


| Basic Information | |
|---|---|
| Family ID | F061001 |
| Family Type | Metagenome |
| Number of Sequences | 132 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MSKKSKRIAMILVGVVMALLAVAQHFGWIAGPPPLLAPGIQ |
| Number of Associated Samples | 100 |
| Number of Associated Scaffolds | 132 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 65.91 % |
| % of genes near scaffold ends (potentially truncated) | 43.94 % |
| % of genes from short scaffolds (< 2000 bps) | 86.36 % |
| Associated GOLD sequencing projects | 95 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.47 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (62.879 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere (8.333 % of family members) |
| Environment Ontology (ENVO) | Unclassified (38.636 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (63.636 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 33.33% β-sheet: 0.00% Coil/Unstructured: 66.67% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.47 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 132 Family Scaffolds |
|---|---|---|
| PF02472 | ExbD | 6.06 |
| PF02687 | FtsX | 2.27 |
| PF01988 | VIT1 | 2.27 |
| PF00719 | Pyrophosphatase | 1.52 |
| PF13847 | Methyltransf_31 | 1.52 |
| PF07694 | 5TM-5TMR_LYT | 1.52 |
| PF00005 | ABC_tran | 1.52 |
| PF07676 | PD40 | 1.52 |
| PF12704 | MacB_PCD | 1.52 |
| PF13193 | AMP-binding_C | 1.52 |
| PF01425 | Amidase | 1.52 |
| PF00756 | Esterase | 0.76 |
| PF04365 | BrnT_toxin | 0.76 |
| PF00196 | GerE | 0.76 |
| PF14690 | zf-ISL3 | 0.76 |
| PF03551 | PadR | 0.76 |
| PF00034 | Cytochrom_C | 0.76 |
| PF12695 | Abhydrolase_5 | 0.76 |
| PF04070 | DUF378 | 0.76 |
| PF04069 | OpuAC | 0.76 |
| PF01435 | Peptidase_M48 | 0.76 |
| PF13517 | FG-GAP_3 | 0.76 |
| PF00664 | ABC_membrane | 0.76 |
| PF00248 | Aldo_ket_red | 0.76 |
| PF12543 | DUF3738 | 0.76 |
| PF00313 | CSD | 0.76 |
| PF03989 | DNA_gyraseA_C | 0.76 |
| PF13535 | ATP-grasp_4 | 0.76 |
| PF07589 | PEP-CTERM | 0.76 |
| PF00593 | TonB_dep_Rec | 0.76 |
| PF07638 | Sigma70_ECF | 0.76 |
| PF00069 | Pkinase | 0.76 |
| PF02518 | HATPase_c | 0.76 |
| PF08241 | Methyltransf_11 | 0.76 |
| PF13340 | DUF4096 | 0.76 |
| PF07677 | A2M_recep | 0.76 |
| PF00326 | Peptidase_S9 | 0.76 |
| PF01464 | SLT | 0.76 |
| PF06439 | 3keto-disac_hyd | 0.76 |
| PF00561 | Abhydrolase_1 | 0.76 |
| PF06956 | RtcR | 0.76 |
| COG ID | Name | Functional Category | % Frequency in 132 Family Scaffolds |
|---|---|---|---|
| COG0848 | Biopolymer transport protein ExbD | Intracellular trafficking, secretion, and vesicular transport [U] | 6.06 |
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 3.03 |
| COG1633 | Rubrerythrin, includes spore coat protein YhjR | Inorganic ion transport and metabolism [P] | 2.27 |
| COG1814 | Predicted Fe2+/Mn2+ transporter, VIT1/CCC1 family | Inorganic ion transport and metabolism [P] | 2.27 |
| COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 1.52 |
| COG0221 | Inorganic pyrophosphatase | Energy production and conversion [C] | 1.52 |
| COG3275 | Sensor histidine kinase, LytS/YehU family | Signal transduction mechanisms [T] | 1.52 |
| COG4650 | Sigma54-dependent transcription regulator containing an AAA-type ATPase domain and a DNA-binding domain | Transcription [K] | 1.52 |
| COG0188 | DNA gyrase/topoisomerase IV, subunit A | Replication, recombination and repair [L] | 0.76 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.76 |
| COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 0.76 |
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.76 |
| COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 0.76 |
| COG2155 | Uncharacterized membrane protein YuzA, DUF378 family | Function unknown [S] | 0.76 |
| COG2929 | Ribonuclease BrnT, toxin component of the BrnT-BrnA toxin-antitoxin system | Defense mechanisms [V] | 0.76 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 62.88 % |
| Unclassified | root | N/A | 37.12 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459004|F62QY1Z02JUAY2 | Not Available | 508 | Open in IMG/M |
| 3300000956|JGI10216J12902_100538283 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4874 | Open in IMG/M |
| 3300000956|JGI10216J12902_102463938 | Not Available | 974 | Open in IMG/M |
| 3300001431|F14TB_100136310 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 928 | Open in IMG/M |
