


| Basic Information | |
|---|---|
| Family ID | F061046 |
| Family Type | Metagenome |
| Number of Sequences | 132 |
| Average Sequence Length | 41 residues |
| Representative Sequence | GKPTGQGFGAARKGPSVVGKPHDVVVDEDYQQGKSFKVED |
| Number of Associated Samples | 95 |
| Number of Associated Scaffolds | 132 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 95.45 % |
| Associated GOLD sequencing projects | 76 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.13 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (91.667 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (44.697 % of family members) |
| Environment Ontology (ENVO) | Unclassified (88.636 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (83.333 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 0.00% Coil/Unstructured: 100.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.13 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 132 Family Scaffolds |
|---|---|---|
| PF01464 | SLT | 6.82 |
| PF01476 | LysM | 4.55 |
| PF12694 | cpYpsA | 0.76 |
| PF13759 | 2OG-FeII_Oxy_5 | 0.76 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 91.67 % |
| All Organisms | root | All Organisms | 8.33 % |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 44.70% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 15.15% |
| Deep Ocean | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean | 6.06% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 6.06% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 4.55% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 3.79% |
| Deep Subsurface | Environmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface | 3.03% |
| Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 2.27% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 2.27% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 1.52% |
| Sea-Ice Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sea-Ice Brine | 1.52% |
| Filtered Seawater | Environmental → Aquatic → Marine → Unclassified → Unclassified → Filtered Seawater | 1.52% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 0.76% |
| Microbial Mat | Environmental → Aquatic → Marine → Coastal → Sediment → Microbial Mat | 0.76% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.76% |
| Sackhole Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine | 0.76% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 0.76% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 0.76% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 0.76% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 0.76% |
| Marine Sediment | Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment | 0.76% |
| Macroalgal Surface | Host-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface | 0.76% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000101 | Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010 | Environmental | Open in IMG/M |
| 3300000115 | Marine microbial communities from Delaware Coast, sample from Delaware MO Summer July 2011 | Environmental | Open in IMG/M |
| 3300000116 | Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010 | Environmental | Open in IMG/M |
| 3300000973 | Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY93 | Host-Associated | Open in IMG/M |
