


| Basic Information | |
|---|---|
| Family ID | F061070 |
| Family Type | Metagenome |
| Number of Sequences | 132 |
| Average Sequence Length | 47 residues |
| Representative Sequence | MNAANEGHQHRATRPDAPADVETEMAEEEGSEMAGPVRASPSDRQPYSA |
| Number of Associated Samples | 99 |
| Number of Associated Scaffolds | 132 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 41.67 % |
| % of genes near scaffold ends (potentially truncated) | 66.67 % |
| % of genes from short scaffolds (< 2000 bps) | 87.88 % |
| Associated GOLD sequencing projects | 90 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.16 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (76.515 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (45.454 % of family members) |
| Environment Ontology (ENVO) | Unclassified (39.394 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (50.758 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 3.90% β-sheet: 0.00% Coil/Unstructured: 96.10% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.16 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 132 Family Scaffolds |
|---|---|---|
| PF00664 | ABC_membrane | 5.30 |
| PF01068 | DNA_ligase_A_M | 2.27 |
| PF08238 | Sel1 | 1.52 |
| PF00496 | SBP_bac_5 | 1.52 |
| PF02900 | LigB | 1.52 |
| PF10503 | Esterase_PHB | 1.52 |
| PF01381 | HTH_3 | 1.52 |
| PF13649 | Methyltransf_25 | 1.52 |
| PF00487 | FA_desaturase | 1.52 |
| PF00582 | Usp | 0.76 |
| PF13561 | adh_short_C2 | 0.76 |
| PF01145 | Band_7 | 0.76 |
| PF03449 | GreA_GreB_N | 0.76 |
| PF13489 | Methyltransf_23 | 0.76 |
| PF00903 | Glyoxalase | 0.76 |
| PF01522 | Polysacc_deac_1 | 0.76 |
| PF07992 | Pyr_redox_2 | 0.76 |
| PF00211 | Guanylate_cyc | 0.76 |
| PF00589 | Phage_integrase | 0.76 |
| PF02798 | GST_N | 0.76 |
| PF01131 | Topoisom_bac | 0.76 |
| PF00313 | CSD | 0.76 |
| PF00296 | Bac_luciferase | 0.76 |
| PF04909 | Amidohydro_2 | 0.76 |
| PF10073 | DUF2312 | 0.76 |
| PF13814 | Replic_Relax | 0.76 |
| PF13424 | TPR_12 | 0.76 |
| PF08241 | Methyltransf_11 | 0.76 |
| PF01548 | DEDD_Tnp_IS110 | 0.76 |
| PF07690 | MFS_1 | 0.76 |
| PF00171 | Aldedh | 0.76 |
| PF02281 | Dimer_Tnp_Tn5 | 0.76 |
| PF13419 | HAD_2 | 0.76 |
| COG ID | Name | Functional Category | % Frequency in 132 Family Scaffolds |
|---|---|---|---|
| COG1423 | ATP-dependent RNA circularization protein, DNA/RNA ligase (PAB1020) family | Replication, recombination and repair [L] | 2.27 |
| COG1793 | ATP-dependent DNA ligase | Replication, recombination and repair [L] | 2.27 |
| COG1398 | Fatty-acid desaturase | Lipid transport and metabolism [I] | 1.52 |
| COG3239 | Fatty acid desaturase | Lipid transport and metabolism [I] | 1.52 |
| COG0014 | Gamma-glutamyl phosphate reductase | Amino acid transport and metabolism [E] | 0.76 |
| COG0550 | DNA topoisomerase IA | Replication, recombination and repair [L] | 0.76 |
| COG0726 | Peptidoglycan/xylan/chitin deacetylase, PgdA/NodB/CDA1 family | Cell wall/membrane/envelope biogenesis [M] | 0.76 |
| COG0782 | Transcription elongation factor, GreA/GreB family | Transcription [K] | 0.76 |
| COG1012 | Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase | Lipid transport and metabolism [I] | 0.76 |
| COG1110 | Reverse gyrase | Replication, recombination and repair [L] | 0.76 |
| COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 0.76 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.76 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.76 |
| COG4230 | Delta 1-pyrroline-5-carboxylate dehydrogenase | Amino acid transport and metabolism [E] | 0.76 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 76.52 % |
| Unclassified | root | N/A | 23.48 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2040502001|FACENC_GAMC6GA01B9JFQ | Not Available | 533 | Open in IMG/M |
| 3300001545|JGI12630J15595_10024597 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Azospirillaceae → Azospirillum → Azospirillum baldaniorum | 1261 | Open in IMG/M |
| 3300001593|JGI12635J15846_10117748 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1880 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100026618 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 5058 | Open in IMG/M |
