


| Basic Information | |
|---|---|
| Family ID | F060991 |
| Family Type | Metagenome |
| Number of Sequences | 132 |
| Average Sequence Length | 51 residues |
| Representative Sequence | MSDDVPTSDKARVRRQPPVPVTLAVFLASVVGFMLVVTGLFALLRYLGGWR |
| Number of Associated Samples | 106 |
| Number of Associated Scaffolds | 132 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 28.24 % |
| % of genes near scaffold ends (potentially truncated) | 38.64 % |
| % of genes from short scaffolds (< 2000 bps) | 78.79 % |
| Associated GOLD sequencing projects | 91 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.52 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (84.091 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (12.121 % of family members) |
| Environment Ontology (ENVO) | Unclassified (50.758 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (61.364 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 46.84% β-sheet: 0.00% Coil/Unstructured: 53.16% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.52 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 132 Family Scaffolds |
|---|---|---|
| PF11026 | DUF2721 | 15.91 |
| PF00149 | Metallophos | 15.15 |
| PF03364 | Polyketide_cyc | 11.36 |
| PF08281 | Sigma70_r4_2 | 6.82 |
| PF10604 | Polyketide_cyc2 | 3.79 |
| PF07992 | Pyr_redox_2 | 1.52 |
| PF08240 | ADH_N | 0.76 |
| PF02852 | Pyr_redox_dim | 0.76 |
| PF02515 | CoA_transf_3 | 0.76 |
| PF01546 | Peptidase_M20 | 0.76 |
| COG ID | Name | Functional Category | % Frequency in 132 Family Scaffolds |
|---|---|---|---|
| COG1804 | Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferases | Lipid transport and metabolism [I] | 0.76 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 84.09 % |
| Unclassified | root | N/A | 15.91 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2228664022|INPgaii200_c0643478 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_101466840 | Not Available | 874 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_101468051 | All Organisms → cellular organisms → Bacteria | 683 | Open in IMG/M |
| 3300000789|JGI1027J11758_12399338 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
| 3300000955|JGI1027J12803_105271075 | Not Available | 741 | Open in IMG/M |
| 3300002075|JGI24738J21930_10162279 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300004114|Ga0062593_100005125 | All Organisms → cellular organisms → Bacteria | 5385 | Open in IMG/M |
| 3300004157|Ga0062590_102047796 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
| 3300004463|Ga0063356_100562427 | All Organisms → cellular organisms → Bacteria | 1529 | Open in IMG/M |
| 3300004463|Ga0063356_101761914 | Not Available | 929 | Open in IMG/M |
| 3300004463|Ga0063356_102046996 | Not Available | 867 | Open in IMG/M |
| 3300004480|Ga0062592_101287867 | Not Available | 689 | Open in IMG/M |
| 3300004643|Ga0062591_101780272 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
| 3300005093|Ga0062594_100529974 | All Organisms → cellular organisms → Bacteria | 1007 | Open in IMG/M |
| 3300005093|Ga0062594_100962253 | All Organisms → cellular organisms → Bacteria | 815 | Open in IMG/M |
| 3300005327|Ga0070658_10498202 | All Organisms → cellular organisms → Bacteria | 1052 | Open in IMG/M |
| 3300005328|Ga0070676_10423105 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 931 | Open in IMG/M |
| 3300005328|Ga0070676_10438661 | Not Available | 916 | Open in IMG/M |
| 3300005329|Ga0070683_100573620 | All Organisms → cellular organisms → Bacteria | 1079 | Open in IMG/M |
| 3300005331|Ga0070670_101065861 | All Organisms → cellular organisms → Bacteria | 736 | Open in IMG/M |
| 3300005337|Ga0070682_101065604 | All Organisms → cellular organisms → Bacteria | 675 | Open in IMG/M |
| 3300005337|Ga0070682_101898148 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300005338|Ga0068868_100163436 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1840 | Open in IMG/M |
