


| Basic Information | |
|---|---|
| Family ID | F061123 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 132 |
| Average Sequence Length | 40 residues |
| Representative Sequence | VLFAIGSALTLAVFFLALWLLPFETFTPFPFPRFPGFF |
| Number of Associated Samples | 88 |
| Number of Associated Scaffolds | 132 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 43.18 % |
| % of genes near scaffold ends (potentially truncated) | 63.64 % |
| % of genes from short scaffolds (< 2000 bps) | 91.67 % |
| Associated GOLD sequencing projects | 81 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.44 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (50.758 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (31.061 % of family members) |
| Environment Ontology (ENVO) | Unclassified (49.242 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (59.091 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 28.79% β-sheet: 0.00% Coil/Unstructured: 71.21% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.44 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 132 Family Scaffolds |
|---|---|---|
| PF01381 | HTH_3 | 9.85 |
| PF09361 | Phasin_2 | 2.27 |
| PF01068 | DNA_ligase_A_M | 2.27 |
| PF04392 | ABC_sub_bind | 1.52 |
| PF00999 | Na_H_Exchanger | 1.52 |
| PF00550 | PP-binding | 0.76 |
| PF13481 | AAA_25 | 0.76 |
| PF00196 | GerE | 0.76 |
| PF13432 | TPR_16 | 0.76 |
| PF01326 | PPDK_N | 0.76 |
| PF00011 | HSP20 | 0.76 |
| PF07978 | NIPSNAP | 0.76 |
| PF00271 | Helicase_C | 0.76 |
| PF00589 | Phage_integrase | 0.76 |
| PF01565 | FAD_binding_4 | 0.76 |
| PF04909 | Amidohydro_2 | 0.76 |
| PF12844 | HTH_19 | 0.76 |
| PF01527 | HTH_Tnp_1 | 0.76 |
| PF13924 | Lipocalin_5 | 0.76 |
| PF00126 | HTH_1 | 0.76 |
| COG ID | Name | Functional Category | % Frequency in 132 Family Scaffolds |
|---|---|---|---|
| COG1423 | ATP-dependent RNA circularization protein, DNA/RNA ligase (PAB1020) family | Replication, recombination and repair [L] | 2.27 |
| COG1793 | ATP-dependent DNA ligase | Replication, recombination and repair [L] | 2.27 |
| COG0025 | NhaP-type Na+/H+ or K+/H+ antiporter | Inorganic ion transport and metabolism [P] | 1.52 |
| COG0475 | Kef-type K+ transport system, membrane component KefB | Inorganic ion transport and metabolism [P] | 1.52 |
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 1.52 |
| COG3004 | Na+/H+ antiporter NhaA | Energy production and conversion [C] | 1.52 |
| COG3263 | NhaP-type Na+/H+ and K+/H+ antiporter with C-terminal TrkAC and CorC domains | Energy production and conversion [C] | 1.52 |
| COG4651 | Predicted Kef-type K+ transport protein, K+/H+ antiporter domain | Inorganic ion transport and metabolism [P] | 1.52 |
| COG0071 | Small heat shock protein IbpA, HSP20 family | Posttranslational modification, protein turnover, chaperones [O] | 0.76 |
| COG0574 | Phosphoenolpyruvate synthase/pyruvate phosphate dikinase | Carbohydrate transport and metabolism [G] | 0.76 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 50.76 % |
| All Organisms | root | All Organisms | 49.24 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459014|G1P06HT01BG3DY | Not Available | 599 | Open in IMG/M |
| 3300000033|ICChiseqgaiiDRAFT_c2273004 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300000655|AF_2010_repII_A100DRAFT_1031375 | Not Available | 980 | Open in IMG/M |
| 3300000793|AF_2010_repII_A001DRAFT_10134086 | Not Available | 516 | Open in IMG/M |
| 3300004633|Ga0066395_10024143 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2456 | Open in IMG/M |
| 3300005332|Ga0066388_100881018 | All Organisms → cellular organisms → Bacteria | 1476 | Open in IMG/M |
| 3300005332|Ga0066388_100948818 | Not Available | 1431 | Open in IMG/M |