| 3300001450 | Marine viral communities from the Pacific Ocean - LP-53 | Environmental | Open in IMG/M |
| 3300001963 | Marine microbial communities from Nags Head, North Carolina, USA - GS013 | Environmental | Open in IMG/M |
| 3300002231 | Marine sediment microbial communities from Santorini caldera mats, Greece - red mat | Environmental | Open in IMG/M |
| 3300002484 | Marine viral communities from the Pacific Ocean - ETNP_2_130 | Environmental | Open in IMG/M |
| 3300002511 | Marine viral communities from the Pacific Ocean - ETNP_2_1000 | Environmental | Open in IMG/M |
| 3300002514 | Marine viral communities from the Pacific Ocean - ETNP_6_85 | Environmental | Open in IMG/M |
| 3300005595 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306PF47B | Environmental | Open in IMG/M |
| 3300006190 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG058-DNA | Environmental | Open in IMG/M |
| 3300006191 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG104-DNA | Environmental | Open in IMG/M |
| 3300006737 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG | Environmental | Open in IMG/M |
| 3300006738 | Marine viral communities from the Subarctic Pacific Ocean - 3_ETSP_OMZ_AT15126 metaG | Environmental | Open in IMG/M |
| 3300006750 | Marine viral communities from the Subarctic Pacific Ocean - 19_ETSP_OMZ_AT15317 metaG | Environmental | Open in IMG/M |
| 3300006753 | Marine viral communities from the Subarctic Pacific Ocean - 6_ETSP_OMZ_AT15160 metaG | Environmental | Open in IMG/M |
| 3300006754 | Marine viral communities from the Subarctic Pacific Ocean - 10_ETSP_OMZ_AT15264 metaG | Environmental | Open in IMG/M |
| 3300006810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 | Environmental | Open in IMG/M |
| 3300006916 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 | Environmental | Open in IMG/M |
| 3300006919 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 | Environmental | Open in IMG/M |
| 3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
| 3300006922 | Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaG | Environmental | Open in IMG/M |
| 3300006925 | Marine viral communities from the Subarctic Pacific Ocean - 14_ETSP_OMZ_AT15311 metaG | Environmental | Open in IMG/M |
| 3300006927 | Marine viral communities from the Subarctic Pacific Ocean - 2_ETSP_OMZ_AT15125 metaG | Environmental | Open in IMG/M |
| 3300006928 | Marine viral communities from the Subarctic Pacific Ocean - 8_ETSP_OMZ_AT15162 metaG | Environmental | Open in IMG/M |
| 3300006929 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG | Environmental | Open in IMG/M |
| 3300007276 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 | Environmental | Open in IMG/M |
| 3300007345 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 | Environmental | Open in IMG/M |
| 3300007346 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 | Environmental | Open in IMG/M |
| 3300007540 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300008012 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300008050 | Marine viral communities from the Subarctic Pacific Ocean - 15_ETSP_OMZ_AT15312 metaG | Environmental | Open in IMG/M |
| 3300008216 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_Geostar | Environmental | Open in IMG/M |