| 3300005339|Ga0070660_100118167 | All Organisms → cellular organisms → Bacteria | 2114 | Open in IMG/M |
| 3300005339|Ga0070660_101862952 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300005345|Ga0070692_11377664 | Not Available | 508 | Open in IMG/M |
| 3300005347|Ga0070668_100004546 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 10286 | Open in IMG/M |
| 3300005355|Ga0070671_100209882 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1652 | Open in IMG/M |
| 3300005356|Ga0070674_100267725 | All Organisms → cellular organisms → Bacteria | 1349 | Open in IMG/M |
| 3300005356|Ga0070674_101843448 | Not Available | 549 | Open in IMG/M |
| 3300005364|Ga0070673_100442023 | All Organisms → cellular organisms → Bacteria | 1169 | Open in IMG/M |
| 3300005366|Ga0070659_101752844 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
| 3300005459|Ga0068867_100912516 | Not Available | 791 | Open in IMG/M |
| 3300005518|Ga0070699_100136382 | All Organisms → cellular organisms → Bacteria | 2165 | Open in IMG/M |
| 3300005530|Ga0070679_101690175 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
| 3300005535|Ga0070684_100030065 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 4612 | Open in IMG/M |
| 3300005543|Ga0070672_100950286 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 760 | Open in IMG/M |
| 3300005543|Ga0070672_101651268 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
| 3300005564|Ga0070664_100664234 | All Organisms → cellular organisms → Bacteria | 969 | Open in IMG/M |
| 3300005564|Ga0070664_102110099 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
| 3300005566|Ga0066693_10293032 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
| 3300005578|Ga0068854_101712512 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
| 3300005614|Ga0068856_100437668 | All Organisms → cellular organisms → Bacteria | 1328 | Open in IMG/M |
| 3300005615|Ga0070702_101537815 | Not Available | 548 | Open in IMG/M |
| 3300005616|Ga0068852_100408229 | All Organisms → cellular organisms → Bacteria | 1337 | Open in IMG/M |
| 3300005840|Ga0068870_10708368 | Not Available | 695 | Open in IMG/M |
| 3300005840|Ga0068870_11115537 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
| 3300005842|Ga0068858_100100223 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 2701 | Open in IMG/M |
| 3300006237|Ga0097621_100955292 | All Organisms → cellular organisms → Bacteria | 800 | Open in IMG/M |
| 3300006755|Ga0079222_10346799 | Not Available | 1000 | Open in IMG/M |
| 3300009156|Ga0111538_10030083 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 7047 | Open in IMG/M |
| 3300009177|Ga0105248_10578323 | All Organisms → cellular organisms → Bacteria | 1267 | Open in IMG/M |
| 3300009789|Ga0126307_10101507 | All Organisms → cellular organisms → Bacteria | 2280 | Open in IMG/M |
| 3300009789|Ga0126307_10174931 | All Organisms → cellular organisms → Bacteria | 1721 | Open in IMG/M |
| 3300009789|Ga0126307_10249672 | All Organisms → cellular organisms → Bacteria | 1426 | Open in IMG/M |
| 3300009840|Ga0126313_10025754 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 3977 | Open in IMG/M |
| 3300010039|Ga0126309_10881523 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
| 3300010045|Ga0126311_10083073 | All Organisms → cellular organisms → Bacteria | 2157 | Open in IMG/M |
| 3300010166|Ga0126306_10022426 | All Organisms → cellular organisms → Bacteria | 4184 | Open in IMG/M |
| 3300010399|Ga0134127_12295557 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
| 3300012212|Ga0150985_111487883 | All Organisms → cellular organisms → Bacteria | 2167 | Open in IMG/M |
| 3300012469|Ga0150984_108015134 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
| 3300012898|Ga0157293_10112475 | Not Available | 719 | Open in IMG/M |
| 3300012911|Ga0157301_10463550 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300012955|Ga0164298_10040205 | All Organisms → cellular organisms → Bacteria | 2176 | Open in IMG/M |