| 3300003219|JGI26341J46601_10027413 | Not Available | 1859 | Open in IMG/M |
| 3300003219|JGI26341J46601_10201430 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 540 | Open in IMG/M |
| 3300003505|JGIcombinedJ51221_10004429 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 4129 | Open in IMG/M |
| 3300004080|Ga0062385_10621671 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 686 | Open in IMG/M |
| 3300005332|Ga0066388_107888263 | Not Available | 533 | Open in IMG/M |
| 3300005435|Ga0070714_101963006 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 571 | Open in IMG/M |
| 3300005518|Ga0070699_100521904 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1080 | Open in IMG/M |
| 3300005561|Ga0066699_10637887 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 764 | Open in IMG/M |
| 3300005576|Ga0066708_10972582 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 528 | Open in IMG/M |
| 3300006176|Ga0070765_101330369 | All Organisms → cellular organisms → Bacteria | 677 | Open in IMG/M |
| 3300006796|Ga0066665_10929237 | Not Available | 671 | Open in IMG/M |
| 3300006797|Ga0066659_11802423 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 518 | Open in IMG/M |
| 3300006800|Ga0066660_10969474 | Not Available | 686 | Open in IMG/M |
| 3300006893|Ga0073928_10842370 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 631 | Open in IMG/M |
| 3300007258|Ga0099793_10105851 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Azospirillaceae → Azospirillum → Azospirillum baldaniorum | 1305 | Open in IMG/M |
| 3300007265|Ga0099794_10033363 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2421 | Open in IMG/M |
| 3300007265|Ga0099794_10438188 | Not Available | 685 | Open in IMG/M |
| 3300007788|Ga0099795_10029044 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1886 | Open in IMG/M |
| 3300007788|Ga0099795_10074589 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1286 | Open in IMG/M |
| 3300007788|Ga0099795_10333661 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 674 | Open in IMG/M |
| 3300007788|Ga0099795_10334213 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 674 | Open in IMG/M |
| 3300009038|Ga0099829_10905713 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 732 | Open in IMG/M |
| 3300009088|Ga0099830_10094416 | All Organisms → cellular organisms → Bacteria | 2221 | Open in IMG/M |
| 3300009088|Ga0099830_10235788 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1443 | Open in IMG/M |
| 3300009143|Ga0099792_10143215 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1309 | Open in IMG/M |
| 3300009143|Ga0099792_10227631 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1074 | Open in IMG/M |
| 3300009143|Ga0099792_10438888 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 806 | Open in IMG/M |
| 3300009143|Ga0099792_11033231 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 550 | Open in IMG/M |
| 3300009143|Ga0099792_11065558 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 543 | Open in IMG/M |
| 3300009156|Ga0111538_12723362 | Not Available | 620 | Open in IMG/M |
| 3300009792|Ga0126374_10263956 | Not Available | 1132 | Open in IMG/M |
| 3300010159|Ga0099796_10441839 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 577 | Open in IMG/M |
| 3300010159|Ga0099796_10542784 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 522 | Open in IMG/M |
| 3300010343|Ga0074044_11068560 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 529 | Open in IMG/M |
| 3300010361|Ga0126378_12686161 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 569 | Open in IMG/M |
| 3300010376|Ga0126381_101277893 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1061 | Open in IMG/M |
| 3300010398|Ga0126383_10367084 | All Organisms → cellular organisms → Bacteria | 1465 | Open in IMG/M |
| 3300011120|Ga0150983_14992314 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 717 | Open in IMG/M |
| 3300011269|Ga0137392_11085448 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 657 | Open in IMG/M |
| 3300011269|Ga0137392_11538298 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 524 | Open in IMG/M |
