


| Basic Information | |
|---|---|
| Family ID | F061048 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 132 |
| Average Sequence Length | 47 residues |
| Representative Sequence | MSLDLVALKDEQSAARNARPRRSLDLETESFVRVLPIRWRLFSIAALNA |
| Number of Associated Samples | 120 |
| Number of Associated Scaffolds | 132 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 84.85 % |
| % of genes near scaffold ends (potentially truncated) | 99.24 % |
| % of genes from short scaffolds (< 2000 bps) | 89.39 % |
| Associated GOLD sequencing projects | 116 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.29 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (99.242 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (21.970 % of family members) |
| Environment Ontology (ENVO) | Unclassified (27.273 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (41.667 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 50.65% β-sheet: 0.00% Coil/Unstructured: 49.35% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.29 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 132 Family Scaffolds |
|---|---|---|
| PF03480 | DctP | 83.33 |
| PF00378 | ECH_1 | 2.27 |
| PF13561 | adh_short_C2 | 1.52 |
| PF00866 | Ring_hydroxyl_B | 1.52 |
| PF03401 | TctC | 0.76 |
| PF00106 | adh_short | 0.76 |
| PF00121 | TIM | 0.76 |
| PF07883 | Cupin_2 | 0.76 |
| PF16113 | ECH_2 | 0.76 |
| PF10397 | ADSL_C | 0.76 |
| PF00903 | Glyoxalase | 0.76 |
| PF01738 | DLH | 0.76 |
| COG ID | Name | Functional Category | % Frequency in 132 Family Scaffolds |
|---|---|---|---|
| COG5517 | 3-phenylpropionate/cinnamic acid dioxygenase, small subunit | Secondary metabolites biosynthesis, transport and catabolism [Q] | 1.52 |
| COG0149 | Triosephosphate isomerase | Carbohydrate transport and metabolism [G] | 0.76 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 0.76 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 99.24 % |
| Unclassified | root | N/A | 0.76 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2140918013|NODE_419806_length_1165_cov_8.813734 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1197 | Open in IMG/M |
| 2170459003|FZ032L002FLMFG | All Organisms → cellular organisms → Bacteria → Proteobacteria | 502 | Open in IMG/M |
| 3300000550|F24TB_11385202 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1064 | Open in IMG/M |
| 3300000651|AP72_2010_repI_A10DRAFT_1054321 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 530 | Open in IMG/M |
| 3300000893|AP72_2010_repI_A001DRAFT_1075370 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 532 | Open in IMG/M |
| 3300000953|JGI11615J12901_10357344 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 962 | Open in IMG/M |
| 3300001164|JGI11823J13286_1009309 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 693 | Open in IMG/M |
| 3300001225|SwM_113819 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 510 | Open in IMG/M |
| 3300004114|Ga0062593_101381460 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 751 | Open in IMG/M |
| 3300004479|Ga0062595_100747539 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 795 | Open in IMG/M |
| 3300004479|Ga0062595_101434741 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 632 | Open in IMG/M |
| 3300004629|Ga0008092_11347922 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1046 | Open in IMG/M |
| 3300005332|Ga0066388_106094196 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 609 | Open in IMG/M |
| 3300005332|Ga0066388_106660582 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 582 | Open in IMG/M |
| 3300005366|Ga0070659_101225239 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 664 | Open in IMG/M |
| 3300005436|Ga0070713_100214710 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1743 | Open in IMG/M |
| 3300005436|Ga0070713_100450094 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1209 | Open in IMG/M |
| 3300005444|Ga0070694_101726414 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 533 | Open in IMG/M |
| 3300005447|Ga0066689_10174104 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1292 | Open in IMG/M |
| 3300005540|Ga0066697_10514419 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 677 | Open in IMG/M |
| 3300005560|Ga0066670_10753605 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 590 | Open in IMG/M |
| 3300005574|Ga0066694_10467793 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 589 | Open in IMG/M |
| 3300005764|Ga0066903_106839806 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 592 | Open in IMG/M |