| 3300012955|Ga0164298_11194057 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
| 3300012957|Ga0164303_10270640 | All Organisms → cellular organisms → Bacteria | 985 | Open in IMG/M |
| 3300012958|Ga0164299_11504791 | Not Available | 525 | Open in IMG/M |
| 3300012960|Ga0164301_10196948 | All Organisms → cellular organisms → Bacteria | 1281 | Open in IMG/M |
| 3300012987|Ga0164307_10008972 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 4782 | Open in IMG/M |
| 3300012987|Ga0164307_11665298 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
| 3300013100|Ga0157373_11247744 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
| 3300013102|Ga0157371_10127898 | All Organisms → cellular organisms → Bacteria | 1807 | Open in IMG/M |
| 3300013104|Ga0157370_10479378 | All Organisms → cellular organisms → Bacteria | 1143 | Open in IMG/M |
| 3300013104|Ga0157370_11204452 | All Organisms → cellular organisms → Bacteria | 683 | Open in IMG/M |
| 3300013105|Ga0157369_10130095 | All Organisms → cellular organisms → Bacteria | 2668 | Open in IMG/M |
| 3300013307|Ga0157372_10800877 | All Organisms → cellular organisms → Bacteria | 1095 | Open in IMG/M |
| 3300013308|Ga0157375_13448264 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300014326|Ga0157380_13491837 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300014969|Ga0157376_10494498 | All Organisms → cellular organisms → Bacteria | 1201 | Open in IMG/M |
| 3300014969|Ga0157376_11989563 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium | 619 | Open in IMG/M |
| 3300015262|Ga0182007_10208115 | All Organisms → cellular organisms → Bacteria | 686 | Open in IMG/M |
| 3300015371|Ga0132258_10935412 | All Organisms → cellular organisms → Bacteria | 2189 | Open in IMG/M |
| 3300015371|Ga0132258_12720830 | All Organisms → cellular organisms → Bacteria | 1234 | Open in IMG/M |
| 3300017792|Ga0163161_10220376 | All Organisms → cellular organisms → Bacteria | 1469 | Open in IMG/M |
| 3300018469|Ga0190270_11204407 | All Organisms → cellular organisms → Bacteria | 796 | Open in IMG/M |
| 3300018476|Ga0190274_10022390 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 4175 | Open in IMG/M |
| 3300018476|Ga0190274_11569927 | Not Available | 750 | Open in IMG/M |
| 3300019356|Ga0173481_10696675 | Not Available | 548 | Open in IMG/M |
| 3300019361|Ga0173482_10203659 | All Organisms → cellular organisms → Bacteria | 812 | Open in IMG/M |
| 3300020009|Ga0193740_1030739 | Not Available | 850 | Open in IMG/M |
| 3300021445|Ga0182009_10017508 | All Organisms → cellular organisms → Bacteria | 2648 | Open in IMG/M |
| 3300021445|Ga0182009_10309949 | All Organisms → cellular organisms → Bacteria | 797 | Open in IMG/M |
| 3300022756|Ga0222622_10109890 | All Organisms → cellular organisms → Bacteria | 1713 | Open in IMG/M |
| 3300022756|Ga0222622_10265256 | All Organisms → cellular organisms → Bacteria | 1169 | Open in IMG/M |
| 3300024055|Ga0247794_10057391 | Not Available | 1082 | Open in IMG/M |
| 3300025315|Ga0207697_10040325 | All Organisms → cellular organisms → Bacteria | 1917 | Open in IMG/M |
| 3300025893|Ga0207682_10011333 | All Organisms → cellular organisms → Bacteria | 3482 | Open in IMG/M |
| 3300025901|Ga0207688_10340000 | All Organisms → cellular organisms → Bacteria | 923 | Open in IMG/M |
| 3300025907|Ga0207645_10042818 | All Organisms → cellular organisms → Bacteria | 2897 | Open in IMG/M |
| 3300025907|Ga0207645_10293329 | All Organisms → cellular organisms → Bacteria | 1082 | Open in IMG/M |
| 3300025909|Ga0207705_11342493 | Not Available | 545 | Open in IMG/M |
| 3300025919|Ga0207657_10353388 | All Organisms → cellular organisms → Bacteria | 1159 | Open in IMG/M |
| 3300025921|Ga0207652_11691636 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300025930|Ga0207701_11171430 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