| 3300001686|C688J18823_10307463 | Not Available | 1039 | Open in IMG/M |
| 3300004114|Ga0062593_101989020 | Not Available | 645 | Open in IMG/M |
| 3300004153|Ga0063455_100442224 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 785 | Open in IMG/M |
| 3300004153|Ga0063455_101151345 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 578 | Open in IMG/M |
| 3300004156|Ga0062589_101178944 | All Organisms → cellular organisms → Bacteria | 731 | Open in IMG/M |
| 3300004156|Ga0062589_101200775 | All Organisms → cellular organisms → Bacteria | 726 | Open in IMG/M |
| 3300004157|Ga0062590_102751882 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium | 525 | Open in IMG/M |
| 3300004463|Ga0063356_100313024 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1956 | Open in IMG/M |
| 3300004463|Ga0063356_103293228 | Not Available | 696 | Open in IMG/M |
| 3300004463|Ga0063356_104091844 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → unclassified Nitrospiraceae → Nitrospiraceae bacterium | 628 | Open in IMG/M |
| 3300004463|Ga0063356_105538396 | Not Available | 542 | Open in IMG/M |
| 3300004479|Ga0062595_100046039 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1953 | Open in IMG/M |
| 3300004480|Ga0062592_101654122 | Not Available | 621 | Open in IMG/M |
| 3300004643|Ga0062591_101310196 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 713 | Open in IMG/M |
| 3300005093|Ga0062594_103328576 | Not Available | 505 | Open in IMG/M |
| 3300005179|Ga0066684_10362990 | All Organisms → cellular organisms → Bacteria | 970 | Open in IMG/M |
| 3300005289|Ga0065704_10339764 | Not Available | 825 | Open in IMG/M |
| 3300005290|Ga0065712_10068292 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 12137 | Open in IMG/M |
| 3300005328|Ga0070676_11269307 | Not Available | 562 | Open in IMG/M |
| 3300005331|Ga0070670_100306731 | All Organisms → cellular organisms → Bacteria | 1389 | Open in IMG/M |
| 3300005331|Ga0070670_101458292 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
| 3300005332|Ga0066388_101770965 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium cajani | 1097 | Open in IMG/M |
| 3300005332|Ga0066388_104529543 | Not Available | 708 | Open in IMG/M |
| 3300005332|Ga0066388_107613725 | Not Available | 543 | Open in IMG/M |
| 3300005335|Ga0070666_10586134 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 813 | Open in IMG/M |
| 3300005336|Ga0070680_101342492 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
| 3300005354|Ga0070675_100084648 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2648 | Open in IMG/M |
| 3300005364|Ga0070673_100488609 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales | 1112 | Open in IMG/M |
| 3300005364|Ga0070673_102324009 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
| 3300005438|Ga0070701_10202990 | All Organisms → cellular organisms → Bacteria | 1173 | Open in IMG/M |
| 3300005457|Ga0070662_100411101 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1118 | Open in IMG/M |
| 3300005526|Ga0073909_10269706 | All Organisms → cellular organisms → Bacteria | 763 | Open in IMG/M |
| 3300005536|Ga0070697_100989841 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 747 | Open in IMG/M |
| 3300005543|Ga0070672_101599560 | Not Available | 585 | Open in IMG/M |
| 3300005577|Ga0068857_102380285 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla | 520 | Open in IMG/M |
| 3300005617|Ga0068859_100253858 | All Organisms → cellular organisms → Bacteria | 1849 | Open in IMG/M |
| 3300005617|Ga0068859_101274328 | Not Available | 810 | Open in IMG/M |
| 3300005719|Ga0068861_100068063 | All Organisms → cellular organisms → Bacteria | 2750 | Open in IMG/M |
| 3300005719|Ga0068861_101823654 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → unclassified Dehalococcoidia → Dehalococcoidia bacterium | 604 | Open in IMG/M |
| 3300005764|Ga0066903_100106738 | All Organisms → cellular organisms → Bacteria | 3815 | Open in IMG/M |
| 3300005764|Ga0066903_100817183 | Not Available | 1670 | Open in IMG/M |
| 3300005764|Ga0066903_101652462 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1217 | Open in IMG/M |
| 3300005764|Ga0066903_105187582 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 689 | Open in IMG/M |