| 3300006031|Ga0066651_10037145 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2218 | Open in IMG/M |
| 3300006038|Ga0075365_10774768 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 677 | Open in IMG/M |
| 3300006051|Ga0075364_11161154 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 524 | Open in IMG/M |
| 3300006186|Ga0075369_10466493 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 599 | Open in IMG/M |
| 3300006195|Ga0075366_10762137 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 602 | Open in IMG/M |
| 3300006605|Ga0074057_11896789 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 711 | Open in IMG/M |
| 3300006800|Ga0066660_11472533 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 535 | Open in IMG/M |
| 3300006846|Ga0075430_101158086 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 637 | Open in IMG/M |
| 3300006852|Ga0075433_10166799 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1960 | Open in IMG/M |
| 3300006854|Ga0075425_101634750 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 726 | Open in IMG/M |
| 3300006881|Ga0068865_100060777 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2646 | Open in IMG/M |
| 3300009012|Ga0066710_102720603 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 704 | Open in IMG/M |
| 3300009157|Ga0105092_10677878 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 598 | Open in IMG/M |
| 3300009792|Ga0126374_11323273 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 583 | Open in IMG/M |
| 3300009792|Ga0126374_11783775 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 514 | Open in IMG/M |
| 3300010046|Ga0126384_10462350 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1086 | Open in IMG/M |
| 3300010046|Ga0126384_11380127 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 656 | Open in IMG/M |
| 3300010159|Ga0099796_10559156 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 514 | Open in IMG/M |
| 3300010358|Ga0126370_10313649 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1250 | Open in IMG/M |
| 3300010360|Ga0126372_12767219 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 542 | Open in IMG/M |
| 3300010398|Ga0126383_11566772 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 748 | Open in IMG/M |
| 3300010868|Ga0124844_1097789 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1113 | Open in IMG/M |
| 3300011119|Ga0105246_10904298 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 792 | Open in IMG/M |
| 3300012189|Ga0137388_11806889 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 543 | Open in IMG/M |
| 3300012209|Ga0137379_11300623 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 633 | Open in IMG/M |
| 3300012349|Ga0137387_11222848 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 529 | Open in IMG/M |
| 3300012356|Ga0137371_10065140 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2821 | Open in IMG/M |
| 3300012357|Ga0137384_11491981 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 525 | Open in IMG/M |
| 3300012363|Ga0137390_10480195 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1218 | Open in IMG/M |
| 3300012363|Ga0137390_11027879 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 775 | Open in IMG/M |
| 3300012897|Ga0157285_10044560 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1058 | Open in IMG/M |
| 3300012909|Ga0157290_10116928 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 811 | Open in IMG/M |
| 3300012971|Ga0126369_11940921 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 677 | Open in IMG/M |
| 3300014150|Ga0134081_10033371 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1498 | Open in IMG/M |
| 3300015373|Ga0132257_102002373 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 747 | Open in IMG/M |
| 3300015374|Ga0132255_104884363 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 568 | Open in IMG/M |
| 3300016294|Ga0182041_10112644 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2025 | Open in IMG/M |
| 3300016422|Ga0182039_10064661 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2556 | Open in IMG/M |
| 3300017973|Ga0187780_11191922 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 558 | Open in IMG/M |
| 3300018000|Ga0184604_10124945 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 825 | Open in IMG/M |
| 3300018053|Ga0184626_10399906 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 549 | Open in IMG/M |
| 3300018054|Ga0184621_10228199 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 666 | Open in IMG/M |