| 3300008218 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s6 | Environmental | Open in IMG/M |
| 3300008219 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_b05 | Environmental | Open in IMG/M |
| 3300008221 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_66 | Environmental | Open in IMG/M |
| 3300009149 | Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG | Environmental | Open in IMG/M |
| 3300009173 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_134 | Environmental | Open in IMG/M |
| 3300009481 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV12_ACTIVE470 metaG | Environmental | Open in IMG/M |
| 3300010155 | Marine viral communities from the Subarctic Pacific Ocean - 12_ETSP_OMZ_AT15267 metaG | Environmental | Open in IMG/M |
| 3300011258 | Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_1, permeate | Environmental | Open in IMG/M |
| 3300017697 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_DNA (version 2) | Environmental | Open in IMG/M |
| 3300017708 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_04 viral metaG | Environmental | Open in IMG/M |
| 3300017717 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 27 SPOT_SRF_2011-10-25 | Environmental | Open in IMG/M |
| 3300017733 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 49 SPOT_SRF_2013-12-23 | Environmental | Open in IMG/M |
| 3300017773 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 9 SPOT_SRF_2010-03-24 | Environmental | Open in IMG/M |
| 3300017967 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071411BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300020464 | Marine microbial communities from Tara Oceans - TARA_B100000530 (ERX556075-ERR599101) | Environmental | Open in IMG/M |
| 3300024262 | Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300024344 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV12_ACTIVE470 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300024518 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_2 | Environmental | Open in IMG/M |
| 3300024520 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_1 | Environmental | Open in IMG/M |
| 3300025072 | Marine viral communities from the Subarctic Pacific Ocean - 19_ETSP_OMZ_AT15317 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025078 | Marine viral communities from the Subarctic Pacific Ocean - 18_ETSP_OMZAT15316 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025079 | Marine viral communities from the Pacific Ocean - LP-48 (SPAdes) | Environmental | Open in IMG/M |
| 3300025082 | Marine viral communities from the Subarctic Pacific Ocean - 1_ETSP_OMZ_AT15124 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025086 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025097 | Marine viral communities from the Subarctic Pacific Ocean - 2_ETSP_OMZ_AT15125 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025109 | Marine viral communities from the Subarctic Pacific Ocean - 6_ETSP_OMZ_AT15160 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025112 | Marine viral communities from the Pacific Ocean - ETNP_2_130 (SPAdes) | Environmental | Open in IMG/M |