| 3300025931|Ga0207644_10222072 | All Organisms → cellular organisms → Bacteria | 1498 | Open in IMG/M |
| 3300025932|Ga0207690_11283818 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
| 3300025933|Ga0207706_10396528 | All Organisms → cellular organisms → Bacteria | 1197 | Open in IMG/M |
| 3300025940|Ga0207691_11220591 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
| 3300025944|Ga0207661_10086928 | All Organisms → cellular organisms → Bacteria | 2595 | Open in IMG/M |
| 3300025945|Ga0207679_11713428 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
| 3300025986|Ga0207658_11425755 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
| 3300026041|Ga0207639_10131332 | All Organisms → cellular organisms → Bacteria | 2074 | Open in IMG/M |
| 3300026067|Ga0207678_10101808 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 2452 | Open in IMG/M |
| 3300026078|Ga0207702_10135968 | All Organisms → cellular organisms → Bacteria | 2218 | Open in IMG/M |
| 3300026142|Ga0207698_10522230 | All Organisms → cellular organisms → Bacteria | 1159 | Open in IMG/M |
| 3300026306|Ga0209468_1048844 | All Organisms → cellular organisms → Bacteria | 1438 | Open in IMG/M |
| 3300027639|Ga0209387_1045373 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales | 950 | Open in IMG/M |
| 3300031824|Ga0307413_11704993 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 562 | Open in IMG/M |
| 3300031903|Ga0307407_10442539 | All Organisms → cellular organisms → Bacteria | 941 | Open in IMG/M |
| 3300031903|Ga0307407_10721186 | All Organisms → cellular organisms → Bacteria | 753 | Open in IMG/M |
| 3300031911|Ga0307412_10452073 | All Organisms → cellular organisms → Bacteria | 1059 | Open in IMG/M |
| 3300031938|Ga0308175_100097274 | All Organisms → cellular organisms → Bacteria | 2701 | Open in IMG/M |
| 3300031938|Ga0308175_100354921 | All Organisms → cellular organisms → Bacteria | 1516 | Open in IMG/M |
| 3300031996|Ga0308176_10340079 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1477 | Open in IMG/M |
| 3300031996|Ga0308176_11261167 | All Organisms → cellular organisms → Bacteria | 785 | Open in IMG/M |
| 3300032005|Ga0307411_10079106 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2256 | Open in IMG/M |
| 3300032074|Ga0308173_11431253 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
| 3300032126|Ga0307415_100338502 | All Organisms → cellular organisms → Bacteria | 1262 | Open in IMG/M |
| 3300032126|Ga0307415_100867342 | Not Available | 829 | Open in IMG/M |
| 3300033412|Ga0310810_10005962 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 13705 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 12.12% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 9.09% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 7.58% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 5.30% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.30% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 5.30% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 5.30% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 5.30% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 5.30% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 4.55% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 4.55% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 3.79% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 3.03% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.27% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 2.27% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.27% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.52% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.52% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.52% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.52% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 