| 3300018078|Ga0184612_10337808 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 766 | Open in IMG/M |
| 3300021168|Ga0210406_10891607 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 670 | Open in IMG/M |
| 3300021171|Ga0210405_10238078 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1441 | Open in IMG/M |
| 3300021968|Ga0193698_1017673 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 922 | Open in IMG/M |
| 3300022756|Ga0222622_10259945 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1179 | Open in IMG/M |
| 3300023069|Ga0247751_1014582 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1196 | Open in IMG/M |
| 3300023078|Ga0247756_1131729 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 502 | Open in IMG/M |
| 3300025908|Ga0207643_10216435 | All Organisms → cellular organisms → Bacteria | 1171 | Open in IMG/M |
| 3300025910|Ga0207684_10905903 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 741 | Open in IMG/M |
| 3300025914|Ga0207671_10474724 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 997 | Open in IMG/M |
| 3300025931|Ga0207644_11187325 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 641 | Open in IMG/M |
| 3300025932|Ga0207690_10679735 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 845 | Open in IMG/M |
| 3300025932|Ga0207690_11057782 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 676 | Open in IMG/M |
| 3300025942|Ga0207689_11742598 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 515 | Open in IMG/M |
| 3300026023|Ga0207677_10047147 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2891 | Open in IMG/M |
| 3300026095|Ga0207676_11468959 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 678 | Open in IMG/M |
| 3300026542|Ga0209805_1042288 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2300 | Open in IMG/M |
| 3300026547|Ga0209156_10341274 | Not Available | 654 | Open in IMG/M |
| 3300026552|Ga0209577_10783685 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 533 | Open in IMG/M |
| 3300027388|Ga0208995_1055626 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 696 | Open in IMG/M |
| 3300027875|Ga0209283_10246852 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1184 | Open in IMG/M |
| 3300027909|Ga0209382_10080830 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3831 | Open in IMG/M |
| 3300028381|Ga0268264_11156872 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 783 | Open in IMG/M |
| 3300028814|Ga0307302_10630608 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 533 | Open in IMG/M |
| 3300028828|Ga0307312_10127187 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1601 | Open in IMG/M |
| 3300028876|Ga0307286_10090635 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1067 | Open in IMG/M |
| 3300031543|Ga0318516_10712970 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 569 | Open in IMG/M |
| 3300031561|Ga0318528_10564007 | All Organisms → cellular organisms → Bacteria | 611 | Open in IMG/M |
| 3300031668|Ga0318542_10627971 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 561 | Open in IMG/M |
| 3300031713|Ga0318496_10023088 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3094 | Open in IMG/M |
| 3300031719|Ga0306917_10758374 | All Organisms → cellular organisms → Bacteria | 762 | Open in IMG/M |
| 3300031720|Ga0307469_12121005 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 547 | Open in IMG/M |
| 3300031723|Ga0318493_10813421 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 527 | Open in IMG/M |
| 3300031724|Ga0318500_10042893 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1884 | Open in IMG/M |
| 3300031744|Ga0306918_10116808 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1926 | Open in IMG/M |
| 3300031751|Ga0318494_10812110 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 548 | Open in IMG/M |
| 3300031764|Ga0318535_10464667 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 563 | Open in IMG/M |
| 3300031768|Ga0318509_10604871 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 610 | Open in IMG/M |
| 3300031779|Ga0318566_10143598 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1182 | Open in IMG/M |
| 3300031781|Ga0318547_10901463 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 552 | Open in IMG/M |
| 3300031796|Ga0318576_10511310 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 567 | Open in IMG/M |
| 3300031845|Ga0318511_10474631 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 577 | Open in IMG/M |