| 3300005332|Ga0066388_108549703 | Not Available | 509 | Open in IMG/M |
| 3300005363|Ga0008090_10087310 | Not Available | 678 | Open in IMG/M |
| 3300005468|Ga0070707_100199628 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1949 | Open in IMG/M |
| 3300005471|Ga0070698_100135596 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2415 | Open in IMG/M |
| 3300005574|Ga0066694_10162617 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1059 | Open in IMG/M |
| 3300005713|Ga0066905_100495689 | All Organisms → cellular organisms → Bacteria | 1014 | Open in IMG/M |
| 3300005713|Ga0066905_100602244 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Magnetospirillum → Magnetospirillum gryphiswaldense → Magnetospirillum gryphiswaldense MSR-1 | 930 | Open in IMG/M |
| 3300005713|Ga0066905_102284783 | Not Available | 505 | Open in IMG/M |
| 3300005764|Ga0066903_101688430 | Not Available | 1205 | Open in IMG/M |
| 3300005764|Ga0066903_101924389 | Not Available | 1133 | Open in IMG/M |
| 3300005764|Ga0066903_101946985 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_62_13 | 1127 | Open in IMG/M |
| 3300005764|Ga0066903_102871704 | Not Available | 934 | Open in IMG/M |
| 3300005764|Ga0066903_106153835 | Not Available | 628 | Open in IMG/M |
| 3300005764|Ga0066903_107897588 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 546 | Open in IMG/M |
| 3300005764|Ga0066903_108366606 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 528 | Open in IMG/M |
| 3300005764|Ga0066903_108385699 | Not Available | 528 | Open in IMG/M |
| 3300006028|Ga0070717_10055284 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3274 | Open in IMG/M |
| 3300006032|Ga0066696_10351706 | All Organisms → cellular organisms → Bacteria | 960 | Open in IMG/M |
| 3300006175|Ga0070712_100782026 | Not Available | 818 | Open in IMG/M |
| 3300006606|Ga0074062_12272714 | Not Available | 509 | Open in IMG/M |
| 3300006800|Ga0066660_10711031 | Not Available | 824 | Open in IMG/M |
| 3300006852|Ga0075433_10800307 | Not Available | 824 | Open in IMG/M |
| 3300006871|Ga0075434_100122219 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2619 | Open in IMG/M |
| 3300009792|Ga0126374_10658459 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 781 | Open in IMG/M |
| 3300009792|Ga0126374_11667405 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 529 | Open in IMG/M |
| 3300010043|Ga0126380_10283359 | Not Available | 1168 | Open in IMG/M |
| 3300010043|Ga0126380_10835928 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 757 | Open in IMG/M |
| 3300010046|Ga0126384_11444878 | Not Available | 643 | Open in IMG/M |
| 3300010048|Ga0126373_11314094 | Not Available | 789 | Open in IMG/M |
| 3300010359|Ga0126376_10211460 | Not Available | 1617 | Open in IMG/M |
| 3300010359|Ga0126376_13029486 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 519 | Open in IMG/M |
| 3300010361|Ga0126378_10817599 | Not Available | 1041 | Open in IMG/M |
| 3300010361|Ga0126378_11356412 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 805 | Open in IMG/M |
| 3300010361|Ga0126378_11761230 | Not Available | 704 | Open in IMG/M |
| 3300010366|Ga0126379_10920809 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium paxllaeri | 977 | Open in IMG/M |
| 3300010376|Ga0126381_101970406 | Not Available | 842 | Open in IMG/M |
| 3300010376|Ga0126381_103399119 | Not Available | 626 | Open in IMG/M |
| 3300010398|Ga0126383_10767893 | All Organisms → cellular organisms → Bacteria | 1045 | Open in IMG/M |
| 3300010398|Ga0126383_10985223 | Not Available | 931 | Open in IMG/M |
| 3300010398|Ga0126383_11030986 | Not Available | 911 | Open in IMG/M |
| 3300010863|Ga0124850_1000633 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 8246 | Open in IMG/M |