1.52% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.76% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.76% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.76% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.76% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.76% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.76% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.76% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.76% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.76% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.76% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.76% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.76% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2228664022 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000789 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Host-Associated | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
| 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
| 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
| 3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
| 3300010039 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56 | Environmental | Open in IMG/M |
| 3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
| 3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012898 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S194-509B-1 | Environmental | Open in IMG/M |
| 3300012911 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S088-202R-2 | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
| 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Host-Associated | Open in IMG/M |
| 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Host-Associated | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300019356 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2) | Environmental | Open in IMG/M |
| 3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
| 3300020009 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2s1 | Environmental | Open in IMG/M |
| 3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300024055 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S046-202B-6 | Environmental | Open in IMG/M |
| 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026306 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 (SPAdes) | Environmental | Open in IMG/M |
| 3300027639 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control (SPAdes) | Environmental | Open in IMG/M |
| 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Host-Associated | Open in IMG/M |
| 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Host-Associated | Open in IMG/M |
| 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Host-Associated | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
| 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Host-Associated | Open in IMG/M |
| 3300032074 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1 | Environmental | Open in IMG/M |
| 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Host-Associated | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| INPgaii200_06434781 | 2228664022 | Soil | MSDEIPTSTKARVRRQPPVPLTLAVFLASVVGFMAVV |
| INPhiseqgaiiFebDRAFT_1014668402 | 3300000364 | Soil | MSDEIPTSTKARVRRQPPVPLTLAVFLASVVGFMAVVTGLFELLRYLGGWR* |
| INPhiseqgaiiFebDRAFT_1014680511 | 3300000364 | Soil | MSDDTPTSNKARVRRLPPVPLTLAVFLASVVGFMAVV |
| JGI1027J11758_123993382 | 3300000789 | Soil | MSDDTPTSNKARVRRLPPVPLTLAVFLASVVGFMAVVTGLFALLRYLGGWR* |
| JGI1027J12803_1052710752 | 3300000955 | Soil | MSDEIPTSTKARVRRQPPVPLTLAVFLASVVGFMAVVTGLFELL |
| JGI24738J21930_101622791 | 3300002075 | Corn Rhizosphere | ARVRRQPPVPLTLAVFIASVVGFMLVVTGLFALVRYLGGWR* |
| Ga0062593_1000051255 | 3300004114 | Soil | MTDENPDVDKTRTRRQPPVPVTLAVFLASVVGFMLVVTGLFALMRYLGGR* |
| Ga0062590_1020477961 | 3300004157 | Soil | MSDDTPNSNKERVRRQPPVSLTLAVFLASVVGFMIVVTGLFALLRFLGGWR* |
| Ga0063356_1005624272 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MTDETPDADKVRIRRQPPVPLALAVFLASVVGFMLVVTGLFALMRYIGKH* |