| 3300031859|Ga0318527_10512708 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 511 | Open in IMG/M |
| 3300031896|Ga0318551_10208798 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1082 | Open in IMG/M |
| 3300031945|Ga0310913_10542748 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 825 | Open in IMG/M |
| 3300031947|Ga0310909_11135788 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 634 | Open in IMG/M |
| 3300032025|Ga0318507_10025156 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2162 | Open in IMG/M |
| 3300032044|Ga0318558_10074559 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1549 | Open in IMG/M |
| 3300032054|Ga0318570_10110013 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1210 | Open in IMG/M |
| 3300032059|Ga0318533_10398747 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1005 | Open in IMG/M |
| 3300032065|Ga0318513_10081679 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1492 | Open in IMG/M |
| 3300032065|Ga0318513_10346101 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 724 | Open in IMG/M |
| 3300032076|Ga0306924_10005495 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 12496 | Open in IMG/M |
| 3300032076|Ga0306924_11070967 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 880 | Open in IMG/M |
| 3300032076|Ga0306924_11412873 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 742 | Open in IMG/M |
| 3300032089|Ga0318525_10004783 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 5692 | Open in IMG/M |
| 3300032089|Ga0318525_10214860 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 988 | Open in IMG/M |
| 3300032159|Ga0268251_10338749 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 635 | Open in IMG/M |
| 3300032211|Ga0310896_10773564 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 548 | Open in IMG/M |
| 3300032261|Ga0306920_102013634 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 808 | Open in IMG/M |
| 3300032261|Ga0306920_103655958 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 565 | Open in IMG/M |
| 3300032955|Ga0335076_11623436 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 535 | Open in IMG/M |
| 3300033289|Ga0310914_10006355 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 8448 | Open in IMG/M |
| 3300033290|Ga0318519_10187530 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1174 | Open in IMG/M |
| 3300034147|Ga0364925_0150708 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 844 | Open in IMG/M |
| 3300034149|Ga0364929_0113894 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 860 | Open in IMG/M |
| 3300034151|Ga0364935_0008312 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2582 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 21.97% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 8.33% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.82% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.82% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 6.06% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.55% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 3.03% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.03% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.03% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 3.03% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 3.03% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.03% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.27% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 2.27% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.27% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 2.27% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.52% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.52% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.52% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.76% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.76% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.76% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.76% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.76% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.76% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.76% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.76% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.76% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.76% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.76% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.76% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.76% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.76% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.76% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.76% |