| 3300010863|Ga0124850_1024967 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1918 | Open in IMG/M |
| 3300012202|Ga0137363_11693560 | Not Available | 525 | Open in IMG/M |
| 3300012211|Ga0137377_11667128 | Not Available | 560 | Open in IMG/M |
| 3300012917|Ga0137395_11160046 | Not Available | 543 | Open in IMG/M |
| 3300012948|Ga0126375_10126078 | Not Available | 1571 | Open in IMG/M |
| 3300012948|Ga0126375_11331660 | Not Available | 605 | Open in IMG/M |
| 3300012971|Ga0126369_13550563 | Not Available | 511 | Open in IMG/M |
| 3300016270|Ga0182036_10325523 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1177 | Open in IMG/M |
| 3300016294|Ga0182041_10214485 | Not Available | 1542 | Open in IMG/M |
| 3300016294|Ga0182041_10458506 | Not Available | 1097 | Open in IMG/M |
| 3300016294|Ga0182041_10927742 | Not Available | 784 | Open in IMG/M |
| 3300016319|Ga0182033_10039161 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 3110 | Open in IMG/M |
| 3300016319|Ga0182033_10177339 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1673 | Open in IMG/M |
| 3300016319|Ga0182033_10325076 | Not Available | 1278 | Open in IMG/M |
| 3300016357|Ga0182032_10180584 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1590 | Open in IMG/M |
| 3300016387|Ga0182040_10116948 | Not Available | 1842 | Open in IMG/M |
| 3300016387|Ga0182040_11262441 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 623 | Open in IMG/M |
| 3300016404|Ga0182037_10090990 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2170 | Open in IMG/M |
| 3300016404|Ga0182037_10555146 | Not Available | 970 | Open in IMG/M |
| 3300016422|Ga0182039_12019009 | Not Available | 531 | Open in IMG/M |
| 3300016445|Ga0182038_10619436 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → unclassified Beijerinckiaceae → Beijerinckiaceae bacterium | 936 | Open in IMG/M |
| 3300018433|Ga0066667_11609508 | Not Available | 579 | Open in IMG/M |
| 3300019890|Ga0193728_1306543 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
| 3300021168|Ga0210406_10698049 | All Organisms → cellular organisms → Bacteria | 782 | Open in IMG/M |
| 3300021560|Ga0126371_12117566 | Not Available | 678 | Open in IMG/M |
| 3300021560|Ga0126371_13672454 | Not Available | 518 | Open in IMG/M |
| 3300025910|Ga0207684_10074927 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2876 | Open in IMG/M |
| 3300025910|Ga0207684_10467198 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 131 | 1083 | Open in IMG/M |
| 3300025928|Ga0207700_10175590 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1790 | Open in IMG/M |
| 3300026552|Ga0209577_10413559 | Not Available | 964 | Open in IMG/M |
| 3300026552|Ga0209577_10566791 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 710 | Open in IMG/M |
| 3300027862|Ga0209701_10461694 | All Organisms → cellular organisms → Bacteria | 697 | Open in IMG/M |
| 3300028715|Ga0307313_10221397 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
| 3300031545|Ga0318541_10203387 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1096 | Open in IMG/M |
| 3300031545|Ga0318541_10461940 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 710 | Open in IMG/M |
| 3300031545|Ga0318541_10503110 | Not Available | 678 | Open in IMG/M |
| 3300031545|Ga0318541_10784611 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 531 | Open in IMG/M |
| 3300031564|Ga0318573_10708024 | Not Available | 541 | Open in IMG/M |
| 3300031572|Ga0318515_10686136 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 542 | Open in IMG/M |
| 3300031573|Ga0310915_10649771 | Not Available | 746 | Open in IMG/M |
| 3300031668|Ga0318542_10157085 | Not Available | 1133 | Open in IMG/M |
| 3300031668|Ga0318542_10463682 | Not Available | 657 | Open in IMG/M |