| 3300005764|Ga0066903_108662816 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Bradymonadales → Bradymonadaceae → unclassified Bradymonadaceae → Bradymonadaceae bacterium | 517 | Open in IMG/M |
| 3300005841|Ga0068863_100488074 | All Organisms → cellular organisms → Bacteria | 1212 | Open in IMG/M |
| 3300005843|Ga0068860_101647834 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 663 | Open in IMG/M |
| 3300006046|Ga0066652_100791748 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 906 | Open in IMG/M |
| 3300006237|Ga0097621_100241336 | All Organisms → cellular organisms → Bacteria | 1580 | Open in IMG/M |
| 3300006847|Ga0075431_100903725 | Not Available | 852 | Open in IMG/M |
| 3300006852|Ga0075433_11166772 | Not Available | 669 | Open in IMG/M |
| 3300006854|Ga0075425_101036165 | All Organisms → cellular organisms → Bacteria | 936 | Open in IMG/M |
| 3300006871|Ga0075434_100431742 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1338 | Open in IMG/M |
| 3300006881|Ga0068865_100776710 | All Organisms → cellular organisms → Bacteria | 825 | Open in IMG/M |
| 3300009092|Ga0105250_10380004 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 623 | Open in IMG/M |
| 3300009100|Ga0075418_10443752 | All Organisms → cellular organisms → Bacteria | 1390 | Open in IMG/M |
| 3300009100|Ga0075418_10792217 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1023 | Open in IMG/M |
| 3300009100|Ga0075418_11456007 | Not Available | 743 | Open in IMG/M |
| 3300009148|Ga0105243_11818141 | Not Available | 641 | Open in IMG/M |
| 3300009148|Ga0105243_12316649 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla | 575 | Open in IMG/M |
| 3300009148|Ga0105243_12796294 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
| 3300009156|Ga0111538_10479936 | All Organisms → cellular organisms → Bacteria | 1576 | Open in IMG/M |
| 3300009162|Ga0075423_10353983 | All Organisms → cellular organisms → Bacteria | 1540 | Open in IMG/M |
| 3300009162|Ga0075423_12618657 | Not Available | 551 | Open in IMG/M |
| 3300009176|Ga0105242_12123801 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 606 | Open in IMG/M |
| 3300009177|Ga0105248_10328937 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia → Afipia felis | 1721 | Open in IMG/M |
| 3300009177|Ga0105248_11696945 | Not Available | 716 | Open in IMG/M |
| 3300010362|Ga0126377_10002299 | All Organisms → cellular organisms → Bacteria | 13091 | Open in IMG/M |
| 3300010373|Ga0134128_10446424 | Not Available | 1443 | Open in IMG/M |
| 3300010397|Ga0134124_11569765 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 688 | Open in IMG/M |
| 3300010401|Ga0134121_10083908 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2652 | Open in IMG/M |
| 3300010403|Ga0134123_11412088 | Not Available | 737 | Open in IMG/M |
| 3300011271|Ga0137393_10116084 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2203 | Open in IMG/M |
| 3300012212|Ga0150985_119629086 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2330 | Open in IMG/M |
| 3300012354|Ga0137366_10016925 | All Organisms → cellular organisms → Bacteria | 5712 | Open in IMG/M |
| 3300012360|Ga0137375_10648993 | Not Available | 870 | Open in IMG/M |
| 3300012469|Ga0150984_102988420 | Not Available | 905 | Open in IMG/M |
| 3300012469|Ga0150984_122434477 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1369 | Open in IMG/M |
| 3300012510|Ga0157316_1082361 | Not Available | 506 | Open in IMG/M |
| 3300012685|Ga0137397_10395722 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1029 | Open in IMG/M |
| 3300012901|Ga0157288_10322423 | Not Available | 549 | Open in IMG/M |
| 3300012958|Ga0164299_10393352 | Not Available | 888 | Open in IMG/M |
| 3300012971|Ga0126369_12451745 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 607 | Open in IMG/M |
| 3300013306|Ga0163162_12373275 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 610 | Open in IMG/M |
| 3300013308|Ga0157375_10873448 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1045 | Open in IMG/M |
| 3300015245|Ga0137409_10221923 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1692 | Open in IMG/M |
| 3300015371|Ga0132258_10031141 | All Organisms → cellular organisms → Bacteria | 11922 | Open in IMG/M |
| 3300015371|Ga0132258_10124286 | All Organisms → cellular organisms → Bacteria | 6138 | Open in IMG/M |