| 3300025114 | Marine viral communities from the Subarctic Pacific Ocean - 3_ETSP_OMZ_AT15126 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025118 | Marine viral communities from the Subarctic Pacific Ocean - 10_ETSP_OMZ_AT15264 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025120 | Marine viral communities from the Pacific Ocean - LP-28 (SPAdes) | Environmental | Open in IMG/M |
| 3300025125 | Marine viral communities from the Pacific Ocean - ETNP_2_1000 (SPAdes) | Environmental | Open in IMG/M |
| 3300025127 | Marine viral communities from the Pacific Ocean - ETNP_2_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300025131 | Marine viral communities from the Pacific Ocean - ETNP_6_100 (SPAdes) | Environmental | Open in IMG/M |
| 3300025133 | Marine viral communities from the Subarctic Pacific Ocean - 15_ETSP_OMZ_AT15312 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025141 | Marine viral communities from the Pacific Ocean - ETNP_6_85 (SPAdes) | Environmental | Open in IMG/M |
| 3300025168 | Marine viral communities from the Pacific Ocean - LP-53 (SPAdes) | Environmental | Open in IMG/M |
| 3300025251 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_906 (SPAdes) | Environmental | Open in IMG/M |
| 3300025260 | Marine viral communities from the Deep Pacific Ocean - MSP112 (SPAdes) | Environmental | Open in IMG/M |
| 3300025276 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_55 (SPAdes) | Environmental | Open in IMG/M |
| 3300025305 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_b05 (SPAdes) | Environmental | Open in IMG/M |
| 3300025645 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (SPAdes) | Environmental | Open in IMG/M |
| 3300025652 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (SPAdes) | Environmental | Open in IMG/M |
| 3300025769 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (SPAdes) | Environmental | Open in IMG/M |
| 3300025806 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025822 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110414 (SPAdes) | Environmental | Open in IMG/M |
| 3300025853 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (SPAdes) | Environmental | Open in IMG/M |
| 3300025873 | Marine viral communities from the Pacific Ocean - ETNP_6_1000 (SPAdes) | Environmental | Open in IMG/M |
| 3300027522 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG058-DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027752 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154 (SPAdes) | Environmental | Open in IMG/M |
| 3300027791 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130 (SPAdes) | Environmental | Open in IMG/M |
| 3300027856 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_23 | Environmental | Open in IMG/M |
| 3300028018 | Seawater viral communities from deep brine pools at the bottom of the Mediterranean Sea - LS1 1600m | Environmental | Open in IMG/M |
| 3300029319 | Marine viral communities collected during Tara Oceans survey from station TARA_032 - TARA_A100001516 | Environmental | Open in IMG/M |
| 3300029448 | Marine viral communities collected during Tara Oceans survey from station TARA_023 - TARA_E500000082 | Environmental | Open in IMG/M |
| 3300031519 | Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2 | Environmental | Open in IMG/M |