| 3300031680|Ga0318574_10871781 | Not Available | 527 | Open in IMG/M |
| 3300031713|Ga0318496_10556451 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 634 | Open in IMG/M |
| 3300031719|Ga0306917_11043855 | Not Available | 637 | Open in IMG/M |
| 3300031723|Ga0318493_10798625 | Not Available | 531 | Open in IMG/M |
| 3300031724|Ga0318500_10043061 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1881 | Open in IMG/M |
| 3300031744|Ga0306918_10080246 | Not Available | 2269 | Open in IMG/M |
| 3300031744|Ga0306918_10202013 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1498 | Open in IMG/M |
| 3300031744|Ga0306918_10228081 | All Organisms → cellular organisms → Bacteria | 1414 | Open in IMG/M |
| 3300031747|Ga0318502_10477481 | Not Available | 746 | Open in IMG/M |
| 3300031748|Ga0318492_10380646 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 741 | Open in IMG/M |
| 3300031751|Ga0318494_10773586 | Not Available | 562 | Open in IMG/M |
| 3300031768|Ga0318509_10023197 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2937 | Open in IMG/M |
| 3300031768|Ga0318509_10418591 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 749 | Open in IMG/M |
| 3300031770|Ga0318521_10229771 | All Organisms → cellular organisms → Bacteria | 1078 | Open in IMG/M |
| 3300031771|Ga0318546_10740994 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 691 | Open in IMG/M |
| 3300031777|Ga0318543_10082595 | All Organisms → cellular organisms → Bacteria | 1362 | Open in IMG/M |
| 3300031777|Ga0318543_10297396 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Sinorhizobium phage PBC5 | 722 | Open in IMG/M |
| 3300031779|Ga0318566_10442318 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 638 | Open in IMG/M |
| 3300031793|Ga0318548_10423380 | Not Available | 652 | Open in IMG/M |
| 3300031794|Ga0318503_10240164 | Not Available | 588 | Open in IMG/M |
| 3300031819|Ga0318568_10728178 | Not Available | 616 | Open in IMG/M |
| 3300031819|Ga0318568_10937302 | Not Available | 535 | Open in IMG/M |
| 3300031821|Ga0318567_10235252 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1027 | Open in IMG/M |
| 3300031845|Ga0318511_10263161 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 775 | Open in IMG/M |
| 3300031880|Ga0318544_10282157 | Not Available | 644 | Open in IMG/M |
| 3300031890|Ga0306925_10374893 | Not Available | 1527 | Open in IMG/M |
| 3300031890|Ga0306925_10577490 | Not Available | 1189 | Open in IMG/M |
| 3300031910|Ga0306923_10415289 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1530 | Open in IMG/M |
| 3300031910|Ga0306923_10513759 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1353 | Open in IMG/M |
| 3300031910|Ga0306923_12192234 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 554 | Open in IMG/M |
| 3300031912|Ga0306921_10704126 | Not Available | 1160 | Open in IMG/M |
| 3300031945|Ga0310913_10027457 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium jicamae | 3599 | Open in IMG/M |
| 3300031945|Ga0310913_10361869 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1027 | Open in IMG/M |
| 3300031946|Ga0310910_10312933 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1236 | Open in IMG/M |
| 3300031947|Ga0310909_10219053 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Magnetospirillum → Magnetospirillum gryphiswaldense → Magnetospirillum gryphiswaldense MSR-1 | 1585 | Open in IMG/M |
| 3300031947|Ga0310909_10661897 | Not Available | 869 | Open in IMG/M |
| 3300032059|Ga0318533_11229782 | Not Available | 548 | Open in IMG/M |
| 3300032060|Ga0318505_10624569 | Not Available | 506 | Open in IMG/M |
| 3300032063|Ga0318504_10602214 | Not Available | 528 | Open in IMG/M |
