSEPVRAFSTKDEAVRFAGRQLGGHYAVYHKDRKIWPTS |
| Ga0207684_105087591 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | TRAGRVMRARSGPVRAFSTKDEAVRFAGRQLGGDYAVYHKHRKIWPAQ |
| Ga0207684_114545711 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | RARSEPGRAFATKDEAIRFAGRQLGEHYAVYHKDRKIWPAS |
| Ga0207663_109766002 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | VRAFATKDEAVRFAGRQLGGHYAVYHKDRKIWPAP |
| Ga0207646_111018571 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | PFKVHLLTRAGRLMRARSEPVRAFATKDEAIRFAGRQLGGHYAAYHRHKKIWPAP |
| Ga0207664_117552991 | 3300025929 | Agricultural Soil | HLLTRAARLMRARSEPVRAFATKDEAIRFAGRQLGEHYAVYHKDRKI |
| Ga0207665_108340111 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MRARSELVRAFATKDEAVRFAGRQLGGHYAVYHKDRKIWPAP |
| Ga0209240_12519512 | 3300026304 | Grasslands Soil | MRARSEPVRAFATKDEAVRFAGRQLGEHYAVYHKDRKIWPAP |
| Ga0209801_11844351 | 3300026326 | Soil | MVRAGRVLRACGGPVREFSTKDEAVKFVGRQLGGYYAVYRN |
| Ga0257165_10777661 | 3300026507 | Soil | MRARSESVRAFSNKDEAVRFAGRQLGGHYAVYHKHK |
| Ga0209690_12064471 | 3300026524 | Soil | MRARSEPVRAFSNKDEAVRFAGRQLGGHYAVYHKHKKIWPAP |
| Ga0209648_103036211 | 3300026551 | Grasslands Soil | VRAFSNKDEAVRFAGRQLGGHYAVYHKHKKIWPAP |
| Ga0209526_109693082 | 3300028047 | Forest Soil | VRAFSIKDEAVRFAGRQLGGHYAVYHKHRKIWPAP |
| Ga0307280_101012993 | 3300028768 | Soil | MRARSEPVRAFSTKDEAVRFAGRQLGGHYAVYRKDR |
| Ga0318516_106858043 | 3300031543 | Soil | HLLARAGRLMRARSEPVRAFATKDEAIRFAGRQLGEHYAVYHKDRKIWPAS |
| Ga0310915_112209472 | 3300031573 | Soil | RARSEPVRAFATKDEAIRFAGRQLGEHYAVYHKDRKIWQA |
| Ga0318500_106172962 | 3300031724 | Soil | VRTALCEPVRAFSNKDEAVRFAGRQLGGNYAVYHKHKKI |
| Ga0306918_104023151 | 3300031744 | Soil | MRARSDPVRAFSNKDEAVRFAGRQLGGHYAVYHKHKKIWPAP |
| Ga0318492_100141427 | 3300031748 | Soil | APFKAHLLTRAGRLMRARSEPVRAFATKDEAIRFAGRQLGEHYAVYHKDRKIWPAS |
| Ga0318554_105500302 | 3300031765 | Soil | VRTALCEPVRAFSNKDEAVRFAGRQLGGHYAVYHRHKKI |
| Ga0318546_100551131 | 3300031771 | Soil | GRLMRARSEPVRAFATKDEAIRFAGRQLGEHYAVYHKDRKIWPAS |
| Ga0318546_111822031 | 3300031771 | Soil | TRAGRLMRARSEPVRAFATKDEAIRFAGRQLGEHYAVYHKDRKIWPAS |
| Ga0318547_106182002 | 3300031781 | Soil | GRLMRARSEPVRAFATKDEAIRFAGRQLGEHYAVYHKDRKIWQA |
| Ga0318557_103195543 | 3300031795 | Soil | RAGRLMRARSEPVRAFAPKDEAIRFAGRQLGEHYAVYHKDRKIWPAS |
| Ga0318565_104980871 | 3300031799 | Soil | MRARSEPVRAFATKDEAIRFAGRQLGEHYAVYHKDRKIWPA |
| Ga0310917_103825182 | 3300031833 | Soil | VLTRAGRVVRARSEAVRAFSAKDEAVRFAGRQLGGHYAVYHKHKKIWPAS |
| Ga0306925_104742443 | 3300031890 | Soil | MRARSEPVRAFSNKDEAVRFAGRQLGGNYAVYHEHKKIWPAP |
| Ga0318551_106361931 | 3300031896 | Soil | RAGRLMRARSEPVRAFATKDEAIRFAGRQLGEHYAVYHKDRKIWPAS |
| Ga0306923_103079464 | 3300031910 | Soil | HLLTRAGRLMRARSEPVRAFATKDEAIRFAGRQLGEHYAVYHKDRKIWPAS |
| Ga0310912_109205401 | 3300031941 | Soil | MRAHTEPVRAFSTKDEAVRFAGRQLGGNYAVYHKDRKIWPISHDAPR |
| Ga0318507_100552481 | 3300032025 | Soil | FKVHLLTRAGRLMRARSEPVRAFATKDEAIRFAGRQLGEHYAVYHKDRKIWPAS |
| Ga0318504_101702651 | 3300032063 | Soil | SEPVRAFAPKDEAIRFAGRQLGEHYAVYHKDRKIWPAS |
| Ga0318540_104690683 | 3300032094 | Soil | PFKVHLLTRAGRLMRARSEPVRAFATKDEAIRFAGRQLGEHYAVYHKDRKIWPAS |
| Ga0307471_1032841941 | 3300032180 | Hardwood Forest Soil | RVMRARSEPVRAFSNKDEAVRFAGRQLGGHYAVYHKHKKIWPDP |
| Ga0306920_1040451741 | 3300032261 | Soil | EPVRAFATKDEAIRFAGRQLGEHYAVYHKDRKIWQA |
| Ga0310914_118917942 | 3300033289 | Soil | PVRAFATKDEAIRFAGRQLGEHYAVYHKDRKIWQA |
| Ga0318519_104310291 | 3300033290 | Soil | MRARSDPVRAFSNKDEAVRFAGRQLGGHYAVYHKHKKI |
| ⦗Top⦘ |