| 3300031626 | Marine microbial communities from Western Arctic Ocean, Canada - CB21_surface | Environmental | Open in IMG/M |
| 3300031802 | Marine microbial communities from Western Arctic Ocean, Canada - CB6_AW_1057 | Environmental | Open in IMG/M |
| 3300032277 | Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 3-month pyrrhotite | Environmental | Open in IMG/M |
| 3300033742 | Sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - 2018 seawater | Environmental | Open in IMG/M |
| 3300034654 | Seawater viral communities from Mid-Atlantic Ridge, Atlantic Ocean - 487_2244 | Environmental | Open in IMG/M |
| 3300034656 | Seawater viral communities from Mid-Atlantic Ridge, Atlantic Ocean - 502_2477 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSum2010_100831432 | 3300000101 | Marine | GAARKGPSVTGKESDVVVEEDYSQGKSFKVSIGE* |
| DelMOSum2011_100548564 | 3300000115 | Marine | GQGFGAARKGPSVTGKAKDAVVDEDYQQGKSFDVED* |
| DelMOSum2011_100608333 | 3300000115 | Marine | YGAARKGPSVTGKESDVVVEEDYSQGKSFKVSIGE* |
| DelMOSum2011_100652882 | 3300000115 | Marine | LGRPTGQGYGAARKGPSVTGKESDVVVEEDYSQGKSFKVSIGD* |
| DelMOSum2011_100710992 | 3300000115 | Marine | GRPTGQGYGAARKGPSVTGKESDVVVEEDYSQGKSFKVSIGD* |
| DelMOSum2011_101161104 | 3300000115 | Marine | GQGFGAARKGPSVTGKAKDAVVDEDYQQGKSFDVDG* |
| DelMOSum2011_101596301 | 3300000115 | Marine | QGYGAARKGPSVTGKQSDVVVEEDYSQGKSFKVSIGE* |
| DelMOSpr2010_101585211 | 3300000116 | Marine | IVGKPTGQGFGAARKGPSVTGKAKDAVVDEDYQQGKSFEIEG* |
| BBAY93_100959162 | 3300000973 | Macroalgal Surface | DLDEIVGRPTGQGYGAARKGPQVKGPPQDVVVDEDYTQGKTFKVED* |
| JGI24006J15134_100698521 | 3300001450 | Marine | QGFGAARKGPSVTGKAKDAVVDEDYQQGKSFDVKD* |
| JGI24006J15134_101056422 | 3300001450 | Marine | GYGAARKGPSVTGKESDVVVEEDYSQGKSFKVSIGE* |
| JGI24006J15134_101892133 | 3300001450 | Marine | TGQGFGAARKGPSVTGKAKDAVVDEDYQQGKSFDVDG* |
| GOS2229_10324505 | 3300001963 | Marine | R*IVGRPTGQGFGAARKGPAVKGPPQDVVVDEDYEQGKAFKVED* |
| KVRMV2_1011925837 | 3300002231 | Marine Sediment | GFGAARKGPAVKGKAQDVVVDEDYQQGKTFKVEG* |
| JGI25129J35166_10652712 | 3300002484 | Marine | VGKPTGQGYGAARKGPDVQGPPEDVVVDEDYQTGKSFKVED* |
| JGI25129J35166_10735322 | 3300002484 | Marine | IVGKPTGQGYGAARKGPDVKGPPQDVVVDEDYQQGKAFKIED* |
| JGI25129J35166_10788892 | 3300002484 | Marine | KPTGQGFGAARKGPSVVGKPHDVVVDEDYQQGKSFKVED* |
| JGI25131J35506_10166862 | 3300002511 | Marine | MGRPTGQGFRTARKGPSVKGPPQDVVVDEDYQQGKSFKVEA* |
| JGI25131J35506_10469492 | 3300002511 | Marine | HNLDNLVGRPTGQGYGAARKGPDVKGPPQDVVVDEDYQQGKSFKVED* |
| JGI25133J35611_101991731 | 3300002514 | Marine | TGQGFGAARKGPSVVGKPQDVVVDEDYEQGKAFKVSIGG* |
| Ga0066833_102104941 | 3300005595 | Marine | GKPTGQGFGAARKGPSVVGKPHDVVVDEDYQQGKSFKVED* |
| Ga0075446_100411991 | 3300006190 | Marine | GKPTGQGFGAARKGPSVVGKAKDAVVDEDYQQGKSFEVEG* |
| Ga0075447_101298822 | 3300006191 | Marine | IPLNDIVGKPTGQGFGAARKGPSVVGKAKDAVVDEDYQQGKSFEVEG* |
| Ga0098037_10469345 | 3300006737 | Marine | PLDQIVGKPTGQGFGAARKGPSVTGKPQDVVVEEDYEKGKGFKVED* |
| Ga0098037_12053691 | 3300006737 | Marine | GRPTGQGYGAARKGPDVKGPPQDVVVDEDYTQGKAFKVEN* |
| Ga0098035_11012831 | 3300006738 | Marine | PTGQGYGAAKKGPEVVGSPQDVVVDEDYQQGKSFKVED* |
| Ga0098035_11565101 | 3300006738 | Marine | LGKPTGQGFGAARKGPSVVGKPHDVVVDEDYQQGKSFKVED* |