| Ga0063356_1017619142 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MPHLLLPPLMTDETPDADKIRIRRQPPVPVAFAVFLASVVGFMVVVAGLFALMRYLGKH* |
| Ga0063356_1020469961 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MIPPLLMTDETPDSDKVRIRRQPPVAVALGVFVASVVGFMLVVTGLFALMRYLGKH* |
| Ga0062592_1012878671 | 3300004480 | Soil | PLMTDETPDVEKVRIRRQPPVPVAFAVFLASVVGFMVVVAGLFALMRYLGKH* |
| Ga0062591_1017802721 | 3300004643 | Soil | MLQPLPPKSMTDENPEAAKSRSRRQPPVPLAFAVFAAAVVGFMAVVAGLFALLRLLGGSH |
| Ga0062594_1005299742 | 3300005093 | Soil | MTDETPDADKVRIRRQPPVPLALAAFAASVVGFMLVVTGLFALMRYLGKH* |
| Ga0062594_1009622532 | 3300005093 | Soil | MSDDLPTSNKARVRRQPPVPLTLAVFIASVVGFMLVVTGLFALVRYLGGWR* |
| Ga0070658_104982023 | 3300005327 | Corn Rhizosphere | MSDDLPTSNKARVRRQPPVPLTLAVFLASVVGFMVVVAGLFALVRYLGGWR* |
| Ga0070676_104231051 | 3300005328 | Miscanthus Rhizosphere | PTSNKTRVRRQPPVPVTLAVFLASIVGFMLVVTGLFALLRYLGGWR* |
| Ga0070676_104386612 | 3300005328 | Miscanthus Rhizosphere | MSDDTPNSDKERVRRQPPVSLTLAVFLAAVVGFMIVVTGLFALLRFLGGWR* |
| Ga0070683_1005736202 | 3300005329 | Corn Rhizosphere | MSDDVPTSNKTRVRRQPPVPVTLAVFLASVVGFMLVVTGLFALLRYLGGWR* |
| Ga0070670_1010658612 | 3300005331 | Switchgrass Rhizosphere | PAFPLHQGFMSDDVPTSDKARVRRQPPVPVTLAVFLASVVGFMLVVTGLFALLRYLGGWR |
| Ga0070682_1010656041 | 3300005337 | Corn Rhizosphere | LMSDDLPTSNKARVRRQPPVPLTLAVFIASVVGFMLVVTGLFALVRYLGGWR* |
| Ga0070682_1018981481 | 3300005337 | Corn Rhizosphere | LMSDDLPTSNKARVRRQPPVPLTLAVFLASVVGFMVVVAGLFALVRYLGGWR* |
| Ga0068868_1001634362 | 3300005338 | Miscanthus Rhizosphere | LLHQDIMSDDTPTSGKARVRRQPPVPVTLAVFLASVVGFMAVVTGLFSLLRYLGGWR* |
| Ga0070660_1001181674 | 3300005339 | Corn Rhizosphere | MSDDTPTSGKARVRRQPPVPVTLAVFLASVVGFMAVVTGLFSLLRYLGGWR* |
| Ga0070660_1018629521 | 3300005339 | Corn Rhizosphere | MSDDTPNSNKERVRRQPPVSLTLALFLASVVGFMIVVTGLFA |
| Ga0070692_113776642 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | MPHLLLPPLMTDETPDVEKVRIRRQPPVPVAFAVFLASVVGFMVVFAGLFALMRYLGKH* |
| Ga0070668_1000045468 | 3300005347 | Switchgrass Rhizosphere | MSDDVPTSNKTRVRRQPPVPVTLAVFLASIVGFMLVVTGLFALLRYLGGWR* |
| Ga0070671_1002098823 | 3300005355 | Switchgrass Rhizosphere | MSDDTPTSGKARDRRQPPVPVTLAVFLASVVGFMAVVTGLFSLLRYLGGWR* |
| Ga0070674_1002677253 | 3300005356 | Miscanthus Rhizosphere | MTDETPDADKARIRRQPPVPLALAVFLASVVGFMVVVTGL |
| Ga0070674_1018434481 | 3300005356 | Miscanthus Rhizosphere | LMTDETPDVEKVRIRRQPPVPVAFAVFLASVVGFMVVVAGLFALMRYLGKH* |
| Ga0070673_1004420231 | 3300005364 | Switchgrass Rhizosphere | MTDETPDVEKVRIRRQPPVPVAFAVFLASVVGFMVVVAGLFALMRYLGKH* |
| Ga0070659_1017528442 | 3300005366 | Corn Rhizosphere | MSDDNPTTNNARVRRQPPVPLTLAVFIASVVGFMVVVTGLFALLRYLGGWR* |
| Ga0068867_1009125162 | 3300005459 | Miscanthus Rhizosphere | VEKVRIRRQPPVPVAFAVFLASVVGFMVVVAGLFALMRYLGKH* |
| Ga0070699_1001363823 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MSDESPDLNKVRIRRQPPVPLAFIVFAASVVGFMIVVTGLFALLRFLGGSH* |
| Ga0070679_1016901751 | 3300005530 | Corn Rhizosphere | KARVRRQPPVPLTLAVFLASVVGFMVVVAGLFALVRYLGGWR* |
| Ga0070684_1000300654 | 3300005535 | Corn Rhizosphere | MSDDVPTSDKARVRRQPPVPVTLAVFLASVVGFMLVVTGLFALLRYLGGWR* |
| Ga0070672_1009502862 | 3300005543 | Miscanthus Rhizosphere | GFMSDDVPTSNKTRVRRQPPVPVTLAVFLASVVGFMLVVTGLFALLRYLGGWR* |
| Ga0070672_1016512681 | 3300005543 | Miscanthus Rhizosphere | MTDETPDADKVRIRRQPPVPLALAAFAASVVGFMLVVTGLF |
| Ga0070664_1006642343 | 3300005564 | Corn Rhizosphere | GHSPLSLLMTDETPDADKARIRRQPPVPLALAVFLASVVGFMVVVTGLFALMRYIGKH* |
| Ga0070664_1021100991 | 3300005564 | Corn Rhizosphere | VRVRRQPPVPVTLAVFLASVVGFMIVVTGLFAIMRYLGKH* |
| Ga0066693_102930322 | 3300005566 | Soil | MTDDTPDVDKARVRRQPRVPVTLAVFLASVVGFMLVVTGLFALMRFLGKH* |
| Ga0068854_1017125121 | 3300005578 | Corn Rhizosphere | MSDDLPTSNKARVRRQPPVPLTLAVFIASVVGFMLVVTGLFALLRYLGGWR* |
| Ga0068856_1004376681 | 3300005614 | Corn Rhizosphere | MSDDIPTSNETRVRRQPPVPLTLAIFLASVVGFMVVVTGLFALLRYLGGWR* |