| 3300015371|Ga0132258_11328498 | All Organisms → cellular organisms → Bacteria | 1817 | Open in IMG/M |
| 3300015372|Ga0132256_101334141 | Not Available | 830 | Open in IMG/M |
| 3300015373|Ga0132257_100003631 | All Organisms → cellular organisms → Bacteria | 14380 | Open in IMG/M |
| 3300015373|Ga0132257_101592209 | Not Available | 835 | Open in IMG/M |
| 3300015373|Ga0132257_101822503 | Not Available | 782 | Open in IMG/M |
| 3300015374|Ga0132255_100485143 | Not Available | 1813 | Open in IMG/M |
| 3300015374|Ga0132255_100692319 | Not Available | 1513 | Open in IMG/M |
| 3300018476|Ga0190274_12015733 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_65_14 | 673 | Open in IMG/M |
| 3300018476|Ga0190274_12711647 | Not Available | 592 | Open in IMG/M |
| 3300018482|Ga0066669_12160242 | Not Available | 527 | Open in IMG/M |
| 3300022756|Ga0222622_10004020 | Not Available | 6446 | Open in IMG/M |
| 3300025315|Ga0207697_10071521 | All Organisms → cellular organisms → Bacteria | 1453 | Open in IMG/M |
| 3300025321|Ga0207656_10670828 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300025893|Ga0207682_10054183 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales | 1666 | Open in IMG/M |
| 3300025901|Ga0207688_10436271 | All Organisms → cellular organisms → Bacteria | 815 | Open in IMG/M |
| 3300025908|Ga0207643_10750393 | Not Available | 632 | Open in IMG/M |
| 3300025923|Ga0207681_10314963 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales | 1242 | Open in IMG/M |
| 3300025925|Ga0207650_10052606 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3017 | Open in IMG/M |
| 3300025926|Ga0207659_10473047 | All Organisms → cellular organisms → Bacteria | 1058 | Open in IMG/M |
| 3300025926|Ga0207659_11646223 | Not Available | 547 | Open in IMG/M |
| 3300025934|Ga0207686_11219779 | Not Available | 616 | Open in IMG/M |
| 3300025936|Ga0207670_10235123 | Not Available | 1409 | Open in IMG/M |
| 3300025961|Ga0207712_10750240 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 855 | Open in IMG/M |
| 3300025961|Ga0207712_12146115 | Not Available | 500 | Open in IMG/M |
| 3300026075|Ga0207708_10935788 | Not Available | 751 | Open in IMG/M |
| 3300027903|Ga0209488_11029329 | Not Available | 568 | Open in IMG/M |
| 3300027907|Ga0207428_10414031 | Not Available | 986 | Open in IMG/M |
| 3300028379|Ga0268266_11350253 | Not Available | 688 | Open in IMG/M |
| 3300028380|Ga0268265_11795787 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 619 | Open in IMG/M |
| 3300031538|Ga0310888_10003907 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → Luteitalea pratensis | 5006 | Open in IMG/M |
| 3300031740|Ga0307468_100421571 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1028 | Open in IMG/M |
| 3300031740|Ga0307468_101109417 | Not Available | 706 | Open in IMG/M |
| 3300031890|Ga0306925_11779495 | Not Available | 591 | Open in IMG/M |
| 3300031944|Ga0310884_10042463 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1995 | Open in IMG/M |
| 3300031995|Ga0307409_101924753 | Not Available | 621 | Open in IMG/M |
| 3300032013|Ga0310906_10589706 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 764 | Open in IMG/M |
| 3300032179|Ga0310889_10331633 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 741 | Open in IMG/M |
| 3300032261|Ga0306920_100418997 | Not Available | 1991 | Open in IMG/M |
| 3300032397|Ga0315287_10012802 | All Organisms → cellular organisms → Bacteria | 8643 | Open in IMG/M |
| 3300033412|Ga0310810_11493225 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → unclassified Dehalococcoidia → Dehalococcoidia bacterium | 502 | Open in IMG/M |
| 3300033475|Ga0310811_10125743 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → Luteitalea pratensis | 3274 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 8.33% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 6.06% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 6.06% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 6.06% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 6.06% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 5.30% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.55% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.55% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 