| 3300032261|Ga0306920_101416802 | All Organisms → cellular organisms → Bacteria | 995 | Open in IMG/M |
| 3300033289|Ga0310914_10481980 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1122 | Open in IMG/M |
| 3300033290|Ga0318519_10984896 | Not Available | 523 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 31.06% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 18.94% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 16.67% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 12.88% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.30% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.55% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.03% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.52% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.52% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.52% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.76% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.76% |
| Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.76% |
| Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 0.76% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459014 | Litter degradation PV2 | Engineered | Open in IMG/M |
| 3300000033 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000655 | Forest soil microbial communities from Amazon forest - 2010 replicate II A100 | Environmental | Open in IMG/M |
| 3300000793 | Forest soil microbial communities from Amazon forest - 2010 replicate II A001 | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005363 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006606 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010863 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (PacBio error correction) | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300019890 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1 | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028715 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_203 | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
| 3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
| 3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
| 3300031794 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f23 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
| 3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
| 3300031880 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
| 3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| 2PV_02375270 | 2170459014 | Switchgrass, Maize And Mischanthus Litter | VLFAIGSALTLAVFFLALWLLPFETFTPFPFPRFHGFF |
| ICChiseqgaiiDRAFT_22730042 | 3300000033 | Soil | LFGIGSVVSLAVFFLALWLLPFETFTPFPFPRFPGFP* |
| AF_2010_repII_A100DRAFT_10313753 | 3300000655 | Forest Soil | RSQLRELMLLFVVGSALTLAVFFLALLLLPFKTFTPFPLRPGLFLHTV* |
| AF_2010_repII_A001DRAFT_101340861 | 3300000793 | Forest Soil | VVLFAISSALTRAVFFLALWLLPFETFTPFPFPRFPEF |
| Ga0066395_100241433 | 3300004633 | Tropical Forest Soil | MLLFVIGSALTVAVFFLALWLLPFQTFTPFLFPRIPGFL* |
| Ga0066388_1008810181 | 3300005332 | Tropical Forest Soil | VLFAISSALTLAVFFLALWLLPFERFPPFSSPRFPGFPLI* |
| Ga0066388_1009488182 | 3300005332 | Tropical Forest Soil | MALFVVGSALTVAVFFLALWLLPEQPFIPFSLSRFPGLF* |
| Ga0066388_1085497032 | 3300005332 | Tropical Forest Soil | SQLRELMLLFVVGSALTLAVFFLALLLLPFETFTPFPFPRPPGFF* |
| Ga0008090_100873101 | 3300005363 | Tropical Rainforest Soil | MLFAICSALTLAVFFLALWLLPFERLPLFSFPRFPGFPLI* |
| Ga0070707_1001996283 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MLFAICSALTLAVFSLALWLLPFERLPLFSFPRFPGFPLI* |
| Ga0070698_1001355961 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MVLLVVGSALTLAVFFLALWLLPFETFTPFPFPRFPGFF* |
| Ga0066694_101626171 | 3300005574 | Soil | RELIVLLAIGSALTVAVFFLALWLLPFETFTPFPFPRFPGLP* |