| 3300011271|Ga0137393_10362602 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1239 | Open in IMG/M |
| 3300011271|Ga0137393_10961197 | Not Available | 728 | Open in IMG/M |
| 3300012096|Ga0137389_10774192 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 824 | Open in IMG/M |
| 3300012189|Ga0137388_10500378 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1129 | Open in IMG/M |
| 3300012199|Ga0137383_10822541 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 678 | Open in IMG/M |
| 3300012202|Ga0137363_11786684 | Not Available | 507 | Open in IMG/M |
| 3300012203|Ga0137399_10220477 | Not Available | 1546 | Open in IMG/M |
| 3300012203|Ga0137399_10262048 | Not Available | 1420 | Open in IMG/M |
| 3300012203|Ga0137399_10587680 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 936 | Open in IMG/M |
| 3300012210|Ga0137378_10786778 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 863 | Open in IMG/M |
| 3300012212|Ga0150985_109391371 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 518 | Open in IMG/M |
| 3300012362|Ga0137361_10832343 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 839 | Open in IMG/M |
| 3300012582|Ga0137358_10936413 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 565 | Open in IMG/M |
| 3300012683|Ga0137398_10069594 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2142 | Open in IMG/M |
| 3300012685|Ga0137397_10238883 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 1353 | Open in IMG/M |
| 3300012685|Ga0137397_10672504 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 769 | Open in IMG/M |
| 3300012685|Ga0137397_10799108 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 700 | Open in IMG/M |
| 3300012917|Ga0137395_10174152 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1485 | Open in IMG/M |
| 3300012918|Ga0137396_10572291 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 836 | Open in IMG/M |
| 3300012918|Ga0137396_10890807 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 653 | Open in IMG/M |
| 3300012922|Ga0137394_10668114 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 876 | Open in IMG/M |
| 3300012923|Ga0137359_11509864 | Not Available | 560 | Open in IMG/M |
| 3300012924|Ga0137413_10938244 | All Organisms → cellular organisms → Bacteria | 674 | Open in IMG/M |
| 3300012925|Ga0137419_10467998 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 996 | Open in IMG/M |
| 3300012925|Ga0137419_10815639 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 764 | Open in IMG/M |
| 3300012927|Ga0137416_10460824 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1088 | Open in IMG/M |
| 3300012927|Ga0137416_10875817 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 797 | Open in IMG/M |
| 3300012929|Ga0137404_10710956 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 909 | Open in IMG/M |
| 3300012929|Ga0137404_11908386 | Not Available | 553 | Open in IMG/M |
| 3300012930|Ga0137407_10214777 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1731 | Open in IMG/M |
| 3300012944|Ga0137410_11517418 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 585 | Open in IMG/M |
| 3300012944|Ga0137410_11709657 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 554 | Open in IMG/M |
| 3300012960|Ga0164301_10604298 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 810 | Open in IMG/M |
| 3300013306|Ga0163162_11072710 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 912 | Open in IMG/M |
| 3300014326|Ga0157380_12723905 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 561 | Open in IMG/M |
| 3300015051|Ga0137414_1226710 | Not Available | 1700 | Open in IMG/M |
| 3300015054|Ga0137420_1244866 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 618 | Open in IMG/M |
| 3300015242|Ga0137412_10073786 | All Organisms → cellular organisms → Bacteria | 2776 | Open in IMG/M |
| 3300015242|Ga0137412_11186393 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 536 | Open in IMG/M |
| 3300016270|Ga0182036_11134291 | Not Available | 648 | Open in IMG/M |
| 3300016341|Ga0182035_10202761 | Not Available | 1570 | Open in IMG/M |
| 3300016357|Ga0182032_11966793 | Not Available | 513 | Open in IMG/M |