| Agave | Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave | 0.76% |
| Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 0.76% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2140918013 | Soil microbial communities from Great Prairies - Iowa soil (MSU Assemblies) | Environmental | Open in IMG/M |
| 2170459003 | Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect MP BIO 1O1 lysis 0-21cm | Environmental | Open in IMG/M |
| 3300000550 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemly | Environmental | Open in IMG/M |
| 3300000651 | Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A10 | Environmental | Open in IMG/M |
| 3300000893 | Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A001 | Environmental | Open in IMG/M |
| 3300000953 | Soil microbial communities from Great Prairies - Kansas Corn soil | Environmental | Open in IMG/M |
| 3300001164 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M1 | Environmental | Open in IMG/M |
| 3300001225 | Switchgrass rhizosphere microbial communities from Knoxville, Tennessee, USA - 11_joined | Host-Associated | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004629 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome P72I A01 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006038 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Host-Associated | Open in IMG/M |
| 3300006051 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Host-Associated | Open in IMG/M |
| 3300006186 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Host-Associated | Open in IMG/M |
| 3300006195 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Host-Associated | Open in IMG/M |
| 3300006605 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009157 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010868 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (PacBio error correction) | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012897 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S074-202C-1 | Environmental | Open in IMG/M |
| 3300012909 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S149-409B-1 | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300014150 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300018000 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coex | Environmental | Open in IMG/M |
| 3300018053 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1 | Environmental | Open in IMG/M |
| 3300018054 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1 | Environmental | Open in IMG/M |
| 3300018078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coex | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021968 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c1 | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300023069 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S049-202B-5 | Environmental | Open in IMG/M |
| 3300023078 | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L066-202C-4 | Environmental | Open in IMG/M |
| 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026542 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes) | Environmental | Open in IMG/M |
| 3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300027388 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300028876 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140 | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
| 3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
| 3300031859 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25 | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
| 3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
| 3300032054 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
| 3300032159 | Agave microbial communities from Guanajuato, Mexico - As.Ma.e (v2) | Host-Associated | Open in IMG/M |
| 3300032211 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| 3300034147 | Sediment microbial communities from East River floodplain, Colorado, United States - 44_j17 | Environmental | Open in IMG/M |
| 3300034149 | Sediment microbial communities from East River floodplain, Colorado, United States - 20_j17 | Environmental | Open in IMG/M |
| 3300034151 | Sediment microbial communities from East River floodplain, Colorado, United States - 2_s17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Iowa-Corn-GraphCirc_00115480 | 2140918013 | Soil | MTFDLVALKDEQTAARNARPRRSLDLETESFVRVLPIRWRLLLIAALNATVAV |