| Ga0066905_1004956893 | 3300005713 | Tropical Forest Soil | FAICSALTLAVFFLALWLLPFERLPLFSFPRFPGFPLI* |
| Ga0066905_1006022442 | 3300005713 | Tropical Forest Soil | MLLFVVGSALTLAVFFLALLLLPFETFTPFPFPRSPGFF* |
| Ga0066905_1022847832 | 3300005713 | Tropical Forest Soil | FVVGSALTLAVFFLALLLLPFETFTPFPFPRSPGFF* |
| Ga0066903_1016884303 | 3300005764 | Tropical Forest Soil | MVLLVVGSALTLAVFFLALLVLPFETFTPFSFPRFPGFF* |
| Ga0066903_1019243891 | 3300005764 | Tropical Forest Soil | MALVMVGSALTVAVFFLALWLLPEQPFIPFSFPRFPGLF* |
| Ga0066903_1019469852 | 3300005764 | Tropical Forest Soil | MALFVVGSALTVAVFFLALWLLPEQPFIPFHFPRFPGLF* |
| Ga0066903_1028717043 | 3300005764 | Tropical Forest Soil | MALVVVGSALTVAVFFLALWLLPEQPFIPFSLPRFPGLF* |
| Ga0066903_1061538351 | 3300005764 | Tropical Forest Soil | QLRELMVLFVVSWAVTLAVFFLAPFEMFTRFPFPRFPAFF* |
| Ga0066903_1078975881 | 3300005764 | Tropical Forest Soil | FVVGSALTLAVFFLALLLLPFETFTPVPFPRFPGFF* |
| Ga0066903_1083666062 | 3300005764 | Tropical Forest Soil | VGSALTLAVFFLALLLLPFETFTPFHFPRFPGFF* |
| Ga0066903_1083856992 | 3300005764 | Tropical Forest Soil | MVLFVVGSALTLAVFLLALWLLPFETFTPFPFPRFPGFF* |
| Ga0070717_100552846 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | FGIGSVVSLAVFFLALWLLPFETFTPFPFPRFPGFP* |
| Ga0066696_103517061 | 3300006032 | Soil | VGSALTLAVFFLALLLLPFETFTPFPFPRFPGFF* |
| Ga0070712_1007820262 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MLFAICSALTLAVFFLALWLLPFERLPLFSFPRFPGFPLIRTLLF* |
| Ga0074062_122727141 | 3300006606 | Soil | FAISSALTLAVFFLALWLLPFETFTPFPFPRFPGFPLI* |
| Ga0066660_107110311 | 3300006800 | Soil | MVLFVVCSTLTLAIFFLALLLLSFETFTPFPFPRFP |
| Ga0075433_108003072 | 3300006852 | Populus Rhizosphere | LVVLFGIGSVVTLAVFFLALWLLPSETFTPFPFPRFPGVF* |
| Ga0075434_1001222191 | 3300006871 | Populus Rhizosphere | ELVVLFGIGSVVSLAVFFLALWLLPFETFTPFPFPRFPGFP* |
| Ga0126374_106584592 | 3300009792 | Tropical Forest Soil | VLFAISSALTLAVFFIALWLLPFETFTPLPFPRFPGFF* |
| Ga0126374_116674051 | 3300009792 | Tropical Forest Soil | MLFAICSALTLAVFLLALWLLPFERLPLFSFPRFPGFP |
| Ga0126380_102833591 | 3300010043 | Tropical Forest Soil | MLLFVVGSALTLAVFFLALLLLPFETFTPFPFPRSPAFF* |
| Ga0126380_108359282 | 3300010043 | Tropical Forest Soil | MLFAICSALTLAVFFLALWLLPFERLPLFSFPRFPGFSLI* |
| Ga0126384_114448781 | 3300010046 | Tropical Forest Soil | VMLFAIGSALTIAVFFLALLLLPFETFTPVPFPRFPGFF* |
| Ga0126373_113140942 | 3300010048 | Tropical Forest Soil | MLLFVVGSALTLAVFFLALLLLPFETFTPFSFPRSPGFF* |
| Ga0126376_102114603 | 3300010359 | Tropical Forest Soil | VLFAVCSALTLAVFFLALWLLPFEIMPPSSFPKFPAFP* |
| Ga0126376_130294862 | 3300010359 | Tropical Forest Soil | LFVVGSALTVAVFFLALWLLPFETFTRFPVLRFPGVP* |
| Ga0126378_108175992 | 3300010361 | Tropical Forest Soil | MLLFVVGSALTLAVFFLALLLLPFETFTPFAFPRSPGFF* |
| Ga0126378_113564121 | 3300010361 | Tropical Forest Soil | VVLFAVGSALTLAVFFLALWLLPFETFTPFPFPRFP |
| Ga0126378_117612301 | 3300010361 | Tropical Forest Soil | MALFVVGSALTVAVFFLALWLLPEQPFIPFSFPRFPGLF* |
| Ga0126379_109208091 | 3300010366 | Tropical Forest Soil | IVLFVVGSALTLAVFFLALWLLPFQTFTPFPFRFPGFL* |
| Ga0126381_1019704062 | 3300010376 | Tropical Forest Soil | MALFVVGSALTVAVFFLALWLLPEQPFIPFSLLRFPGLF* |
| Ga0126381_1033991192 | 3300010376 | Tropical Forest Soil | FAISSALTLAVFFLALWLLPFETFTRFPLSPFPALFN* |
| Ga0126383_107678931 | 3300010398 | Tropical Forest Soil | AIGSALTLAVFFLALWLLPFETFTPFPFPRFPGFF* |
| Ga0126383_109852232 | 3300010398 | Tropical Forest Soil | VGSALTLAVFFLALWLQPFETFAPFPFPRFPGFF* |
| Ga0126383_110309862 | 3300010398 | Tropical Forest Soil | MLFVIGSALTVAVFFLALWLLPFDRFPPFSFLKFPALP* |
| Ga0124850_10006335 | 3300010863 | Tropical Forest Soil | MLLFVVGSALTLAVFFLALLLVSFETFTPFPFPRSPGFF* |
| Ga0124850_10249671 | 3300010863 | Tropical Forest Soil | VVLFAIGSAVTLAVFFLALWLMPFETFTSFPFPRFPGFF* |