| 3300018482|Ga0066669_10918070 | All Organisms → cellular organisms → Bacteria | 785 | Open in IMG/M |
| 3300020582|Ga0210395_10689277 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 764 | Open in IMG/M |
| 3300021168|Ga0210406_10622055 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 840 | Open in IMG/M |
| 3300021171|Ga0210405_10934912 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 657 | Open in IMG/M |
| 3300021171|Ga0210405_11078888 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
| 3300021178|Ga0210408_10195674 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1607 | Open in IMG/M |
| 3300021178|Ga0210408_10776249 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 751 | Open in IMG/M |
| 3300021178|Ga0210408_11075915 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 619 | Open in IMG/M |
| 3300021420|Ga0210394_10472842 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1103 | Open in IMG/M |
| 3300021432|Ga0210384_10825402 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 825 | Open in IMG/M |
| 3300021478|Ga0210402_10162745 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2037 | Open in IMG/M |
| 3300021478|Ga0210402_10908343 | Not Available | 807 | Open in IMG/M |
| 3300021479|Ga0210410_10451733 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1149 | Open in IMG/M |
| 3300021479|Ga0210410_10993445 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 728 | Open in IMG/M |
| 3300021559|Ga0210409_10918810 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 749 | Open in IMG/M |
| 3300021559|Ga0210409_11428940 | Not Available | 568 | Open in IMG/M |
| 3300025929|Ga0207664_11438925 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 610 | Open in IMG/M |
| 3300026355|Ga0257149_1003389 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1817 | Open in IMG/M |
| 3300026359|Ga0257163_1031899 | Not Available | 829 | Open in IMG/M |
| 3300026490|Ga0257153_1003434 | Not Available | 3068 | Open in IMG/M |
| 3300026490|Ga0257153_1048279 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 873 | Open in IMG/M |
| 3300026555|Ga0179593_1229360 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1213 | Open in IMG/M |
| 3300026555|Ga0179593_1261034 | All Organisms → cellular organisms → Bacteria | 2608 | Open in IMG/M |
| 3300026557|Ga0179587_10760851 | All Organisms → cellular organisms → Bacteria | 638 | Open in IMG/M |
| 3300026984|Ga0208732_1007622 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 868 | Open in IMG/M |
| 3300027172|Ga0208098_1000280 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2655 | Open in IMG/M |
| 3300027173|Ga0208097_1016148 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 830 | Open in IMG/M |
| 3300027381|Ga0208983_1011677 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1673 | Open in IMG/M |
| 3300027512|Ga0209179_1046546 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 923 | Open in IMG/M |
| 3300027512|Ga0209179_1105952 | Not Available | 627 | Open in IMG/M |
| 3300027583|Ga0209527_1003782 | All Organisms → cellular organisms → Bacteria | 3061 | Open in IMG/M |
| 3300027681|Ga0208991_1129178 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 751 | Open in IMG/M |
| 3300027727|Ga0209328_10022024 | Not Available | 1950 | Open in IMG/M |
| 3300027783|Ga0209448_10044106 | Not Available | 1500 | Open in IMG/M |
| 3300027812|Ga0209656_10015659 | Not Available | 4701 | Open in IMG/M |
| 3300027812|Ga0209656_10052832 | Not Available | 2286 | Open in IMG/M |
| 3300027825|Ga0209039_10052079 | Not Available | 1859 | Open in IMG/M |
| 3300027829|Ga0209773_10416122 | Not Available | 557 | Open in IMG/M |
| 3300027903|Ga0209488_10657258 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 755 | Open in IMG/M |
| 3300028047|Ga0209526_10034994 | Not Available | 3535 | Open in IMG/M |
| 3300031718|Ga0307474_10229809 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae | 1417 | Open in IMG/M |
| 3300031753|Ga0307477_10226766 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae | 1296 | Open in IMG/M |
| 3300031798|Ga0318523_10416650 | Not Available | 667 | Open in IMG/M |
| 3300031912|Ga0306921_10028608 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 6190 | Open in IMG/M |