| E4A_08455970 | 2170459003 | Grass Soil | MSLDLVALKDEPSATRNARPRRSLDLETESVVRVLPI |
| F24TB_113852022 | 3300000550 | Soil | MSLDLVALKDEPSAARTARPRRSLDQETQSVVRALPIRWRLLLIAALN |
| AP72_2010_repI_A10DRAFT_10543211 | 3300000651 | Forest Soil | MSFDLVALKDERTPSARPRRSLDLETESFVRALPIRWR |
| AP72_2010_repI_A001DRAFT_10753702 | 3300000893 | Forest Soil | MSFDLVALKDERTPSARPRRSLDLETESFVRALPI |
| JGI11615J12901_103573442 | 3300000953 | Soil | MTFDLVALKDEQTAARNARPRRSLDLETESFVRVLPIRWRLLLIAAL |
| JGI11823J13286_10093092 | 3300001164 | Forest Soil | MTFDLVALKDEQTAARNARPRRSLDLETESFVRVLPI |
| SwM_1138192 | 3300001225 | Switchgrass Rhizosphere | MSLDLVALKDEPSTTRNARPRRSLDLETESVVRVLPIRWRLFS |
| Ga0062593_1013814601 | 3300004114 | Soil | VSFDLVAINHELPTAPGARRRSLDLETESFVRALPIRWRLFLLAALNGAVAVILA |
| Ga0062595_1007475392 | 3300004479 | Soil | MSLDLLALKEEQSRTPTARQRRSLDLETQSVVRVLPIRWRL |
| Ga0062595_1014347412 | 3300004479 | Soil | MSLDLLALKEEQSAAPTGRQRRSLDLETQSVVRVLPIRWRLLSI |
| Ga0008092_113479221 | 3300004629 | Tropical Rainforest Soil | MSLDLVALKDEQSATRNARPRRSLDLETESVVRVLPIRWRLFLIAALNASVAFIL |
| Ga0066388_1060941962 | 3300005332 | Tropical Forest Soil | MSFDLVALAQDQPSPPRARARRNLGRETEGFVRVLPIRWRLVSIAALNLIVAFIL |
| Ga0066388_1066605822 | 3300005332 | Tropical Forest Soil | MTLDLLALRDGRTAAARPRRSLDLETEGVVRAVPIRWRLLSLAALNAA |
| Ga0070659_1012252391 | 3300005366 | Corn Rhizosphere | MSLDLLALKEEQSAAPTGRQRRSLDLETQSVVRVLPIRWRLLSIA |
| Ga0070713_1002147103 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MSLDLVALRDEPSSSARSRAGRNFDLGTQSFVRVLPISWRLLAIAALNAAVAAILAL |
| Ga0070713_1004500942 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MSFDLVALKDEPPAARQVRPRRSLDLETESFVRALPIRWRLLSIAALNAT |
| Ga0070694_1017264142 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | MTFDLVALKDEQAAARGARPRRSLDLETESFVRVLPIRWRLLLIAALNATVAVILAT |
| Ga0066689_101741041 | 3300005447 | Soil | MSLDLVALKDEQSATRNARPRRSLDLETESVVRVLPIRWRL |
| Ga0066697_105144191 | 3300005540 | Soil | MSLDLVALKDEPSATRNARPRRSLDLETESVVRVLPIRWRLFSIAALNAAVAFILA |
| Ga0066670_107536052 | 3300005560 | Soil | MSLDLLALKEEQPRAPTARQRRSLDLETQSVVRVLPIRWRLLSIAALNAT |
| Ga0066694_104677931 | 3300005574 | Soil | MSLDLLALKEEQPRAPTARQRRSLDLETQSVVRVL |
| Ga0066903_1068398062 | 3300005764 | Tropical Forest Soil | MSLDLVALKDEPSATRNARPRRSLDLETESVVRVLPIRWRLFSIAAL |
| Ga0066651_100371451 | 3300006031 | Soil | MSLDLLALKEEQPRAPTARQRRSLDLETQSVVRVLPIRWRLLSIAALNATVA |
| Ga0075365_107747681 | 3300006038 | Populus Endosphere | MSFDLVALKDEPAGRTARPRRSLDLETESFVRALPIRWRLLSIAALNATVAV |
| Ga0075364_111611541 | 3300006051 | Populus Endosphere | MSFDLVALKDEPPAARSARPRRSLDLETESFVRVLPIRWRLLSIAALNAT |
| Ga0075369_104664931 | 3300006186 | Populus Endosphere | MTFDLVALKDEQAAARGARPRRSLDLETESFVRVLPIRWRLLLI |
| Ga0075366_107621372 | 3300006195 | Populus Endosphere | MTFDLVALKDEQAAARGARPRRSLDLETESFVRVLPIRWRLL |
| Ga0074057_118967892 | 3300006605 | Soil | MSLDLVALKDEQSAARNARPRRSLDLETESVVRVLPI |
| Ga0066660_114725332 | 3300006800 | Soil | MSLDLLALKEEQPRAPTARQRRSLDLETQSVVRVLPI |
| Ga0075430_1011580862 | 3300006846 | Populus Rhizosphere | MSLDLVALKDEPSVARTARPRRSLDQETQSVVRALPIRWRLLLIAALNATVAVILAAL |
| Ga0075433_101667993 | 3300006852 | Populus Rhizosphere | MSLDLVALKDEPSATRNARPRRSLDLETESVVRVLPIRWRLFSIA |
| Ga0075425_1016347501 | 3300006854 | Populus Rhizosphere | MTFDLVALKDEQAAARGARPRRSLDLETESFVRVLPIRWRLLLIAGLNATVAVIL |
| Ga0068865_1000607775 | 3300006881 | Miscanthus Rhizosphere | MTFDLVALKDEQAAARGARPRRSLDLETESFVRVLPIRWRL |
| Ga0066710_1027206031 | 3300009012 | Grasslands Soil | VSFDLVAINQELPTAPVAQTMRSLDLETESFVRALTLRWRLFLL |
| Ga0105092_106778781 | 3300009157 | Freshwater Sediment | MSFDLVALKDEQPVARSARPRRSLDLETESFVRVLPIRWRLLS |
| Ga0126374_113232732 | 3300009792 | Tropical Forest Soil | MSLDLVALKDEQSATRNARPRRSLDLETESVVRVLPIRWRLFFIAALNAVVAFI |
| Ga0126374_117837751 | 3300009792 | Tropical Forest Soil | MSLDLLALKEQQSAARTARQRRSLDLETQSVVRVLPIRW |
| Ga0126384_104623501 | 3300010046 | Tropical Forest Soil | MSLDLVALKDEQSAARNARPRRSLDLETESVVRVLPIRWRLFSIAALNA |
| Ga0126384_113801271 | 3300010046 | Tropical Forest Soil | MSLDLVALKDEQSATRNARPRRSLDLETESVVRVLPIRWRLFFIAALN |
| Ga0099796_105591562 | 3300010159 | Vadose Zone Soil | MSFDLVALKEERSPSARPRRSLDLETESFVRALPIRWRLLSIAALNATV |
| Ga0126370_103136491 | 3300010358 | Tropical Forest Soil | MSFDLIALKEERTPSARPRRSLDLETESFVRVLPIRWRLISIAALNLIVA |
| Ga0126372_127672192 | 3300010360 | Tropical Forest Soil | MTVDLIALKEQQSAARPVRPRRSLDQETQSVVRTLPIRWRLLLIAALNA |