| Ga0137363_116935602 | 3300012202 | Vadose Zone Soil | VVLFAVGSTLTLAVFFLAHWLLPFERFPPFSFPRFPGFP* |
| Ga0137377_116671282 | 3300012211 | Vadose Zone Soil | VLFAVGSALTLAVFFLALWLLPFETFTPFPFPRFHGFF* |
| Ga0137395_111600462 | 3300012917 | Vadose Zone Soil | VLFAIGSALTLAVFFLALWLLPFETFTPFPFPRFPGFF* |
| Ga0126375_101260781 | 3300012948 | Tropical Forest Soil | VVLCAIGSALTLAVFFLALWLLPFETFTPFPFPRF |
| Ga0126375_113316602 | 3300012948 | Tropical Forest Soil | QLRELVVLFAVGSALTLAVFFLALWLLPFERFPPFSFPRFPGFP* |
| Ga0126369_135505631 | 3300012971 | Tropical Forest Soil | MLLFVVGSALTLAVFFLALLLLPFETFTPFPFPRS |
| Ga0182036_103255231 | 3300016270 | Soil | SRGQLRELTVLFVVGSTLTLAIFFLALLLLPFETFTPFPFPRFPGSF |
| Ga0182041_102144851 | 3300016294 | Soil | VVLFAISSALTLAVFFLALWLLPFETFTRFPLPRFPAL |
| Ga0182041_104585061 | 3300016294 | Soil | LRELMVLFVVGSALTLAVFFLALLLLPFETFTPVPFPRFPGFF |
| Ga0182041_109277423 | 3300016294 | Soil | RELVVLFAISSALTLAVFFLALWLLPFETFTRFPLPRFPALFN |
| Ga0182033_100391616 | 3300016319 | Soil | VLFAISSALTLAVFFLALWLLPFETFTPFPFPRSPWFF |
| Ga0182033_101773391 | 3300016319 | Soil | VQLRELTVLFVVGSALTLAVFFLALLLLSFETFTPVPFPRFPGFF |
| Ga0182033_103250762 | 3300016319 | Soil | MVLFVVGSTLTLAVFFLALLLLPFETFTPFSFPRFPGFF |
| Ga0182032_101805841 | 3300016357 | Soil | VLFAISSALTLAVFFLALWLLPFEMFTRFPVPRFPALFN |
| Ga0182040_101169482 | 3300016387 | Soil | MLLFVIGSALAVAVFFLALWLLPFETFTRFPVPRFPGLP |
| Ga0182040_112624412 | 3300016387 | Soil | AISSALTLAVFFLALWLLPFETFTPFPFPRFPGLF |
| Ga0182037_100909901 | 3300016404 | Soil | ELVVLFAISSALTLAVFFLALWLLPFEMFTRFPVPRFPALFN |
| Ga0182037_105551461 | 3300016404 | Soil | LLFVVGSALTVTVFFLALWLLPFETFTRFPVLRFPGVP |
| Ga0182039_120190091 | 3300016422 | Soil | MVLFVVGSALTLAVFFIALLLLPFETFTPVPFPRFPGFF |
| Ga0182038_106194361 | 3300016445 | Soil | VMLFAICSALTLAVFFLALWLLPFERLPLFSFPQAHKR |
| Ga0066667_116095081 | 3300018433 | Grasslands Soil | MVLFVVGSALTLAVFFLALFLLPFETFTPFPFPRFPGFF |
| Ga0193728_13065431 | 3300019890 | Soil | VVLFGIGSVVTLAVFFLALWLLPFETFTPFPFPRFPGFP |
| Ga0210406_106980492 | 3300021168 | Soil | MLFAICSALTLAVFFLALWLLPFERLPLFSFPRFPGFPLI |
| Ga0126371_121175661 | 3300021560 | Tropical Forest Soil | RLRELVVLFGIGSVVTLAVFFLTLWLLPFEMFTPFPFPRFPGFF |
| Ga0126371_136724541 | 3300021560 | Tropical Forest Soil | MALFVVGSALTVAVFFLALWLLPEQPFIPFSLLRFPGLF |
| Ga0207684_100749276 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MVLFVVGSALTLAVFFLAPLLLPFETFTPFPFPRFPGFF |
| Ga0207684_104671981 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MVLLVVGSALTLAVFFLALWLLPFETFTPFPFSRFPGFF |
| Ga0207700_101755903 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MVLFVVCSTLTLAVFFLALLLLPFETFNPFSFPRFPGFF |
| Ga0209577_104135593 | 3300026552 | Soil | LRELVVLFGIGSVVSLAVFFLALWLLPFETFTPFPFPRFPGFP |
| Ga0209577_105667912 | 3300026552 | Soil | LMVLFVVGSALTLAVFFLALLLLPFETFTPFPFPRFPGFF |
| Ga0209701_104616942 | 3300027862 | Vadose Zone Soil | ELTELMVLFVVGSALTLAVFFLALWLLPFERFPPFSSPRFPGVPLI |
| Ga0307313_102213972 | 3300028715 | Soil | LVVLFGIGSVVSLAVFFLALWLLPFETFTPFPFPRFPGFP |
| Ga0318541_102033872 | 3300031545 | Soil | MALFVVGSAVTVAAFFLALWLLPEQPFSPFQFPRLPGLF |
| Ga0318541_104619401 | 3300031545 | Soil | ELMVLYVVCSTLTLAIFFLALLLLPFETFTPFPFPRFPGSF |
| Ga0318541_105031103 | 3300031545 | Soil | VLFLVGSALTLAVFFLAVLLLPFETFTPFPFPRFPGFF |
| Ga0318541_107846111 | 3300031545 | Soil | MLLFVIGSALTVAVFFLALWLLPFQTFTPFLFPRIPGFL |
| Ga0318573_107080242 | 3300031564 | Soil | VQLRELTVLFVVGSALTLAVFFLALLLLPFETFTPVPFPRFPGFF |
| Ga0318515_106861361 | 3300031572 | Soil | MLLFVIGSALTVAVFFLALWLLPFQTFTPFAFPRIPGFL |
| Ga0310915_106497713 | 3300031573 | Soil | VVLFAVGSALTLAVFFLALWLLPFETFTPFPFPRFPALFN |
| Ga0318542_101570852 | 3300031668 | Soil | MLLFVIGSALTVAVFFLALWLLPFETFTRFPVLRFPGVP |