4.55% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 3.79% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 3.79% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 3.03% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.03% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 3.03% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 3.03% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 3.03% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.27% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.52% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.52% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.52% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.52% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.52% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 1.52% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 1.52% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.76% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.76% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.76% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.76% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.76% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.76% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.76% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.76% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.76% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.76% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.76% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.76% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.76% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.76% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.76% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.76% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.76% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459004 | Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect MP BIO 1O1 lysis 0-21cm (2) | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001431 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemly | Environmental | Open in IMG/M |
| 3300001686 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004153 | Grasslands soil microbial communities from Hopland, California, USA (version 2) | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 | Host-Associated | Open in IMG/M |
| 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
| 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
| 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012510 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 | Host-Associated | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012901 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S119-311C-1 | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300031538 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031944 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1 | Environmental | Open in IMG/M |
| 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Host-Associated | Open in IMG/M |
| 3300032013 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3 | Environmental | Open in IMG/M |
| 3300032179 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D2 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032397 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0 | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| 3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| E4B_06568340 | 2170459004 | Grass Soil | EAMSKRSKRIALILVGIAMAILAVAQHFGWIAGPPPLLAPGIQ |
| JGI10216J12902_1005382833 | 3300000956 | Soil | MSKRSKRIALILVGIAMALLAVAQHFGWIAGPPPLLAPGIQ* |
| JGI10216J12902_1024639383 | 3300000956 | Soil | MGKKSTRIAMILLLLVMAFLAVAQHFGWIAGPPPLLAPGVR* |
| F14TB_1001363102 | 3300001431 | Soil | MGEKSKRIAMILILVVMALLAVAQHFGWIAGPPPLLAPGVR |
| C688J18823_103074634 | 3300001686 | Soil | MSNRSKRILLILVGAAIVLLAVAQHFGWIAGPPPLLAPGIQPNS* |
| Ga0062593_1019890202 | 3300004114 | Soil | MSKTSKRIAMILVGVVMALLAVAQHFGWIAGPPPLLAPGVK* |
| Ga0063455_1004422242 | 3300004153 | Soil | MSKRSKRIAMISVGVAIALLAVAQYFGWIAGPPPLLAPGI |
| Ga0063455_1011513451 | 3300004153 | Soil | MSNRSKRILLILVGAAIVLLAVAQHFGWIAGPPPLLAPGIQPNF* |
| Ga0062589_1011789441 | 3300004156 | Soil | MSKRSKRIALILVGVAIALLAVAQHFGWIAGPPPLLAPGIQ* |
| Ga0062589_1012007751 | 3300004156 | Soil | GVCAETERLEMISKKSKGIAMILIVVVMAFLAVAQHFGWIAGPPPLLAPGVQ* |