| 3300032059|Ga0318533_10060616 | All Organisms → cellular organisms → Bacteria | 2542 | Open in IMG/M |
| 3300032180|Ga0307471_104257010 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 45.45% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 15.91% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 9.85% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 6.06% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.79% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.03% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.03% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.27% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.52% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.76% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.76% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.76% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.76% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.76% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.76% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.76% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.76% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.76% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.76% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.76% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.76% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2040502001 | Soil microbial communities from sample at FACE Site 2 North Carolina CO2+ | Environmental | Open in IMG/M |
| 3300001545 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300003219 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 | Environmental | Open in IMG/M |
| 3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300015051 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026355 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-02-A | Environmental | Open in IMG/M |
| 3300026359 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-06-A | Environmental | Open in IMG/M |
| 3300026490 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-A | Environmental | Open in IMG/M |
| 3300026555 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300026984 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF048 (SPAdes) | Environmental | Open in IMG/M |
| 3300027172 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF038 (SPAdes) | Environmental | Open in IMG/M |
| 3300027173 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF036 (SPAdes) | Environmental | Open in IMG/M |
| 3300027381 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027583 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027681 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027727 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027783 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027825 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027829 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FACENCE_5873950 | 2040502001 | Soil | NAANEGHRAMPPTAVADLETERAEEDGSEMAGPVRTSLSNRQPYSA |
| JGI12630J15595_100245971 | 3300001545 | Forest Soil | MNAANEGHQHRVTRPDAPADVETEMAEEEGSEMAGPVRASPSDRRPYSA* |
| JGI12635J15846_101177481 | 3300001593 | Forest Soil | MNAANEGHQHRVTRPGAPADVETEMAEEEGSEMAGPVRAS |
| JGIcombinedJ26739_1000266185 | 3300002245 | Forest Soil | MPPTAVADLETERAEEDGSEMAGPVRTSLSNRQPYSA* |
| JGI26341J46601_100274133 | 3300003219 | Bog Forest Soil | QQRATGPTASADLQTEMAEEEGSEMAGPARASPMNRQPYSS* |
| JGI26341J46601_102014301 | 3300003219 | Bog Forest Soil | MNAANEGHQQRATGPTASADLQTEMAEEEGSEMAGPARASP |
| JGIcombinedJ51221_100044294 | 3300003505 | Forest Soil | MNAANEGHQHRATRPDAPTDVETEMAEEEGSEMAGPVRASPSDRQPYSA* |
| Ga0062385_106216712 | 3300004080 | Bog Forest Soil | RIMNAANEGHQHRATRPDAPTDAETEMAEEEGSEMAGPVHTSPSDRQPYSA* |
| Ga0066388_1078882631 | 3300005332 | Tropical Forest Soil | HAEHYFRVMNAANEAHQPPAMRPTASADPQTEMAEEEPSEIVGPARASPADRRPYSA* |
| Ga0070714_1019630061 | 3300005435 | Agricultural Soil | MNAANEGQHHRATRPTAPADLQAETSEEEGSEMVGPSRAS |
| Ga0070699_1005219042 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | QHAEHYFRVMNAADEGHQHRATRPTAPADLETEMAEEDGSEMVGPARAPPSDQPYSF* |