| Ga0098058_10519201 | 3300006750 | Marine | KEILGKPTGQGFGAARKGPSVVGKPHDVVVDEDYQQGKSFKVED* |
| Ga0098039_10642972 | 3300006753 | Marine | KPTGQGFGTARKGPSVVGKPHDVVVDEDYQQGKSFKVED* |
| Ga0098039_11971601 | 3300006753 | Marine | PTGQGFGAARKGPSIVGKPQDVVVDEDYQQGKSFKVED* |
| Ga0098044_11631141 | 3300006754 | Marine | EIVGRPTGQGYGAARKGPDVKGPPQDVVVDEDYQQGKSFKIED* |
| Ga0098044_12786532 | 3300006754 | Marine | NKILGKPTGQGYGAARKGPDVQGPPEDVVVDEDYQQGKSFKVED* |
| Ga0070754_101168061 | 3300006810 | Aqueous | PTGQGYGAARKGPSVTGKQSDVVVEEDYSQGKSFKVSIGE* |
| Ga0070754_101607671 | 3300006810 | Aqueous | PTGQGFGAARKGPSVTGKAKDAVVDEDYQQGKSFEIEG* |
| Ga0070754_102387522 | 3300006810 | Aqueous | RPTGQGYGAARKGPSVTGKESDVVVEEDYSQGKSFKVSIGE* |
| Ga0070750_100937092 | 3300006916 | Aqueous | PTGQGYGAARKGPSVTGKESDVVVEEDYSQGKSFKVSIGE* |
| Ga0070750_102346472 | 3300006916 | Aqueous | GQGYGAARKGPSVTGKESDVVVEEDYSQGKSFKVSIGE* |
| Ga0070750_102760511 | 3300006916 | Aqueous | GQGYGAARKGPQVKGPPQDVVVDGDYEQGKAFKVED* |
| Ga0070746_100557196 | 3300006919 | Aqueous | PLNDIVGKPTGQGFGAARKGPSVTGKAKDAVVDEDYQQGKSFDVED* |
| Ga0070748_10569414 | 3300006920 | Aqueous | GKPTGQGFGAARKGPSVTGKAKDAVVDEDYQQGKSFDVED* |
| Ga0070748_11112143 | 3300006920 | Aqueous | NDIVGKPTGQGFGAARKGPSVTGKAKDAVVDEDYQQGKSFEIEG* |
| Ga0098045_10815341 | 3300006922 | Marine | GQGYGAARKGPAVKGPPKDVVVDEDYEQGKAFKVED* |
| Ga0098050_10857872 | 3300006925 | Marine | VLGRPTGQGYGAARKGPSVVGQPKNVVVSEEYEQGKSFKVSIGE* |
| Ga0098034_11924811 | 3300006927 | Marine | GQGFGAARKGPSIVGKPQDVVVDEDYQQGKSFKVED* |
| Ga0098041_11756211 | 3300006928 | Marine | TGQGYGAARKGPDVKGPPQDVVVDEDYEQGKAFKVED* |
| Ga0098036_11028503 | 3300006929 | Marine | GFGAARKGPSVKGPPQDVVVDDDYEQGKAFKVEN* |
| Ga0070747_10974981 | 3300007276 | Aqueous | GAARKGPSVVGQPKNVVVSEEYQQGKSFKVSVGE* |
| Ga0070747_12942701 | 3300007276 | Aqueous | PLNDIVGKPTGQGFGAARKGPSVTGKAKDAVVDEDYQQEKSFKVKD* |
| Ga0070752_11108551 | 3300007345 | Aqueous | QGYGAARKGPSVTGKESDVVVEEDYSQGKSFKVSIGE* |
| Ga0070753_11322271 | 3300007346 | Aqueous | NKIVGRPTGQGYGAARKGPQVMGPPQDVVVDEDYNEGKAFKVEG* |
| Ga0099847_11314371 | 3300007540 | Aqueous | LDEVLGRPTGQGYGAARKGPSVTGKQSDVVVEEDYSQGKSFKVSIGE* |
| Ga0075480_100942634 | 3300008012 | Aqueous | TGQGFGAARKGPSVTGKAKDAVVDEDYQQGKSFDVED* |
| Ga0098052_13813841 | 3300008050 | Marine | KVLGRPTGQGYGAARKGPSVTGKESNVVVDEDYSESKSFKVSIGD* |
| Ga0114898_11692801 | 3300008216 | Deep Ocean | DDLVGRPTGQGYGAARKGPDVKGPPQDVVVDEDYQQGNAFKVEA* |
| Ga0114904_11566061 | 3300008218 | Deep Ocean | TGQGYGAARKGPDVKGPPKDVVVDEDYKEGKTFKIEE* |
| Ga0114905_11528534 | 3300008219 | Deep Ocean | YGAARKGPNVIGPETDVVVDEEYSQPKPFKVEKGG* |
| Ga0114916_10968731 | 3300008221 | Deep Ocean | LDEIVGRPTGQGYGAARKGPQVQGPPQNVVVDEDYQQGKAFRVED* |
| Ga0114918_101167353 | 3300009149 | Deep Subsurface | TGQGYGAARKGPSVTGKQSDVVVEEDYSQGKSFKVSIGD* |
| Ga0114918_102982161 | 3300009149 | Deep Subsurface | RPTGQGYGAARKGPQVQGPPQDVVVDEDYEQGKSFKVED* |
| Ga0114996_105105271 | 3300009173 | Marine | RPTGQGFGAARKGPSVKGPPQDVVVDEDYQQGKAFKIED* |
| Ga0114932_100397081 | 3300009481 | Deep Subsurface | DEIVGRPTGQGYGAARKGPQVQGPPQDVVVDEDYEQGKAFKIED* |
| Ga0114932_102453111 | 3300009481 | Deep Subsurface | GKPTGQGYGAARKGPDVKGPPQDVIVDEDYEQGKSFKVED* |