| Ga0062590_1027518821 | 3300004157 | Soil | EAMSKRSKRIALILVGVGMAFLAVARHFGWIAGPPPLLAPGFQ* |
| Ga0063356_1003130242 | 3300004463 | Arabidopsis Thaliana Rhizosphere | VGNRQGRKVMSKKSKRIAMILVGVVIALLAVAQHFGWITGPPPLLAPGIQ* |
| Ga0063356_1032932282 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MSKRSKRIAALILVGGAMALLAVAQHFGWIAGPPPLLAPGIQ* |
| Ga0063356_1040918441 | 3300004463 | Arabidopsis Thaliana Rhizosphere | AMSQRSKRIALILVGIAMALLAVAQYAGWIAGPPPILAPGIQ* |
| Ga0063356_1055383962 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MSKKSKRIAMILVVVVMAFLAVAQHFGWIAGPPPLLAPGVH* |
| Ga0062595_1000460392 | 3300004479 | Soil | VAEGVCAETERLGMISKKSKGIAMILIVVVMAFLAVAQHFGWIAGPPPLLAPGVQ* |
| Ga0062592_1016541222 | 3300004480 | Soil | MSKRSKRIALILVGVAMALLAVAQHFGWIAGPPPLLAPGIQ* |
| Ga0062591_1013101961 | 3300004643 | Soil | MSKKSKRIAMILAGVVMALLAVAQHFGWIAGPPPLLAPGIQ* |
| Ga0062594_1033285762 | 3300005093 | Soil | MSTKSKRIAMILVGVVMALLAVAQHFGWIAGPPPLLAPGIQ* |
| Ga0066684_103629902 | 3300005179 | Soil | MSKRSKRIALILVGVAMALLAVAQHFGWIAGPPPLLAPGI |
| Ga0065704_103397642 | 3300005289 | Switchgrass Rhizosphere | MSKKAKRMALIFVGVAMALLAVAQHFGWIAGPPPLLAPGIQ* |
| Ga0065712_100682924 | 3300005290 | Miscanthus Rhizosphere | MISKKSKGIAMILIVVVMAFLAVAQHFGWIAGPPPLLAPGVQ* |
| Ga0070676_112693071 | 3300005328 | Miscanthus Rhizosphere | MMSKKSKRIAMILVVVVMALLAVAQHFGWIAGPPPLLAPGVQ* |
| Ga0070670_1003067312 | 3300005331 | Switchgrass Rhizosphere | MSKKSRRIAMILVGIVMALLAVAQHFGWIAGPPPLLAPGIQ* |
| Ga0070670_1014582922 | 3300005331 | Switchgrass Rhizosphere | MSKRSKRIALILVGVAMVLLAVAQHFGWIAGPPPLLAPGIQ* |
| Ga0066388_1017709651 | 3300005332 | Tropical Forest Soil | VSKECRRIAIILVGVTMAFLAVAQQFGWIAGPPPFLATGIH* |
| Ga0066388_1045295431 | 3300005332 | Tropical Forest Soil | MSRRSKRIALILLGITMALLAVAQHFGWIAGPPPLLAPGIQ* |
| Ga0066388_1076137252 | 3300005332 | Tropical Forest Soil | MSKKSKRIAMILVGVVMAFLAVAQHFGWIAGPPPLLAPGIH* |
| Ga0070666_105861342 | 3300005335 | Switchgrass Rhizosphere | VAEGVCAETERLEMISKKSKGIAMILIVVVMAFLAVAQHFGWIAGPPPLLAPGVQ* |
| Ga0070680_1013424922 | 3300005336 | Corn Rhizosphere | MSKKSKRIAMILVGVAMALLAVAQHFGWIAGPPPLLAPGIQ* |
| Ga0070675_1000846483 | 3300005354 | Miscanthus Rhizosphere | MSKKSKRIAMILVGVVIALLAVAQHFGWIAGPPPLLAPGIQ* |
| Ga0070673_1004886091 | 3300005364 | Switchgrass Rhizosphere | MSTKSKRIAMILVGVVMALLAVAQHFGWIAGPPPLLAPGIR* |
| Ga0070673_1023240091 | 3300005364 | Switchgrass Rhizosphere | TERREAMSKRSARIALIMVGIAMALLAVAQHFGWIAGPPPLLAPGMQ* |
| Ga0070701_102029902 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | MSKKSKRIAMILVGVAMALLAVAQHFGWIAGPPPLLAPGIR* |
| Ga0070662_1004111012 | 3300005457 | Corn Rhizosphere | MSKKSKRIAMLLVGVVIAILAVAQHFGWIAGPPPLLAPGIQ* |
| Ga0073909_102697063 | 3300005526 | Surface Soil | MSKKSKRIAMILVVVVMTFLAVAQHFGWIAGPPPLLAPGVQ* |
| Ga0070697_1009898412 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | KREQKGGKVMSKKSKRIAMFLAGVVMALLTVAQHFGWIAGPPPLLAPGIQ* |
| Ga0070672_1015995602 | 3300005543 | Miscanthus Rhizosphere | MSKKSKRIAMILVVAVMAFLAVAQHFGWIAGPPPLLAPGVQ* |
| Ga0068857_1023802852 | 3300005577 | Corn Rhizosphere | MSKRSTRIAMILVVVVMAFLAVAQHFGWIAGPPPLLAPGIQ* |
| Ga0068859_1002538584 | 3300005617 | Switchgrass Rhizosphere | SKRSKRIALILVGVAMVLLAVAQHFGWIAGPPPLLAPGIQ* |
| Ga0068859_1012743282 | 3300005617 | Switchgrass Rhizosphere | MSKRSKRIALILVGTAMALLAVAQHLGWIAGPPPLLAPG |
| Ga0068861_1000680632 | 3300005719 | Switchgrass Rhizosphere | MSKRSKRIALILLGTAMALLAVAQHLGWIAGPPPLLAPGIQ* |
| Ga0068861_1018236541 | 3300005719 | Switchgrass Rhizosphere | TERREMMSKKSKRIAMILVVVVMALLAVAQHFGWIAGPPPLLAPGVQ* |
| Ga0066903_1001067384 | 3300005764 | Tropical Forest Soil | MSKKSKRIAMIVLGVVLVLLAVAQHFGWIAGPPPLLAPGIQ* |
| Ga0066903_1008171831 | 3300005764 | Tropical Forest Soil | MSKKSRRIALILVGVVMAVLAVAQHFGWIAGPPPLLAPGIQ* |
| Ga0066903_1016524621 | 3300005764 | Tropical Forest Soil | MSKRSTRIALILVGVAMALLAVAQHFGWIAGPPPLLAP |
| Ga0066903_1051875822 | 3300005764 | Tropical Forest Soil | ERREVMSKKSKRIAFVLFGVAMAILAVAQHFGWIAGPPPLLAPGIQ* |
| Ga0066903_1086628161 | 3300005764 | Tropical Forest Soil | TRIALILVGVAMALLAVAQHFGWIAGPPPLLAPGIQ* |
| Ga0068863_1004880741 | 3300005841 | Switchgrass Rhizosphere | SKRIAMILVVVVMTFLAVAQHFGWIAGPPPLLAPGVQ* |
| Ga0068860_1016478342 | 3300005843 | Switchgrass Rhizosphere | TERREAMSKRSKRVALVVVGVAMALLAVAQHFGWIAGPPPLLALGIQ* |