| Ga0066699_106378872 | 3300005561 | Soil | MNAADEGHQHRATRPTAPADLETEMAEEDGSEMAGPARAPPSDQPYSF* |
| Ga0066708_109725822 | 3300005576 | Soil | MNAANEGHQHRATRPDAPVDVETEVAEEASSEMAGPMRASPSDRQPYS |
| Ga0070765_1013303691 | 3300006176 | Soil | AEHYFRVMNAANEGHRAMPPTAVADLETERAEEDGSEMAGTVRTSLGQRM* |
| Ga0066665_109292371 | 3300006796 | Soil | MRPTAPADLQTAMSEGEGSEMVGPARASPSDRQPYSA* |
| Ga0066659_118024231 | 3300006797 | Soil | QHAEHYFRVMNAANEGHQHRATRPDAPVDVETEVAEEASSEMAGPMRASPSDRQPYSA* |
| Ga0066660_109694741 | 3300006800 | Soil | MKAANEGHQQPAMRSSAPTDLQTEMSEEEGSEIDRPARASPSQRQPYYPAAPLSS* |
| Ga0073928_108423702 | 3300006893 | Iron-Sulfur Acid Spring | MNAANEGHQHRVTRPDAPADVETEMAEEERSEMAGPVRA* |
| Ga0099793_101058511 | 3300007258 | Vadose Zone Soil | MNAANEGHQHRVTRPGAPADVETEMAEEEGSEMAGPVRASSSDRRPYSA* |
| Ga0099794_100333631 | 3300007265 | Vadose Zone Soil | MNAANEGHQHRVTRPDAPADVETEMAEEEGSEMAGPVRASSSDRRPYSA* |
| Ga0099794_104381881 | 3300007265 | Vadose Zone Soil | NEGHQHRVTRPDAPADVETEMAGEEGSEMAGPVRTSPSDRQPYSA* |
| Ga0099795_100290443 | 3300007788 | Vadose Zone Soil | RIMNAANEGHQHRAMRPDAPANVETEMAEEEGSEMAGPVRASPSDRRPYSA* |
| Ga0099795_100745892 | 3300007788 | Vadose Zone Soil | MNAANEGHQHRATRPDAPADVETEMAEEEGSEMAGPVRASPSERQPYSA* |
| Ga0099795_103336612 | 3300007788 | Vadose Zone Soil | LYQHAVHYFRIMNAANEGHPHATRPVAPADVETEMAEEEGSEMAGPVRASPSDRAPYSA* |
| Ga0099795_103342131 | 3300007788 | Vadose Zone Soil | MNAANEGHQHRAMRPDAPADVETEMAEEEGSEMAGPVRASPSGGSGYGAL* |
| Ga0099829_109057132 | 3300009038 | Vadose Zone Soil | MNGADEGHQHRATRPTAPADLETEMAEEDGSEMAGPARA |
| Ga0099830_100944161 | 3300009088 | Vadose Zone Soil | MNAANEGHQHRVTRPGAPADVETEMAEEEGSEMAGPVRASPSDRQPYSA* |
| Ga0099830_102357882 | 3300009088 | Vadose Zone Soil | MNAADEGHQHRATRPTAPADLETEMAEEDGSEMAGPARAPSSDRQPYSF* |
| Ga0099792_101432152 | 3300009143 | Vadose Zone Soil | MNAANEGHQHRAMRPDAPADVETEMAEEQGSEMAGPVRASPSDRRPYSA* |
| Ga0099792_102276311 | 3300009143 | Vadose Zone Soil | MIAANEGHQHRAMRPDAPADVETEMAEEEGSEIAGPVRASPSDRWPYSA* |
| Ga0099792_104388881 | 3300009143 | Vadose Zone Soil | MKAANEGHQQRAARPSAPTDFQTEMSEEEGSEIDGPARTSPSQR* |
| Ga0099792_110332311 | 3300009143 | Vadose Zone Soil | MNAANEGQQHRATRPDAPADVETEMAEEDGSEMAGRVRASPSDRQPYST* |
| Ga0099792_110655583 | 3300009143 | Vadose Zone Soil | DAPADVETEMAEEEGSEMAGPVRASPSERQPYSA* |
| Ga0111538_127233622 | 3300009156 | Populus Rhizosphere | AEHYFRVMNAANEAHQPPAGRPTAPADLQTEMAEEERSGMVGPARASPSDRQIYPA* |
| Ga0126374_102639561 | 3300009792 | Tropical Forest Soil | RVMNAANEAHQPPAVRPTAPADPQTETAEEERSGMVGPARASPSDRQIYPA* |
| Ga0099796_104418391 | 3300010159 | Vadose Zone Soil | MNAANEGHQHRATRPDVPADVETEMPEEEGSEMAGPVRASPSDRRPY* |
| Ga0099796_105427841 | 3300010159 | Vadose Zone Soil | MMNAANEGHQHRAMRPDAPADVETEMAEEEGSEMAGPVRTSPSDRQPYSA* |
| Ga0074044_110685601 | 3300010343 | Bog Forest Soil | MNAANEGHQHRAPRPTAPADLETEMAEEEGSEMAGPARASP |
| Ga0126378_126861611 | 3300010361 | Tropical Forest Soil | AEHYSRIMNAANEGDQHRVTRPDAPADVETEMAEEEGPEMAGPVRASPSDRHPYSA* |
| Ga0126381_1012778931 | 3300010376 | Tropical Forest Soil | EHYFRIMNAGNEGHQHRATRPDAPTDVETEMAEEEGSEMAGPVGASPSDRQPYSA* |
| Ga0126383_103670841 | 3300010398 | Tropical Forest Soil | EHYFRVMKTANESHLHHSTRPTAPADLQPEMSEEEGFEMVGPSRASPSDR* |
| Ga0150983_149923141 | 3300011120 | Forest Soil | MNAANEGHQHRATRLDAPADVEPEMAEEEGSEMAGPVRASSSDRRPYSA* |
| Ga0137392_110854482 | 3300011269 | Vadose Zone Soil | RVMNAADEGHQHRATRPTAPADLETEMAEEDGSEMAGPARAPSSDRQPYSF* |
| Ga0137392_115382981 | 3300011269 | Vadose Zone Soil | MNAANEGHQHRVTRPDAPADVETEMAEEEGSEMAGPVRTSPS |
| Ga0137393_103626022 | 3300011271 | Vadose Zone Soil | HEQRATRSDAPADVETEMAEEEGSEMAGPVRASPSDRQPHPA* |
| Ga0137393_109611971 | 3300011271 | Vadose Zone Soil | MNAANEGHQHRATRPDAPADGETEMAEEEGSEMAGPVRTSPSDRQPYSA* |
| Ga0137389_107741921 | 3300012096 | Vadose Zone Soil | MNAANEGHQHRVTPPGAPADVETGMAEEEGSEMAGPVRASSSDRRPYSA* |
| Ga0137388_105003782 | 3300012189 | Vadose Zone Soil | MNAADEGQQHRATRPTAPADLETEMAEEDGSEMAGPARAPSSDRQPYSF* |
| Ga0137383_108225412 | 3300012199 | Vadose Zone Soil | MNAANEGHQHRATRPDAPADVETEMAEEEGSEMAGPVRASSSDRRPYSA* |
| Ga0137363_117866841 | 3300012202 | Vadose Zone Soil | PDAPADVETEMAEEEGSEMAGPVRASPSDRRPYSA* |