| Ga0114932_105268251 | 3300009481 | Deep Subsurface | KIVGKPTGQGFGAARKGPSVKGKPQDVVVEEDYQQGKGFKVEG* |
| Ga0098047_101409261 | 3300010155 | Marine | KLKEILGKPTGQGFGAARKGPSVVGKPHDVVVDEDYQQGKSFKVED* |
| Ga0151677_10516172 | 3300011258 | Marine | GRPTGQGFGAARKGPAVKGPPKDVVVDEDYEQGKAFKVED* |
| Ga0180120_101187802 | 3300017697 | Freshwater To Marine Saline Gradient | GQGYGAARKGPSVTGKQSDVVVEEDYSQGKSFKVSIGE |
| Ga0180120_101557202 | 3300017697 | Freshwater To Marine Saline Gradient | NDIVGKPTGQGFGAARKGPSVTGKAKDAVVDEDYQQGKSFEIEG |
| Ga0181369_11272042 | 3300017708 | Marine | DEVLGRPTGQGYGAARKGPSVVGQPKNVVVSEEYEQGKSFKVSIGE |
| Ga0181404_10915622 | 3300017717 | Seawater | DKVLGRPTGQGYGAARKGPSVTGKESDVVVEEDYSQGKSFKVSIGD |
| Ga0181426_11070581 | 3300017733 | Seawater | EGYGAARKGPDVKGPPQDVVVDEDYTQGKSFKVES |
| Ga0181386_11020334 | 3300017773 | Seawater | SIPLDEIVGKPTGQGFGAARKGPSVKGPPQDVVVDDDYEQGKAFKVE |
| Ga0181590_109460301 | 3300017967 | Salt Marsh | RPTGQGYGAARKGPDVKGKPQDVVVDEDYTQGKAFKVES |
| Ga0211694_100854304 | 3300020464 | Marine | TGQGYGAARKGPNVLGPETNVVVDEVYSQPEPFKTEK |
| Ga0210003_13089482 | 3300024262 | Deep Subsurface | KPTGQGFGAARKGPSVVGKAKDAVVDEDYQQGKSFEVEG |
| Ga0209992_100549967 | 3300024344 | Deep Subsurface | GKPTGQGFGAARKGPSVTGKPQDVVVEEDYQQGKGFKVED |
| (restricted) Ga0255048_105514831 | 3300024518 | Seawater | LNDIVGKPTGQGFGAARKGPSVTGKAKDAVVDEDYQQGKSFKVED |
| (restricted) Ga0255047_102570752 | 3300024520 | Seawater | KLDKIVGRPTGQGFGAARKGPSVKGPPEDVVVTEDYQQGKAFRVED |
| (restricted) Ga0255047_102827791 | 3300024520 | Seawater | DAIVGRPTGQGYGAARKGPNVLGPETNVVVDEDYSQPEPFKTEK |
| (restricted) Ga0255047_103737582 | 3300024520 | Seawater | GKPTGQGFGAARKGPSVTGKAKDAVVDEDYQQGKSFKVED |
| Ga0208920_10327931 | 3300025072 | Marine | TGQGYGAAKKGPEVVGSPQDVVVDEDYQQGKSFKVED |
| Ga0208668_10161551 | 3300025078 | Marine | GQGFGAARKGPSVVGKPHDVVVDEDYQQGKSFKVED |
| Ga0207890_10576131 | 3300025079 | Marine | GFGAARKGPSVKGKPQDVVVEEDYQQGKSFKVEGQ |
| Ga0207890_10589271 | 3300025079 | Marine | RPTGQGYGAARKGPQVMGPPQNVVVDEDYEQGKAFKVED |
| Ga0208156_10191253 | 3300025082 | Marine | AKLKEILGKPTGQGFGAARKGPSVVGKPHDVVVDEDYQQGKSFKVED |
| Ga0208157_10697071 | 3300025086 | Marine | PLDQIVGKPTGQGFGAARKGPSVTGKPQDVVVEEDYEKGKGFKVED |
| Ga0208010_11176881 | 3300025097 | Marine | PTGQGYGAAKKGPEVVGSPQDVVVDEDYQQGKSFKVED |
| Ga0208553_10326111 | 3300025109 | Marine | KPTGQGFGTARKGPSVVGKPHDVVVDEDYQQGKSFKVED |
| Ga0209349_10747691 | 3300025112 | Marine | NLDEIVGRPTGQGYGAARKGPDVKGPPQDVVVDEDYVSGTAFKVED |
| Ga0209349_11932042 | 3300025112 | Marine | TGQGFGAARKGPSVVGKPHDVVVDEDYQQGKSFKVED |
| Ga0208433_10691142 | 3300025114 | Marine | EILGKPTGQGFGAARKGPSVVGKPHDVVVDEDYQQGKSFKVED |
| Ga0208790_10736282 | 3300025118 | Marine | KPTGQGYGAAKKGPEVVGSPQDVVVDEDYQQGKSFKVED |
| Ga0209535_10932281 | 3300025120 | Marine | RPTGQGYGAARKGPSVTGKESDVVVEEDYSQGKSFKVSIGE |
| Ga0209535_12032802 | 3300025120 | Marine | EVLGRPTGQGYGAARKGPSVTGKESDVVVEEDYSQGKSFKVSIGE |
| Ga0209644_10027491 | 3300025125 | Marine | TGQGYGAARKGPDVQGPPEDVVVDEDYQQGKSFKVED |
| Ga0209644_10146163 | 3300025125 | Marine | PTGQGYGAARKGPDVQGPPEDVVVDEDYQTGKSFKVED |
| Ga0209644_10179912 | 3300025125 | Marine | EILGKPTGQGYGAARKGPDVKGPPQDVVVDEDYKSISGKAFKIED |
| Ga0209348_11837941 | 3300025127 | Marine | RPTGQGYGAARKGPDVKGPPQDVVVDEDYTQGKSFKVES |