| Ga0070702_1015378151 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | ADKVRIRRQPPVPLALAAFAASVVGFMLVVTGLFALMRYLGKH* |
| Ga0068852_1004082291 | 3300005616 | Corn Rhizosphere | QGFMSDDVPTSNKTRVRRQPPVPVTLAVFLASIVGFMLVVTGLFALLRYLGGWR* |
| Ga0068870_107083681 | 3300005840 | Miscanthus Rhizosphere | PLMTDETPDADKVRIRRQPPVPLALAAFAASVVGFMLVVTGLFALMRYLGKH* |
| Ga0068870_111155371 | 3300005840 | Miscanthus Rhizosphere | PDKVRVRRQPPVPVTLAVFLASVVGFMIVVTGLFAIMRYLGKH* |
| Ga0068858_1001002231 | 3300005842 | Switchgrass Rhizosphere | AFPLHQGFMSDDVPTSNKTRVRRQPPVPVTLAVFLASIVGFMLVVTGLFALLRYLGGWR* |
| Ga0097621_1009552921 | 3300006237 | Miscanthus Rhizosphere | GFMSDDVPTSDKARVRRQPPVPVTLAVFLASVVGFMLVVTGLFALLRYLGGWR* |
| Ga0079222_103467992 | 3300006755 | Agricultural Soil | MSDEGPTSNKTRVRRQPPVPLTLAVFLASIVGFMVVVTGLFALLRYLGGWR* |
| Ga0111538_100300832 | 3300009156 | Populus Rhizosphere | MTEENPDKVRVRRQPPVPVTLAVFLASVVGFMVVVAGLFALMRYLGRH* |
| Ga0105248_105783231 | 3300009177 | Switchgrass Rhizosphere | KARVRRQPPVPVTLAVFLASVVGFMAVVTGLFSLLRYLGGWR* |
| Ga0126307_101015072 | 3300009789 | Serpentine Soil | MTDETPDSDKVRVRRQPPVPLTLAVFLGAVVAFTVVVAALFALMRYLDGR* |
| Ga0126307_101749312 | 3300009789 | Serpentine Soil | MTDETPDRDKVRIRRQPPVPLTLAVFLASIVGFMIVVAGLFALMRFLDGR* |
| Ga0126307_102496722 | 3300009789 | Serpentine Soil | MTDETPDSDKARIRRQPPVPLTLAVFLASVVTFTVVVAALFALMRYLDGR* |
| Ga0126313_100257546 | 3300009840 | Serpentine Soil | MTDETPDSEKARVRRQPPVPLTLAVFLASVVAFTVVVAALFALMRYLDGR* |
| Ga0126309_108815232 | 3300010039 | Serpentine Soil | MTDETPDSDKDRGRRQPPVPLTLAVFLASIVGFMLVVAGLFSLMRYLDGR* |
| Ga0126311_100830734 | 3300010045 | Serpentine Soil | MTDETPDSEKARVRRQPPVPLTLAVFLASVVAFTVVVA |
| Ga0126306_100224264 | 3300010166 | Serpentine Soil | MTDETPDSDKVRIRRQPPVPLTLAVFLASVVTFTVVVAALFALMRYLDGR* |
| Ga0134127_122955572 | 3300010399 | Terrestrial Soil | MSDDVPTSNKTRVRRQPPVPVTLAVFLASIVGFILVVTGLFALLRYLGGWR* |
| Ga0150985_1114878832 | 3300012212 | Avena Fatua Rhizosphere | MSDDTPNSSKERVRRQPPVPLTLAVFFASVVGFMLVVAGVFAVFRFLGGWR* |
| Ga0150984_1080151341 | 3300012469 | Avena Fatua Rhizosphere | MTDEVPTSNKDRVRRQPPVPVTLAVFLASVVGFMLVVTGLFALLRYLGGWR* |
| Ga0157293_101124752 | 3300012898 | Soil | MTDETPDADKARIRRQPHVPLALAVFLASVVGFMVVVTGLFALMRYIGKH* |
| Ga0157301_104635502 | 3300012911 | Soil | MTDETPDADKARIRRQPPVPLALAVFLASVVGFMVVVTGLFALMRYIGKH* |
| Ga0164298_100402054 | 3300012955 | Soil | MSDDVPTSNKTRARRQPPVPVALAVFLASIVGFMLVVTGLFALLRYLGGWR* |
| Ga0164298_111940571 | 3300012955 | Soil | LLHQDIMSDDTPTSGKARDRRQPPVPVTLAVFLASVVGFMAVVTGLFSLLRYLGGWR* |
| Ga0164303_102706402 | 3300012957 | Soil | MSDDVPTSNKTRVRRQPPVPVTLAVFLASIVGFMLVVTGLFTLLRYLGGWR* |
| Ga0164299_115047912 | 3300012958 | Soil | MSDDTPTSNKARVRRQPPVPVTLAVFLASIAGFMLVVAGLFAVLRYLGGWR* |
| Ga0164301_101969481 | 3300012960 | Soil | AFPLHQGFMSDDVPTSNKTRVRRQPPVPVTLAVFLASVVGFMLVVTGLFALLRYLGGWR* |
| Ga0164307_100089726 | 3300012987 | Soil | MSDDVPTSNKTRARRQPPVPVTLAVFLASIVGFMLVVTGLFALLRYLGGWR* |
| Ga0164307_116652981 | 3300012987 | Soil | LFSYPAFQLHKILMSDDLPTSNKAHVRRQPPVPLTLAVFFASVVGFMIVVAGLFALLRYLGGWR* |
| Ga0157373_112477442 | 3300013100 | Corn Rhizosphere | LLPYLLPLHPILMSDDNPTSNKARVRRQPPVPLTLAVFIVSVVGFMVVVTGLFALLRYLGGWR* |
| Ga0157371_101278981 | 3300013102 | Corn Rhizosphere | PDLMSDDLPTSNKARVRRQPPVPLTLAVFIASVVGFMLVVTGLFALVRYLGGWR* |
| Ga0157370_104793782 | 3300013104 | Corn Rhizosphere | MSDEGPTSNKTRVRRQPPVPLTLAVFLASVVGFMVVVTGLFALLRYLGGWR* |
| Ga0157370_112044522 | 3300013104 | Corn Rhizosphere | MSDDIPTSDKTRVRRQPPVPLTLAIFLASVVGFMLVVTGLFALLRYLGGWR* |
| Ga0157369_101300952 | 3300013105 | Corn Rhizosphere | MSDDLPTSNKARVRRQPPVPLTLAVFLASVVGFMVVVAGLFALMRYLGGWR* |
| Ga0157372_108008773 | 3300013307 | Corn Rhizosphere | MSDDVPTSDKARVRRQPPVPVTLAVFLASVVGFMVVVAGLFALVRYLGGWR* |
| Ga0157375_134482641 | 3300013308 | Miscanthus Rhizosphere | LLHQDIMSDDTPTSGKERVRPQPPVPVTLAVFLASVVGFMAVVTALFSLLR |
| Ga0157380_134918371 | 3300014326 | Switchgrass Rhizosphere | SLLLPLHMTEENPDKVRVRRQPPVPVTLAVFLASIVGFMVVVAGLFALMRYLGRH* |