| Ga0137399_102204771 | 3300012203 | Vadose Zone Soil | HRATRPDAPADVETEMAEEEGSELAGPVRASPSERQPYSA* |
| Ga0137399_102620481 | 3300012203 | Vadose Zone Soil | TRPDAPADVETEMAEEERSEMAGPVRASPSDRRPYSA* |
| Ga0137399_105876801 | 3300012203 | Vadose Zone Soil | MNAANEGHQHRVTRPDAPADVETEMAEEEGSEMAGPVRASPSDR |
| Ga0137378_107867781 | 3300012210 | Vadose Zone Soil | MNAANEGHQHRATRPDAPADVKTEMAEEEGSEMAGPLRASPSDRQPYSA* |
| Ga0150985_1093913711 | 3300012212 | Avena Fatua Rhizosphere | RPDAPADVETEMAKEEGSEMAGSVRASPSDRQPYSA* |
| Ga0137361_108323432 | 3300012362 | Vadose Zone Soil | MNAANEGHQHRATRPDAPADVETEMAEEEGSEMAGPVRASPSDRQPYSA* |
| Ga0137358_109364131 | 3300012582 | Vadose Zone Soil | MKAANEGHQQRATRPSTPTDLQTEMSEEKGSEIDGPARAWPSQRQ |
| Ga0137398_100695941 | 3300012683 | Vadose Zone Soil | MIAANEGHQHRAMRPDAPADVETEMAEEEGSEIAGPVRASPSDRRPYSA* |
| Ga0137397_102388831 | 3300012685 | Vadose Zone Soil | HYFRVMNAANEGHRAMPPTAVADLETERAEEDGSEMAGPVRTSLSNQQPHSA* |
| Ga0137397_106725042 | 3300012685 | Vadose Zone Soil | HYFRIMNAANEGHQHRVTRPGAPADLETEMAEEEGSEMAGPVRASPSDRRPYSA* |
| Ga0137397_107991081 | 3300012685 | Vadose Zone Soil | MNAANEGHQHRVTRPDAPADVETEMAEEEGSEMAGPVRASPS |
| Ga0137395_101741522 | 3300012917 | Vadose Zone Soil | MNAADEGHQHRATRPTAPADLETEMAEEDGSEMAGPARAPPSDQQPYSF* |
| Ga0137396_105722913 | 3300012918 | Vadose Zone Soil | MNAANEGHQHRVTPPGAPADVETEMAEEEGSEMAGPVRAS |
| Ga0137396_108908071 | 3300012918 | Vadose Zone Soil | MNAANEGHRAMPPTAVADLETERAEEDGSEMAGPVRTSLSNQQPYSA* |
| Ga0137394_106681141 | 3300012922 | Vadose Zone Soil | ENLYQHAEHYFRVMNAANEGLRAMPPTAAADLETERAEEDGSEMAGPVRTSLSNRQPYSA |
| Ga0137359_115098642 | 3300012923 | Vadose Zone Soil | NAANEGHQQRVTRPDAPADVETEVEEGSEMAGPVRASPSDRQPYSA* |
| Ga0137413_109382441 | 3300012924 | Vadose Zone Soil | GAPADVETEMAEEEGSEMAGPVRASSSDRRPYSA* |
| Ga0137419_104679981 | 3300012925 | Vadose Zone Soil | MNAADEGHQHRATRPTAPADLETEMAEENGSEMAGPARAPPSDPQPYSF* |
| Ga0137419_108156392 | 3300012925 | Vadose Zone Soil | MKAANEGHQQRATRPSTPTDLQTEMSEEEGSEIDGPARAWPKSPALLR |
| Ga0137416_104608243 | 3300012927 | Vadose Zone Soil | EHYFRVMNAANEGHQHRAMPPTVAADLDTERVEEDGSEIAGPVRTSLSNQQPYSA* |
| Ga0137416_108758171 | 3300012927 | Vadose Zone Soil | AEHYFRIMNAANEGHQHRATRPDAPADVETEMAEEEGSEMAGPVRASPSDRRPYSA* |
| Ga0137404_107109562 | 3300012929 | Vadose Zone Soil | MNAADEGHQHRATRPTAPADLETEMAAEGGSETAGPARAPPSDPQPYSF* |
| Ga0137404_119083861 | 3300012929 | Vadose Zone Soil | RSDAPADVETEMAEEEVSEVDGPARASPSQRQPYSS* |
| Ga0137407_102147772 | 3300012930 | Vadose Zone Soil | MNAADEGHQHRATRPTAPADLETEMAEEGGSEMAGPARAPPSDQQPYSF* |
| Ga0137410_115174181 | 3300012944 | Vadose Zone Soil | MNAANEGHQHRVTRPDAPADVETEMAEEEGSEMAGPVRASPSDRQPYSA* |
| Ga0137410_117096571 | 3300012944 | Vadose Zone Soil | MNAANEGHQHRATRPDAPADVETEMAEEEGSEMAGPVRASP |
| Ga0164301_106042982 | 3300012960 | Soil | MNAANEGHQHRATRPDAPTDVETEMAEEEGSEMAVPVRASSSDWRPYSA* |
| Ga0163162_110727102 | 3300013306 | Switchgrass Rhizosphere | MNAANEGHQHRTARPDAPADVDTEMAEEEGSEMAVPVRA* |
| Ga0157380_127239051 | 3300014326 | Switchgrass Rhizosphere | MNAANEGHQHRATRPDAPADVETEMAEEEGSEMAGPV |
| Ga0137414_12267101 | 3300015051 | Vadose Zone Soil | MNAANEGHQHRGTRPDAPADVETDMAEEEGSEMAGPVRASPSDRQPYSA* |
| Ga0137420_12448662 | 3300015054 | Vadose Zone Soil | MNAANEGHQHRVTRPGAPADVETEMAEEEGSEMAGPVR |
| Ga0137412_100737864 | 3300015242 | Vadose Zone Soil | RPDAPADVETEMAEEEGSEMAGPVRTSPSDRQPYSA* |
| Ga0137412_111863931 | 3300015242 | Vadose Zone Soil | MNAANEGHQHRVTRPDAPADVETEMAEEEGSEMAGPVR |
| Ga0182036_111342911 | 3300016270 | Soil | YFRVRNAANEGHQHRAMPPTAAADLETERAEEDGSEMAGPVRTSLSNRQPYSA |
| Ga0182035_102027614 | 3300016341 | Soil | MNAANEGHQPRATHPNAPADLETEMADEEGSELAGSARASPSDRQPYPV |
| Ga0182032_119667931 | 3300016357 | Soil | YFRVMNAAKEAHQHPAMRPTAPADLQTEMAEEEASEMAGPGPASPSERQPYSA |
| Ga0066669_109180702 | 3300018482 | Grasslands Soil | VMNAGNEGPQHHATRPAAPDDLGTEIAEEEGSEMAGTSPMDRQPYLS |
| Ga0210395_106892773 | 3300020582 | Soil | ANEGHQHRATRPDAPTDVETEMAEEEGSERAAPVRASPSDRQPYSA |
| Ga0210406_106220551 | 3300021168 | Soil | MPSTSVADLETESAEEDGSEMAGPVRTSLSNRQPYSA |
| Ga0210405_109349121 | 3300021171 | Soil | VRVMNAANEGQHHRATRPTAPADLQAEMSEEEGSEMVGPSRDSPSDRQLY |
| Ga0210405_110788881 | 3300021171 | Soil | YFRVMKAANEGHQQRATRPSTPSDLQTEMSEEEGSEIDGLARAWPSQRQPYSS |