| Ga0126383_115667721 | 3300010398 | Tropical Forest Soil | MSLDLLALKDEQSAASTARPRRSLDQETQSVVRVLPIRWRLLLIAALNATV |
| Ga0124844_10977891 | 3300010868 | Tropical Forest Soil | MSLDLLALKEEQSAAPTARQRRSLDLETQSVVRVLPIRWRLLSIAALNATVAII |
| Ga0105246_109042981 | 3300011119 | Miscanthus Rhizosphere | MTFDLVALKDEQTAARNARPRRSLDLETESFVRVLPIRWRLLLIA |
| Ga0137388_118068892 | 3300012189 | Vadose Zone Soil | VSFDLVAINHELPTAPSARTRRSLDLETESFVRALPIRWRLFLLAALN |
| Ga0137379_113006231 | 3300012209 | Vadose Zone Soil | VSFDLVAINHELPTAPDARPRRSLDLETESFVRALPIRWRLFLLAALNG |
| Ga0137387_112228481 | 3300012349 | Vadose Zone Soil | MSFDLIALKEESSALPRARPQRSVDLATQTLVRVLPIRWRLFSIAALNATVAV |
| Ga0137371_100651401 | 3300012356 | Vadose Zone Soil | MSLDLVALKDEPSAARTARPRRSLDQETQSVVRALPIRWRL |
| Ga0137384_114919811 | 3300012357 | Vadose Zone Soil | MSLDLVALKDEPSATRNARPRRSLDLETESVVRVLPIRWRLF |
| Ga0137390_104801951 | 3300012363 | Vadose Zone Soil | MSLDLIALKDESATLPRAGPRQSVDLATQTVVRLLPIR |
| Ga0137390_110278792 | 3300012363 | Vadose Zone Soil | MSFDLVALKEESSALPRAGPRRSVDLATQTFVRVLPIRWRLFSIAALNATVAVILALLIC |
| Ga0157285_100445601 | 3300012897 | Soil | MTFDLVALKDEQAAARGARQRRSLDLETESFVRVLPIRWRLLLI |
| Ga0157290_101169281 | 3300012909 | Soil | MTFDLVALKDEQAAARGARPRRSLDLETESFVRVLPIRWRLLLIAALNATVAVIL |
| Ga0126369_119409212 | 3300012971 | Tropical Forest Soil | MSFDLVALKDERTPSARPRRSLDLETESFVRVLPIRWRLFSI |
| Ga0134081_100333713 | 3300014150 | Grasslands Soil | MTVDLIALKEQQSAARPARSRRSLDQETQSVLRVLPIRWRLLLIAALNVVVAS |
| Ga0132257_1020023731 | 3300015373 | Arabidopsis Rhizosphere | MSFDLVALKDGPPAAPSARPRRSLDLETESFVRVLPIRWRL |
| Ga0132255_1048843632 | 3300015374 | Arabidopsis Rhizosphere | MSFDLVALKEERSPSARPRRSLDLETESYVRTLPIRWRLISIAA |
| Ga0182041_101126441 | 3300016294 | Soil | MSFDLIALKDESSVLQRSRPRRSVDLATQTLVRVLPIRWRLFCIA |
| Ga0182039_100646611 | 3300016422 | Soil | MSLDLVALKDEQPAARNARPRRSLDLETESVVRVLPIRWRLFSIAALNAAVAF |
| Ga0187780_111919222 | 3300017973 | Tropical Peatland | MSFDLIALRQEPAALQLARQRRSVDLATQTLVRLLPIRWRLFSIAALN |
| Ga0184604_101249452 | 3300018000 | Groundwater Sediment | MTFDLVALKDEQAAARGARPRRSLDLETESFVRVLPIRWRLLLIAALN |
| Ga0184626_103999061 | 3300018053 | Groundwater Sediment | MNFDLVALKDERAAAPGARPRRSLDLETESVVRVL |
| Ga0184621_102281991 | 3300018054 | Groundwater Sediment | VSFDLVAISHEQQAAPPARPRRSLDIETESFVRALPIRWRL |
| Ga0184612_103378082 | 3300018078 | Groundwater Sediment | VSFDLVAISHEQQAAPPARPRRSLDIETESFVRALPIRWRLPLLALLNLAVAVILA |
| Ga0210406_108916072 | 3300021168 | Soil | MSLDLIALREQPSALPRATRSVDLATQTLVRLLPI |
| Ga0210405_102380782 | 3300021171 | Soil | MSFDLIALKDELSALSRPRRTVDIATQTLLRVLPIRWRLFAIAALNATVAV |
| Ga0193698_10176731 | 3300021968 | Soil | MTFDLVALKDEQAAARSARPRRSLDLETESFVRVLPIRWRLLSIAALNATVAV |
| Ga0222622_102599451 | 3300022756 | Groundwater Sediment | MTFDLVALKNEQAAARSARPRRSLDLETESFVRVLPIRWRLLSIAALNA |
| Ga0247751_10145821 | 3300023069 | Soil | MTFDLVALKDEQTAARNARPRRSLDLETESFVRVLPIRWR |
| Ga0247756_11317291 | 3300023078 | Plant Litter | MTFDLVALKDEQAAARGARPRRSLDLETESFVRVLPIRWRLLLIAAL |
| Ga0207643_102164352 | 3300025908 | Miscanthus Rhizosphere | MTFDLVALKDEQTAARNARPRRSLDLETESFVRVLPIRWRLLLIAALNATVA |
| Ga0207684_109059031 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MSLDLVAFKDEPSATRNARPRRSLDLETESVVRVLPIRWRLF |
| Ga0207671_104747242 | 3300025914 | Corn Rhizosphere | MTFDLVALKDEQAAARGARPRRSLDLETESFVRVLPIRWRLLLIAALNARVQAIVAQLGASRVTAFA |
| Ga0207644_111873252 | 3300025931 | Switchgrass Rhizosphere | MTFDLVALKDEQTAARNARPRRSLDLETESFVRVLPIR |
| Ga0207690_106797351 | 3300025932 | Corn Rhizosphere | MTFDLVALKDEQTAARNARPRRSLDLETESFVRVLPIRWRLLLIAALDATVAVIL |
| Ga0207690_110577822 | 3300025932 | Corn Rhizosphere | MSLDLLALKEEQSAAPTGRQRRSLDLETQSVVRVLPIRWRLLSIAALNA |
| Ga0207689_117425983 | 3300025942 | Miscanthus Rhizosphere | MSLDLLALKEEQSAAPTGRQRRSLDLETQSVVRVLPIRWRLLSIAALNATVAIILAALI |
| Ga0207677_100471471 | 3300026023 | Miscanthus Rhizosphere | MTFDLVALKDEQAAARGARPRRSLDLETESFVRVLPIRWRLLLIAALNA |
| Ga0207676_114689592 | 3300026095 | Switchgrass Rhizosphere | MTFDLVALKDEQTAARNARPRRSLDLETESFVRVLPIRWRLLLIAALNA |
| Ga0209805_10422883 | 3300026542 | Soil | MTVDLVALKEQESAARPARSRRSLDQETQSVLRVLPIRWRLLLIAALNVVVAS |
| Ga0209156_103412742 | 3300026547 | Soil | MNLDLLTLKHKGSAATGARPRRSLDLETEGFIRALPIRWRVLLIAALNATVAVILA |
| Ga0209577_107836851 | 3300026552 | Soil | MSLDLVALKDEPSATRNARPRRSLDLETESVVRVLPIRWRLFSIAALNAA |
| Ga0208995_10556261 | 3300027388 | Forest Soil | MSFDLVALKEERSPSARPRRSLDLETESFVRALPIRWRLLSIAA |