| Ga0066652_1007917481 | 3300006046 | Soil | TERREAMSKRSKRIALILVGVAMALLAVAQHFGWIAGPPPLLAPGIQ* |
| Ga0097621_1002413362 | 3300006237 | Miscanthus Rhizosphere | MSKKSKRIALILVGVAMTVLAVAQHFGWIAGPPPLLAPGIQ* |
| Ga0075431_1009037251 | 3300006847 | Populus Rhizosphere | MSKKSKRIAMILVVVVMAFLAVAQHFGWIAGPPPLLAPGVQ* |
| Ga0075433_111667722 | 3300006852 | Populus Rhizosphere | MMSKRSTRIAMILVVVVMAFLAVAQHFGWIAGPPPLLAPGIQ* |
| Ga0075425_1010361651 | 3300006854 | Populus Rhizosphere | RREMMSKKSKRIAMILVVVVMAFLAVAQHFGWIAGPPPLLAPGIQ* |
| Ga0075434_1004317421 | 3300006871 | Populus Rhizosphere | VSKREQKAGEAMSKKSKWIAMILIGVVLALMAVARHFGWIAGPAPLLAPGIR* |
| Ga0068865_1007767102 | 3300006881 | Miscanthus Rhizosphere | SKRIALILLGTAMALLAVAQHLGWIAGPPPLLAPGIQ* |
| Ga0105250_103800042 | 3300009092 | Switchgrass Rhizosphere | ETERLGMISKKSKGIAMILIVVVMAFLAVAQHFGWIAGPPPLLAPGVQ* |
| Ga0075418_104437522 | 3300009100 | Populus Rhizosphere | MMSKKSKRIAMILVVVVMAFLAVAQHFGWIAGPPPL |
| Ga0075418_107922171 | 3300009100 | Populus Rhizosphere | ERREMMSKKSKRIAMILVVVVMAFLAVAQHFGWIAGPPPLLAPGVQ* |
| Ga0075418_114560071 | 3300009100 | Populus Rhizosphere | MSKKAKRMALIFVGVAMALLAVAQHFGWIAGPPPLLAP |
| Ga0105243_118181411 | 3300009148 | Miscanthus Rhizosphere | AMSKKSTRIAMILVGVVMALVAVAQHFGWIAGPPPLLAPGIQ* |
| Ga0105243_123166491 | 3300009148 | Miscanthus Rhizosphere | MMSKRSTRIAMILVVVVMAFLAVAQHFRWIAGPPPLLAPGIQ* |
| Ga0105243_127962941 | 3300009148 | Miscanthus Rhizosphere | VAEGVCAETERLGMISKKSKGIAMILIVVVMAFLAVAQHFGWIAGPPP |
| Ga0111538_104799363 | 3300009156 | Populus Rhizosphere | MSKRSKRIAALILVGGAMALLAVAQHFGWIAGPPPLFAPGIQ* |
| Ga0075423_103539831 | 3300009162 | Populus Rhizosphere | RIAMILVVVVMAFLAVAQHFGWIAGPPPLLAPGIQ* |
| Ga0075423_126186571 | 3300009162 | Populus Rhizosphere | EMMSKKSKRIAMILVVVVMAFLAVAQHFGWIAGPPPLLAPGVQ* |
| Ga0105242_121238012 | 3300009176 | Miscanthus Rhizosphere | MSRKSKRIAMILFGVVLALLAVAQHFGWIAGPPPVLAPGIR* |
| Ga0105248_103289372 | 3300009177 | Switchgrass Rhizosphere | MSKKSKRIALILVGVGMAVLAVAQHFGWIAGPPPLLAPGIQ* |
| Ga0105248_116969451 | 3300009177 | Switchgrass Rhizosphere | MSKRSKRIAVFLVGLAMALLAVAQHFGWIAGPPPLLAPGIQ* |
| Ga0126377_100022995 | 3300010362 | Tropical Forest Soil | MSKRSARIALILVGIVMALLAVVQHFGWIAGPPPLLAPGIQ* |
| Ga0134128_104464242 | 3300010373 | Terrestrial Soil | MSKRSTRIAMILVVVVMAFLAVAQHFGWIAGPPPLLAPGIN* |
| Ga0134124_115697653 | 3300010397 | Terrestrial Soil | MSRKSKRIAMILVGVVMALLAVAQHFGWIAGPPPLLAPGIR |
| Ga0134121_100839082 | 3300010401 | Terrestrial Soil | MSKKSKRIAMIVLGVVMALLALAQHFGWIAGPPPVLAPGIH* |
| Ga0134123_114120882 | 3300010403 | Terrestrial Soil | MSNTSKRIALILLGTAMALLAVAQHLGWIAGPPPLLAPGIQ* |
| Ga0137393_101160844 | 3300011271 | Vadose Zone Soil | MSKRSKRIALILVGLAMALLAVAQHFGWIAGPPPLLAPGIQ* |
| Ga0150985_1196290862 | 3300012212 | Avena Fatua Rhizosphere | MSKKSKQIVMALVLVMMALLAIAQHFGWIAAPPPLLAPGIQ* |
| Ga0137366_100169254 | 3300012354 | Vadose Zone Soil | MSKRSKRIALILVGIAMALLAVAQHFGWIAGPPPLLAPEIQ* |
| Ga0137375_106489933 | 3300012360 | Vadose Zone Soil | MSKKSKRIAVILVGVVMALLAVAQHFGWIAGVPPLLAPGLQ* |
| Ga0150984_1029884202 | 3300012469 | Avena Fatua Rhizosphere | ARARGRCLRGNRRRAVRSDKSKRIAMIILVGMAFMAVAQHFGWIAGPPPLLAPGQ* |
| Ga0150984_1224344771 | 3300012469 | Avena Fatua Rhizosphere | DVMSKKSKQIVMALVQVMMALLAIAQHFGWIAAPPPLLAPGIQ* |
| Ga0157316_10823612 | 3300012510 | Arabidopsis Rhizosphere | RGDTRVMEAESREMMSKKSKRIAMILVVVVMAFLAVAQHFGWIAGPPPLLAPGVH* |
| Ga0137397_103957221 | 3300012685 | Vadose Zone Soil | TERREAMSKRSKRIALILVGIAMALLAVAQHLGWIAGPPPLLAPGIQ* |
| Ga0157288_103224232 | 3300012901 | Soil | MNKKSQRIALVALGVFIALAAAQHFGWIDGPPPLLAPGIH* |
| Ga0164299_103933522 | 3300012958 | Soil | LCLGISEGVDAETERRERMSKKSKRIAMILVVVVMTFLAVAQHFGWIAGPPPLLAPGVQ* |
| Ga0126369_124517451 | 3300012971 | Tropical Forest Soil | MSKRSTRIALILVGVAMALLAVAQHFGWIAGPPPLLA |
| Ga0163162_123732751 | 3300013306 | Switchgrass Rhizosphere | MSKKSKRIAMIVVGVVMALLAVAQHFGWIAGPPPLLAPGIH* |
| Ga0157375_108734482 | 3300013308 | Miscanthus Rhizosphere | AEGVCAETERLGMISKKSKGIAMILIVVVMAFLAVAQHFGWIAGPPPLLAPGVQ* |
| Ga0137409_102219232 | 3300015245 | Vadose Zone Soil | MSKESKRIAMILVGVVMALLAVAQHFGWIAGPPPLLAPGIQ* |
| Ga0132258_1003114114 | 3300015371 | Arabidopsis Rhizosphere | MSKNSKRIGMILFVLVMAFLAVAQHFGWIAGPPPLLAPGVQ* |