| Ga0210408_101956743 | 3300021178 | Soil | GQRFEHRVTRPGAPADVETEMAEEEGSEMAGPVRASPSDRRPYSA |
| Ga0210408_107762491 | 3300021178 | Soil | MNAANEGHQHRATRPDAPTDVETEMAEEEGSEMAGPVRASPSGRQPYSA |
| Ga0210408_110759152 | 3300021178 | Soil | EHYFRIMNAANEGHQHRATRPDAPTDVETEMAEEEGSEMAGPVRASPSDRQPYSA |
| Ga0210394_104728421 | 3300021420 | Soil | MNAANEGHQHRATRPDAPTGVETEMAEEEGSEMTAPVRASPSGRQPYSA |
| Ga0210384_108254021 | 3300021432 | Soil | PTSVADLETESAEEDGSEMAGPVRTSLSNRQPYSA |
| Ga0210402_101627452 | 3300021478 | Soil | MNAANEGHQHRVTRPGAPADVETEMAEEEGSEMAGPVRASPSDRRPYSA |
| Ga0210402_109083431 | 3300021478 | Soil | YFRIMNATNEGHQHRVTRPDAPADVETEMAEEEGSEMAGPVRASPSDRQPYSV |
| Ga0210410_104517331 | 3300021479 | Soil | HYFRVINAANEGHRAMPPTSVADLETESAEEDGSEMAGPVRTSLSNRQPYSA |
| Ga0210410_109934451 | 3300021479 | Soil | LAEGLIMRPDAPTDVETEMAEEEGSEMAGPVRASPSERRPYSA |
| Ga0210409_109188101 | 3300021559 | Soil | EHYFRIMNAANERHQHRATRPDAPTDVETEMAEEEGSEMAGPVRASPSDRQPYSA |
| Ga0210409_114289401 | 3300021559 | Soil | HRVTRPDAPVDVETEMAEEEGSEMAGPVRASPSDRRPYSA |
| Ga0207664_114389252 | 3300025929 | Agricultural Soil | AEHYFRVMNAANEGLQHRATRPTAADLQTQMSQEEGSEMVGPSRASPSDRQPYSS |
| Ga0257149_10033891 | 3300026355 | Soil | MNAANEGHQHRATRPDAPTDVETEMAEEEGSEMAGPVRASPSDRQPYSA |
| Ga0257163_10318992 | 3300026359 | Soil | EHYFRIMNAANEGHQHRVTPPGAPADVETEMAEEEGSEMAGPVRASSSDRRPYSA |
| Ga0257153_10034341 | 3300026490 | Soil | MNAANEGHQHRVTRPGAPADVETEMAEEEGSEMAGPVRASSSDRRPYSA |
| Ga0257153_10482791 | 3300026490 | Soil | QHRVTRPDAPADVETEMAEEERSEMAGPVRASPSDRRPYSA |
| Ga0179593_12293602 | 3300026555 | Vadose Zone Soil | MNAANEGHQHRVTRPDAPADVETEMAEEERSEMAGPVRASPSDRRPYSA |
| Ga0179593_12610345 | 3300026555 | Vadose Zone Soil | NAANEGHQHRVTRPDAPADVETEMAEEERSEMAGPVRASPSDRRPYSA |
| Ga0179587_107608511 | 3300026557 | Vadose Zone Soil | YFRIMIAANEGHQHRAMRPDAPADVETEMAEEEGSEIAGPVRASPSDRRPYSA |
| Ga0208732_10076222 | 3300026984 | Forest Soil | NEGHQHRATRPDAPTDVETEMAEEEGSEMAGPVRASPSDRQPYSA |
| Ga0208098_10002801 | 3300027172 | Forest Soil | EHYFRVMNAANEGHRAMPPTAVADLETERAEEDGSEMAGPVRTSLSNRQPYSA |
| Ga0208097_10161481 | 3300027173 | Forest Soil | ENLYQHAEHYFRVMNAANEGHRAMPPTAVADLETERAEEDGSEMAGPVRTSLSNRQPYSA |
| Ga0208983_10116773 | 3300027381 | Forest Soil | MNAANEGHQHRVTRPGAPADVETEMAEEEGSEMAGPVRASPSDRQPYSA |
| Ga0209179_10465461 | 3300027512 | Vadose Zone Soil | MNAANEGHQHRATRPDAPADVETEMAEEEGSEMAGPVRASPSDRQPYSA |
| Ga0209179_11059522 | 3300027512 | Vadose Zone Soil | RATRPDAPADVETEMAEEEGSEMAGPVRASPSDRQPYSA |
| Ga0209527_10037824 | 3300027583 | Forest Soil | MPPTAVADLETERAEEDGSEMAGPVRTSLSNRQPYSA |
| Ga0208991_11291782 | 3300027681 | Forest Soil | MNAANEGHQHRAMRPDAPADVETEMAEEEGSEMAGPVRASPSERRPYSA |
| Ga0209328_100220241 | 3300027727 | Forest Soil | FRVMNAANEGHRAMPPTAVADLETERAEEDGSEMAGPVRTSLSNRQPYSA |
| Ga0209448_100441061 | 3300027783 | Bog Forest Soil | VNAANEDHQHRATRPTAPADLETEMAEEEGSEMAGPARASPSNRQPYSA |
| Ga0209656_1001565910 | 3300027812 | Bog Forest Soil | VMNAANEGHQQRATGPTASADLQTEMAEEEGSEMAGPARASPMNRQPYSS |
| Ga0209656_100528321 | 3300027812 | Bog Forest Soil | VMNAANEGHQQRATGPTASADLQTEMAEEEGSEMAGPARASPSNRQPYSA |
| Ga0209039_100520794 | 3300027825 | Bog Forest Soil | QRATGPTASADLQTEMAEEEGSEMAGPARASPMNRQPYSS |
| Ga0209773_104161221 | 3300027829 | Bog Forest Soil | MNAANEGHQHRATRPDAPTDAETEMAEEEGSEMAGPVHTSPSDRQPYSA |
| Ga0209488_106572582 | 3300027903 | Vadose Zone Soil | MNAANEGHPHRATRPVAPADVETEMAEEEGSGPVRASPGDRQPYSA |
| Ga0209526_100349941 | 3300028047 | Forest Soil | MNAANEGHQHRVTRPDAPADVETEMAEEEGSEMAGPVRASPSDRRPYSA |
| Ga0307474_102298091 | 3300031718 | Hardwood Forest Soil | QHRATRPDAPADVETEMAEKEGSEMAGPVRASPSDRQPYSA |
| Ga0307477_102267661 | 3300031753 | Hardwood Forest Soil | MNAANEGHQHRATRPDAPADVETEMAEKEGSEMAGPVRASPSDRQPYSA |
| Ga0318523_104166502 | 3300031798 | Soil | HQHRAMPPTAAADLETERAEEDGSEMAGPVRTSLSNRQPYSA |
| Ga0306921_100286081 | 3300031912 | Soil | FRVMNAAKEAHQHPAMRPTAPADLQTEMSEDERSDMVGPERAAPSDRQPYSA |
| Ga0318533_100606167 | 3300032059 | Soil | MHAEHYFRVRNAANEGHQHRAMPPTAAADLETERAEEDGSEMAGPVRTSLSNRQPYSA |
| Ga0307471_1042570102 | 3300032180 | Hardwood Forest Soil | TRPGAPADVETEMAEEEGSEMAGPVRASPSDRQPYSA |
| ⦗Top⦘ |