| Ga0209283_102468521 | 3300027875 | Vadose Zone Soil | MSFDLVAFEEERAPHARPRRSLDLETESVVRVLPIRWRLLSI |
| Ga0209382_100808301 | 3300027909 | Populus Rhizosphere | MSLDLVALKDEPSVARTARPRRSLDQETQSVVRALP |
| Ga0268264_111568721 | 3300028381 | Switchgrass Rhizosphere | MSLDLVALRDEPSSSARSRAGRNFDLGTQSFVRVLPISWRLLAIAALNAAVAAILALIIW |
| Ga0307302_106306081 | 3300028814 | Soil | VSFDLVAINHELPAAPGARTRRSLDLETESFVRALPIR |
| Ga0307312_101271871 | 3300028828 | Soil | MSLDLLALKEQQPTAPTARQRRRLDLETQSFVRVLPIRWRLFSIAALNATVAI |
| Ga0307286_100906351 | 3300028876 | Soil | MSFDLVALKEERSPSARPRRSLDLETESFVRALPIRWRLFLLAALNGAVAVI |
| Ga0318516_107129701 | 3300031543 | Soil | MSLDLLALKNEQSAASTTRPRRSLDQETQSVVRVLPIRWR |
| Ga0318528_105640072 | 3300031561 | Soil | MSLDLIALREQPSALPRATRSVDLATQTLVRLLPIRWRLFSIAALNATVAIVLA |
| Ga0318542_106279711 | 3300031668 | Soil | MSLDLLALKNEQSAASTTRPRRSLDQETQSVVRVLPIRWRLLL |
| Ga0318496_100230884 | 3300031713 | Soil | MSLDLVALKDEQSAARTARPRRSLDLETESFVRVL |
| Ga0306917_107583741 | 3300031719 | Soil | MSLDLIALREQPSALPRATRSVDLATQTLVRLLPIRWRLFSIAALNATVAIILA |
| Ga0307469_121210051 | 3300031720 | Hardwood Forest Soil | MSFDLVAFEEERAPHARPRRSLDLETESVVRVLPIRWRLLSIAALNATVAVIL |
| Ga0318493_108134212 | 3300031723 | Soil | MSFDLIALKEEASALTRASPRRSVDLATQTLVRVLPIRWRLFC |
| Ga0318500_100428933 | 3300031724 | Soil | MSLDLVALKDEQPAARNARPRRSLDLETESVVRVLPIRWRLFSIAALN |
| Ga0306918_101168083 | 3300031744 | Soil | MSLDLVALKDEQSATRNARPRRSLDLETESVVRVL |
| Ga0318494_108121102 | 3300031751 | Soil | MSFDLVALKDGPPAAPSARPRRSLDLETESFVRVLPIR |
| Ga0318535_104646672 | 3300031764 | Soil | MSLDLLALKNEQSAASTTRPRRSLDQETQSVVRVLPIRWRLLLIAALNATVAIIL |
| Ga0318509_106048712 | 3300031768 | Soil | MSLDLVALKDEQSATRNARPRRSLDLETESVVRVLPIRWRLFLIAALNASVAFILAAFIW |
| Ga0318566_101435981 | 3300031779 | Soil | MSLDLVALKDEQSATRNARPRRSLDLETESVVRVLPIRWRLLFIA |
| Ga0318547_109014631 | 3300031781 | Soil | MSFDLIALRQEPAALQLARQRRSVDLATQTLVRLLPIRWRLFSIAALNATV |
| Ga0318576_105113102 | 3300031796 | Soil | MSLDLVALKDEQSAARTARPRRSLDLETESFVRVLPIRWRLFSIAALNAAVAFIL |
| Ga0318511_104746312 | 3300031845 | Soil | MSLDLVALKDEQSATRNARPRRSLDLETESVVRVLPIRWRLFLIAALNA |
| Ga0318527_105127081 | 3300031859 | Soil | MSLDLVALKDEQSAARTARPRRSLDLETESFVRVLPIRWR |
| Ga0318551_102087981 | 3300031896 | Soil | MSFDLIALKDESSVLQRSRPRRSVDLATQTLVRVLPIRWRLFCIAALNATVAVILALLIW |
| Ga0310913_105427482 | 3300031945 | Soil | MSFDLIALKEEASALTRASPRRSVDLATQTLVRVLPIRWRLFCIAALNATVAVILAL |
| Ga0310909_111357883 | 3300031947 | Soil | MSFDLIALRQEPAALQLARQRRSVDLATQTLVRLLPIRWRL |
| Ga0318507_100251561 | 3300032025 | Soil | MSFDLIALKDESSVLQRSRPRRSVDLATQTLVRVLPIRWRLFCIAALNATVAV |
| Ga0318558_100745593 | 3300032044 | Soil | MSFDLIALKDESSVLQRSRPRRSVDLATQTLVRVLPIRWRLFCIAALN |
| Ga0318570_101100131 | 3300032054 | Soil | MSFDLIALRQEPAALQLARQRRSVDLATQTLVRLLPIRWRLFSIAALNA |
| Ga0318533_103987471 | 3300032059 | Soil | MSLDLVALKDEQSAARTARPRRSLDLETESFVRVLPIRWRLFSIAALNAAVAFILAAF |
| Ga0318513_100816791 | 3300032065 | Soil | MSLDLVALKDEQPAARNARPRRSLDLETESVVRVLPI |
| Ga0318513_103461011 | 3300032065 | Soil | MSFDLIALRQEPAALQLARQRRSVDLATQTLVRLLPIRWRLFSIAALNATVAVILAL |
| Ga0306924_1000549513 | 3300032076 | Soil | MSFDLIALKEEASALTRASPRRSVDLATQTLVRVLPIRWRLFCIAALNATVA |
| Ga0306924_110709671 | 3300032076 | Soil | MSLDLVALKDEQSAARNARPRRSLDLETESFVRVLPIRWRLFSIAALNA |
| Ga0306924_114128732 | 3300032076 | Soil | MSLDLIALREQPSALPRATRSVDLATQTLVRLLPIRWRL |
| Ga0318525_100047837 | 3300032089 | Soil | MSLDLVALKDEQSATRNARPRRSLDLETESAVRVLPIRWRLFLIAALNA |
| Ga0318525_102148602 | 3300032089 | Soil | MSLDLVALKDEQSATRNARPRRSLDLETESVVRVLPIRWRLFF |
| Ga0268251_103387491 | 3300032159 | Agave | MSFDLVALKDEPPAARQVRPRRSLDLETESFVRAL |
| Ga0310896_107735641 | 3300032211 | Soil | MTFDLVALKDEQAAARGARPRRSLDLETESFVRVLPIRWRLLLIAALNAT |
| Ga0306920_1020136341 | 3300032261 | Soil | MSLDLVALKDEQSAARTARPRRSLDLETESFVRVLPIRWRLFSIAALNAA |
| Ga0306920_1036559581 | 3300032261 | Soil | MSFDLIALRQEPAALQLARQRRSVDLATQTLVRLLPIRWRLFSIAALNAT |
| Ga0335076_116234362 | 3300032955 | Soil | MSFDLVALKDESSVLQRSRPRRSVDLATQTLVRVLPIRWRLFCIAALNATVAVILALLIW |
| Ga0310914_100063551 | 3300033289 | Soil | MSLDLVALKDEQSATRNARPRRSLDLETESVVRVLPIRWRLFLIAALNASV |
| Ga0318519_101875301 | 3300033290 | Soil | MSLDLVALKDEQSATRNARPRRSLDLETESVVRVLPIRWRLFLIA |
| Ga0364925_0150708_3_149 | 3300034147 | Sediment | MSFDLIALKDEASALPRARPRRSVDLATQALVRGLPIRWRLFSIAALNA |
| Ga0364929_0113894_2_142 | 3300034149 | Sediment | MSFDLIALKDEASALPRARPRRSVDLATQALVRGLPIRWRLFSIAAL |
| Ga0364935_0008312_1_153 | 3300034151 | Sediment | MTFDLVALKDEQAAARGARPRRSLDLETESFVRVLPIRWRLLLIAALNATV |
| ⦗Top⦘ |