| Ga0318542_104636821 | 3300031668 | Soil | FLVGSALTLAVFFLAVLLLPFETFTPFPFPRFPGFF |
| Ga0318574_108717812 | 3300031680 | Soil | MVLVVVGSALTLAVFFIALLLLPFETFTPVPFPRFPGFF |
| Ga0318496_105564511 | 3300031713 | Soil | LRELMVLVVVGSALTLAVFFIALLLLPFETFTPVPFPRFPGFF |
| Ga0306917_110438551 | 3300031719 | Soil | MSRSQLRELMLLFVVGSALTLAVFFLALLLLPFETFTPFPFPRAPGFF |
| Ga0318493_107986252 | 3300031723 | Soil | VLFAIGLALTLAVFFLALWLLPFETFTPFPFPRFPGSF |
| Ga0318500_100430612 | 3300031724 | Soil | MLLFVIGSALTVAVFFLALWLLPFQMFTPFLFPRIPGFL |
| Ga0306918_100802462 | 3300031744 | Soil | MVLFVVGSTLTLAVFFLALLLLPFETFTPFSFPRFPGLF |
| Ga0306918_102020133 | 3300031744 | Soil | MVLFVVGSALAVFFIALLLLPFETFTPVPFPRFPGFF |
| Ga0306918_102280811 | 3300031744 | Soil | MLLFVVGSALTLAVFFLALLLLPFETFTPFPFPRAPGFF |
| Ga0318502_104774811 | 3300031747 | Soil | RAQLRELMVLFLVGSALTLAVFFLVVLLLPFETFTPFPFPRFPGFF |
| Ga0318492_103806461 | 3300031748 | Soil | MLLLVIGSALTVAVFFLALWLLPFQMFTPFLFPRIPGFL |
| Ga0318494_107735862 | 3300031751 | Soil | LRELTLLFVVSSALTVAVFFLALWLLPFETFTRFPVLRFPGVP |
| Ga0318509_100231975 | 3300031768 | Soil | VVLFAISSALTLAVFFLALWLLPFETFTRFPLPRFPALFN |
| Ga0318509_104185911 | 3300031768 | Soil | RELTALFMIGSALTVAVFFLALWLLPFETFTPFPFPRFPGLF |
| Ga0318521_102297712 | 3300031770 | Soil | MLFAICSVLTLAVFFLALWLLPFERLPLFSFPRFSGFPLI |
| Ga0318546_107409941 | 3300031771 | Soil | MLLFVIGSALTVAVFFLALWLLPFQTFTPFPFPRIPGFL |
| Ga0318543_100825951 | 3300031777 | Soil | RELVMLFAICSALTLAVFFLALWLLPFERLPLFSFPRFPGFPLI |
| Ga0318543_102973961 | 3300031777 | Soil | MSRAQLREVMVLVVVGSALTLAVFFIALLLLPFETFTPVPFPRFPGFF |
| Ga0318566_104423182 | 3300031779 | Soil | VLFAIGLALALAVFFLALWLLPFETFTRRAVLRPAHV |
| Ga0318548_104233803 | 3300031793 | Soil | VQLRELMVLFVVGSALTLAVFFLALLLLPFETFTPVPFPRFPGFF |
| Ga0318503_102401642 | 3300031794 | Soil | VVLFAISSALTLAVFFLALWLLPFEMFTRFPVPRFPALFN |
| Ga0318568_107281782 | 3300031819 | Soil | LRELMLLFVVGSALTLAVFFLALLLLPFETFTPFPFPRAPGFF |
| Ga0318568_109373022 | 3300031819 | Soil | LRELVVLFAISSALTLAVFFVALWLLPFERFPPFSSPRFPGFPLI |
| Ga0318567_102352521 | 3300031821 | Soil | MVLFVVCSTLTLAVFFFALLLLPFETFTPFPFPRFPGFF |
| Ga0318511_102631612 | 3300031845 | Soil | RLRELMVLVVVGSALTLAVFFIALLLLPFETFTPVPFPRFPGFF |
| Ga0318544_102821572 | 3300031880 | Soil | MALFVVGSAVTVAAFFLALWLLPEQPFIPFQFPRLPGLF |
| Ga0306925_103748932 | 3300031890 | Soil | MLLFVVGSALTLAVFLLALWLLPFETFTPFPFPRFPGFF |
| Ga0306925_105774903 | 3300031890 | Soil | VLFVVGSALTLAVFFLALLLLPFETFTPVPFPRFPGFF |
| Ga0306923_104152894 | 3300031910 | Soil | MVVFVVGSALTLAVFFLALWLLPFETFTPFPFPRFPGFF |
| Ga0306923_105137593 | 3300031910 | Soil | LVVLFAIGSALTLAVFFLAPWLLPYETFTPFPFPRFPGFF |
| Ga0306923_121922341 | 3300031910 | Soil | LTVLFVVGSALTLAVFFLALFLLPFETFTPFPFPRFPGFF |
| Ga0306921_107041261 | 3300031912 | Soil | VVLFAISSVLTLAVFFLALWLLPFETFTPFPFPRSP |
| Ga0310913_100274572 | 3300031945 | Soil | MLLFVIGSALTVAVFFLALWLLPFETFTRFPVPRFPGLP |
| Ga0310913_103618693 | 3300031945 | Soil | RARLRELVVLFAIGSALTLAVFFLALWLLPDKPFTTFLFPRFP |
| Ga0310910_103129331 | 3300031946 | Soil | QLRELTALFMIGSALTVAVFFLALWLLPFETFTPFPFPRFPGLF |
| Ga0310909_102190531 | 3300031947 | Soil | MVLFVVGSALTLAVFFLALLLLPFETFNPFSFPRFPGFF |
| Ga0310909_106618971 | 3300031947 | Soil | VLFVISSALTLAVFFLALWLLPFETFTRFPLPRFPALFN |
| Ga0318533_112297821 | 3300032059 | Soil | LLFVICSALTVAVFFLALWLLPFETFTRFSVLRFPGVP |
| Ga0318505_106245691 | 3300032060 | Soil | FLVGSALTLAVFFLVVLLLPFETFTPFPFPRFPGFF |
| Ga0318504_106022142 | 3300032063 | Soil | LRELMVLFVVCSTLTLAVFFLALWLLPFETFTPFPFPRFPGFF |
| Ga0306920_1014168021 | 3300032261 | Soil | MLLFVVGSALTLAVFFLALLLLPFETFTPFPFPRAPGFFWFR |
| Ga0310914_104819804 | 3300033289 | Soil | RELMVLVVVGSALTLAVFFIALLLLPFETFTPVPFPRFPGFF |
| Ga0318519_109848961 | 3300033290 | Soil | MVLFVVSSALTLAVFFLALFLLPFETFTPFPFPRFPGSF |
| ⦗Top⦘ |