| Ga0209128_12122842 | 3300025131 | Marine | GQGFGAARKGPSIVGKPQDVVVDEDYQQGKSFKVED |
| Ga0208299_10679221 | 3300025133 | Marine | GRPTGQGYGAARKGPDVKGPPQDVVVDEDYVSGTAFKVED |
| Ga0209756_11810782 | 3300025141 | Marine | PTGQGYGAARKGPDVQGPPEDVVVDEDYEQGKSFKVED |
| Ga0209756_11878422 | 3300025141 | Marine | GFGAARKGPSVQGQPKNIVVDESYSQGKSFKVSIGE |
| Ga0209337_10397211 | 3300025168 | Marine | NDIVGKPTGQGFGAARKGPSVTGKAKDAVVDEDYQQGKSFDVEG |
| Ga0209337_11048823 | 3300025168 | Marine | NDIVGKPTGQGFGAARKGPSVTGKAKDAVVDEDYQQGKSFDVKD |
| Ga0208182_10571832 | 3300025251 | Deep Ocean | KILGKPTGQGYGAARKGPDVQGPPEDVVVEEDYQQGKSFKVED |
| Ga0207895_10235281 | 3300025260 | Deep Ocean | GKPTGQGYGAARKGPDVQGPPEDVVVDEDYQTGKSFKVED |
| Ga0208814_11477942 | 3300025276 | Deep Ocean | GQGFGAARKGPAVKGPPQDVVVDEDYEQGKAFKVED |
| Ga0208684_11648152 | 3300025305 | Deep Ocean | IVGKPTGQGYGAARKGPDVKGPPQDVVVDEDYQEGKAFKIED |
| Ga0208643_10989752 | 3300025645 | Aqueous | TGQGFGAARKGPSVTGKAKDAVVDEDYQQGKSFDVDG |
| Ga0208134_10805272 | 3300025652 | Aqueous | DKVLGRPTGQGYGAARKGPSVTGKESDVVVEEDYSQGKSFKVSIGE |
| Ga0208767_10622304 | 3300025769 | Aqueous | GQGYGAARKGPSVTGKESDVVVEEDYSQGKSFKVSIGE |
| Ga0208545_10622933 | 3300025806 | Aqueous | TGQGFGAARKGPSVTGKAKDAVVDEDYQQGKSFEIEG |
| Ga0209714_11177541 | 3300025822 | Pelagic Marine | RPTGQGYGAARKGPQVKGPPQDVVVDEDYEQGKAFKVED |
| Ga0208645_11835692 | 3300025853 | Aqueous | GRPTGQGYGAARKGPSVTGKESDVVVEEDYSQGKSFKVSIGE |
| Ga0209757_100208033 | 3300025873 | Marine | NDIVGKPTGQGYGAARKGPDVQGPPEDVVVDEDYQTGKSFKVED |
| Ga0209757_100532593 | 3300025873 | Marine | NKILGKPTGQGYGAARKGPDVQGPPEDVVVDEDYQQGKSFKVED |
| Ga0209757_101143092 | 3300025873 | Marine | KLNEILGKPTGQGFGAARKGPSIVGKPQDVVVDEDYQQGKSFKVED |
| Ga0209757_102272012 | 3300025873 | Marine | PEKLKEILGKPTGQGFGAARKGPSVVGKPHDVVVDEDYQQGKSFKVED |
| Ga0209384_10309074 | 3300027522 | Marine | SIPLNDIVGKPTGQGFGAARKGPSVVGKAKDAVVDEDYQQGKSFEVEG |
| Ga0209192_103452132 | 3300027752 | Marine | RSIPLKDIVGKPTGQGFGAARKGPSVTGKAKDAVVDEDYQQGKSFKVED |
| Ga0209830_104045832 | 3300027791 | Marine | GQGYGAARKGPSVTGKQSDVVVEEDYSQGKSFKVSIGD |
| (restricted) Ga0255054_106209801 | 3300027856 | Seawater | PTGQGFGAARKGPSVKGPPQDVVVDEDYEQGKSFKVED |
| Ga0256381_10727931 | 3300028018 | Seawater | GQGYGAARKGPDVKGPPQDVVVDEDYQQGKAFKIED |
| Ga0183748_11227772 | 3300029319 | Marine | NLDEIVGRPTGQGYGAARKGPDVKGPPQDVVVDEDYTQGKSFKVEG |
| Ga0183755_10440633 | 3300029448 | Marine | DQIVGKPTGQGFGAARKGPSVTGKPQDVVVDEDYTQGKAFKVED |
| Ga0307488_102469862 | 3300031519 | Sackhole Brine | GYGAARKGPSVTGKESDVVVEEDYSQGKSFKVSIGE |
| Ga0302121_100376131 | 3300031626 | Marine | DIVGKPTGQGFGAARKGPSVTGKAKDAVVDEDYQQGKSFDVEG |
| Ga0310123_100512351 | 3300031802 | Marine | TGQGYGAARKGPNVLGPETNVVVDESYSQPKPFKVSKNG |
| Ga0316202_104196231 | 3300032277 | Microbial Mat | PTGQGYGAARKGPSVTGKESDVVVEEDYSQGKSFKVSIGE |
| Ga0314858_090698_1_126 | 3300033742 | Sea-Ice Brine | IGKPTGQGFGAARKGPSVTGKAKDAVVDEDYQQGKSFKVED |
| Ga0314858_111178_2_130 | 3300033742 | Sea-Ice Brine | IVGKPTGQGFGAARKGPSVKGKPQDVVIDKDYQQGKAFKVED |
| Ga0326741_019901_2_109 | 3300034654 | Filtered Seawater | QGFGAARKGPSVTGKAKDAVVDEDYQQGKSFKVED |
| Ga0326748_028906_623_757 | 3300034656 | Filtered Seawater | DNLVGRPTGQGYGAARKGPDVKGPPQDVIVDEDYQQGKSFKMED |
| ⦗Top⦘ |