| Ga0132258_101242862 | 3300015371 | Arabidopsis Rhizosphere | MSRPSRRVTLVVVGLLIALVAIARYLGWLADAPPLLAPGIR* |
| Ga0132258_113284981 | 3300015371 | Arabidopsis Rhizosphere | RIALILVGVAMALLAVAQHFGWIAGPPPLLAPGIQ* |
| Ga0132256_1013341412 | 3300015372 | Arabidopsis Rhizosphere | MEAESREMMSKKSKRIAMILVVVVMAFLAVAQHFGWIAGPPPLLAPGVQ* |
| Ga0132257_10000363112 | 3300015373 | Arabidopsis Rhizosphere | IAMILIVVVMVFLALAQHFGWIAGPPPLLAPGVH* |
| Ga0132257_1015922092 | 3300015373 | Arabidopsis Rhizosphere | SKRIALIFVGVAMVVLAVAQHFGWIAGPPPLLAPGIQ* |
| Ga0132257_1018225031 | 3300015373 | Arabidopsis Rhizosphere | REMMSKKSKRIAMILVVVVMALLAVAQHFGWIAGPPPLLAPGVQ* |
| Ga0132255_1004851435 | 3300015374 | Arabidopsis Rhizosphere | MSKNSKRIGMILFVLVMAFLAAAQHFGWIAGPPPLLAPGVQ* |
| Ga0132255_1006923191 | 3300015374 | Arabidopsis Rhizosphere | RIALILVGVAMALLAVAQHFGWIAGPPPLLAPGVQ* |
| Ga0190274_120157331 | 3300018476 | Soil | MSKKSKQIAMILVVVVIAFLAVAQHFGWIAGPPPLLAPGVE |
| Ga0190274_127116472 | 3300018476 | Soil | MNKQSRRIALVALGLFVAFMAVAQHFGWIAGPPPLLAPGIH |
| Ga0066669_121602422 | 3300018482 | Grasslands Soil | VNKTQRVVLILVGIAMVLLAVAQYFGWIAGPPPLLAPGVQ |
| Ga0222622_100040208 | 3300022756 | Groundwater Sediment | MMSNKSKRIAMILVVVVIAFLAVAQHFGWIAGPPPLLAPGVQ |
| Ga0207697_100715212 | 3300025315 | Corn, Switchgrass And Miscanthus Rhizosphere | MSKRSKRIALILVGVAMALLAVAQHFGWIAGPPPLLAPGMQ |
| Ga0207656_106708281 | 3300025321 | Corn Rhizosphere | MISKKSKGIAMILIVVVMAFLAVAQHFGWIAGPPPLLAPGVQ |
| Ga0207682_100541833 | 3300025893 | Miscanthus Rhizosphere | MSTKSKRIAMILVGVVMALLAVAQHFGWIAGPPPLLAPGIQ |
| Ga0207688_104362712 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | VAEGVCAETERLEMISKKSKGIAMILIVVVMAFLAVAQHFGWIAGPPPLLAPGVQ |
| Ga0207643_107503932 | 3300025908 | Miscanthus Rhizosphere | REVMSTKSKRIAMILVGVVMALLAVAQHFGWIAGPPPLLAPGIQ |
| Ga0207681_103149632 | 3300025923 | Switchgrass Rhizosphere | MSTKSKRIAMILVGVVMALLAVARHFGWIAGPPPLLAPGIQ |
| Ga0207650_100526064 | 3300025925 | Switchgrass Rhizosphere | MSKKSRRIAMILVGIVMALLAVAQHFGWIAGPPPLLAPGIQ |
| Ga0207659_104730472 | 3300025926 | Miscanthus Rhizosphere | VAEGVCAETERLGMISKKSKGIAMILIVVVMAFLAVAQHFGWIAGPPPLLAPGVQ |
| Ga0207659_116462231 | 3300025926 | Miscanthus Rhizosphere | MSKKSKRIAMILVVVVMAFLAVAQHFGWIAGPPPLL |
| Ga0207686_112197792 | 3300025934 | Miscanthus Rhizosphere | AETERLEMISKKSKGIAMILIVVVMAFLAVAQHFGWIAGPPPLLAPGVQ |
| Ga0207670_102351233 | 3300025936 | Switchgrass Rhizosphere | KKSKRIAMILVGVVIALLAVAQHFGWITGPPPLLAPGTQ |
| Ga0207712_107502402 | 3300025961 | Switchgrass Rhizosphere | KSKRIAMILAGVVMALLAVAQHFGWIAGPPPLLAPGIQ |
| Ga0207712_121461152 | 3300025961 | Switchgrass Rhizosphere | KRSKRIALILLGTAMALLAVAQHLGWIAGPPPLLAPGIQ |
| Ga0207708_109357881 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | EGLDVMSKKSKRIAMILVGVAMALLAIAQHFGWIAGPPPLLAPGIQ |
| Ga0209488_110293291 | 3300027903 | Vadose Zone Soil | MSKRSKRIALILVGVAIALLAVAQHFGWIAGPPPLLAPGIQ |
| Ga0207428_104140312 | 3300027907 | Populus Rhizosphere | MMSKKSKRIAMILVVVVMAFLAVAQHFGWIAGPPPLLAPGVQ |
| Ga0268266_113502531 | 3300028379 | Switchgrass Rhizosphere | GFRPETERWEVMSKKSKRIALILVGVAIALLAIGQRFGWIAGPPPLLAPGIQ |
| Ga0268265_117957871 | 3300028380 | Switchgrass Rhizosphere | MSKKSKRIAMILAGVVMALLAVAQHFGWIAGPPPLLAPGIQ |
| Ga0310888_100039071 | 3300031538 | Soil | MSKKSKRIAMILVVVVMAFLAVAQHFGWIAGPPPLLAPGV |
| Ga0307468_1004215713 | 3300031740 | Hardwood Forest Soil | MSKRSKRIALILVGIAMALLAVAQLVGWIAGPPPLLAPGIQ |
| Ga0307468_1011094172 | 3300031740 | Hardwood Forest Soil | MSKKSKRIAMILVGVVMALLAVAQHFGWIAGPPPLLAPGIQ |
| Ga0306925_117794952 | 3300031890 | Soil | MSKRSKRIALILVGVVMALLAVAHHFGWIAGPPPLLAP |
| Ga0310884_100424631 | 3300031944 | Soil | MSKKSKRIAMILVVVVMAFLAVAQHFGWIAGPPPLLAPGVH |
| Ga0307409_1019247531 | 3300031995 | Rhizosphere | SGNRRREMMSKNSKRIAMILVVVVIAFLAVAQHFGWIAGPPPLLAPGVQ |
| Ga0310906_105897061 | 3300032013 | Soil | MGKKSTRIAMILILVVMALLAVAQHFGWIAGPPPLLAP |
| Ga0310889_103316331 | 3300032179 | Soil | GVQVGNRQGRKVMSKKSKRIAMILVGVVIALLAVAQHFGWITGPPPLLAPGTQ |
| Ga0306920_1004189971 | 3300032261 | Soil | MSKRSKRIALILVGVVMALLAVAHHFGWIAGPPPLLAPGIR |
| Ga0315287_1001280212 | 3300032397 | Sediment | MSRPSWRVALVVVGVMMALVAIAQHLGWLAGPPPLLAPGIR |
| Ga0310810_114932252 | 3300033412 | Soil | KAREMSKKSKRIAMILVVVVMAVLAVAQHFGWIAGPPPLLAPGVQ |
| Ga0310811_101257437 | 3300033475 | Soil | MSKKSKRIAMILVVVVMAVLAVAQHFGWIAGPPPLLAPGVQ |
| ⦗Top⦘ |