| Ga0157376_104944981 | 3300014969 | Miscanthus Rhizosphere | LLHQDIMSDDTPTSGKARVRRQPPVPVTLAVFLASVVGFMAVVTGLF |
| Ga0157376_119895632 | 3300014969 | Miscanthus Rhizosphere | MSEDTPTPTKARRQPPVPLTLAVFLASVVGFMAVVTGLFSLLRYLGGWR* |
| Ga0182007_102081152 | 3300015262 | Rhizosphere | MTDQTPEADKVRTRRQPRVPVTLAVFLASIVGFMLVVTGLFAFMRYLGKH* |
| Ga0132258_109354122 | 3300015371 | Arabidopsis Rhizosphere | LLHQDFMSDDTPTSNKARARRQPPVPLTLALFLASVAGFMLVVAGLFAALRYLGGWR* |
| Ga0132258_127208301 | 3300015371 | Arabidopsis Rhizosphere | PTPNKTHARRQPPVPVTLAVFLASVVGFMVLVTGLFALLRYLGGWR* |
| Ga0163161_102203763 | 3300017792 | Switchgrass Rhizosphere | MSDDVPTSNKTRVRRQPPVPVTLAVFLASIVGFMLVVTGLFALLRYLGGWR |
| Ga0190270_112044072 | 3300018469 | Soil | MLSPLLMTDETPDADKVRIRRQPPVPLAFAVFLASVVGFMLVVTGLFALLRYLGKH |
| Ga0190274_100223903 | 3300018476 | Soil | MTDETPDADKARIRRQPPVPLALAVFLASVVGFMLVVTGLFALMRYLGKH |
| Ga0190274_115699271 | 3300018476 | Soil | SRSPLLSHPSLLMSDETPDLNKERLRRQPPVPLTFAAFAAAVVGFMIVVAGLFALLRFLGGSH |
| Ga0173481_106966751 | 3300019356 | Soil | PDADKARIRRQPPVPLALAVFLASVVGFMVVVTGLFALMRYIGKH |
| Ga0173482_102036591 | 3300019361 | Soil | ENPDKVRVRRQPPVPVTFAVFLASVVGFMLVVTGLFALLRYLGKH |
| Ga0193740_10307392 | 3300020009 | Soil | DAAHDSPLLMTDETPDADKVRIRRQAPVPVALALFLASVVGFMLVVTGLFALMRYLGKH |
| Ga0182009_100175084 | 3300021445 | Soil | MSDEGPTSNKTRVRRQPPVPLTFAVFLASVVGFMVVVTGLFALLRYLGGWR |
| Ga0182009_103099492 | 3300021445 | Soil | MTDQTPEADKVRTRRQPRVPVTLAVFLASIVGFMLVVTGLFAFMRYLGKH |
| Ga0222622_101098904 | 3300022756 | Groundwater Sediment | MSDDTPNSDKERVRRQPPVPLTLAVFLAAVVGFMIVVTGLFALLRFLGGWR |
| Ga0222622_102652561 | 3300022756 | Groundwater Sediment | DETPDADKARIRRQPPVPLALAVFLASVVGFMLVVTGLFALMRYLGKH |
| Ga0247794_100573911 | 3300024055 | Soil | MSDDLPTSNKARVRRQPPVPLTLAVFIASVVGFMLVVTGLFALVRYLGGWR |
| Ga0207697_100403251 | 3300025315 | Corn, Switchgrass And Miscanthus Rhizosphere | TPLLLPLHMTEENPDKVRVRRQPPVPVTLAVFLASVVGFMVVVAGLFALMRYLGRH |
| Ga0207682_100113335 | 3300025893 | Miscanthus Rhizosphere | MTDETPDAAKVRIRRQPPVPLALAAFAASVVGFMLVVTGLFALMRYLGKH |
| Ga0207688_103400002 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | MTDETPDADKVRIRRQPPVPLALAAFAASVVGFMLVVTGLFALMRYLGKH |
| Ga0207645_100428184 | 3300025907 | Miscanthus Rhizosphere | MSDDTPNSNKERVRRQPPVSLTLAVFLASVVGFMIVVTGLFALLRFLGGWR |
| Ga0207645_102933292 | 3300025907 | Miscanthus Rhizosphere | MSDDTPTSGKARVRRQPPVPVTLAVFLASVVGFMAVVTGLFSLLRYLGGWR |
| Ga0207705_113424932 | 3300025909 | Corn Rhizosphere | MSDDLPTSNKARVRRQPPVPLTLAVFLASVVGFMVVVAGLFALVRYLGGWR |
| Ga0207657_103533881 | 3300025919 | Corn Rhizosphere | SCFPASPDLMSDDLPTSNKARVRRQPPVPLTLAVFIASVVGFMLVVTGLFALVRYLGGWR |
| Ga0207652_116916362 | 3300025921 | Corn Rhizosphere | SDDLPTSNKARVRRQPPVPLTLAVFLASVVGFMVVVAGLFALVRYLGGWR |
| Ga0207650_113524872 | 3300025925 | Switchgrass Rhizosphere | VRRQPPVPLTLAVFIASVVGFMLVVTGLFALVRYLGGWR |
| Ga0207701_111714302 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | MTDETPDVEKVRIRRQPPVPVAFAVFLASVVGFMVVVAGLFALMRYLGKH |
| Ga0207644_102220723 | 3300025931 | Switchgrass Rhizosphere | MSDDTPTSGKARDRRQPPVPVTLAVFLASVVGFMAVVTGLFSLLRYLGGWR |
| Ga0207690_112838181 | 3300025932 | Corn Rhizosphere | SIRLLSYPLPLHQILMSDDNPTTNNARVRRQPPVPLTLAVFIASVVGFMVVVTGLFALLRYLGGWR |
| Ga0207706_103965282 | 3300025933 | Corn Rhizosphere | MSDDTPNSDKERVRRQPPVSLTLAVFLASVVGFMIVVTGLFALLRFLGGWR |
| Ga0207691_112205911 | 3300025940 | Miscanthus Rhizosphere | MTDETPDADKVRIRRQPPVPLALAAFAASVVGFMLVVTGLFALMRYL |
| Ga0207661_100869283 | 3300025944 | Corn Rhizosphere | MSDDVPTSDKARVRRQPPVPVTLAVFLASVVGFMLVVTGLFALLRYLGGWR |
| Ga0207679_117134282 | 3300025945 | Corn Rhizosphere | MTDQTPDADKVRTRHQPRVPVTLAVFLASIVGFMLVVTGLFAFMRYLGKH |
| Ga0207658_114257551 | 3300025986 | Switchgrass Rhizosphere | AFPLHQGFMSDDVPTSNKTRARRQPPVPVTLAVFLASIVGFMLVVTGLFALLRYLGGWR |
| Ga0207639_101313322 | 3300026041 | Corn Rhizosphere | MSDDNPTTNNARVRRQPPVPLTLAVFIASVVGFMVVVTGLFALLRYLGGWR |
| Ga0207678_101018085 | 3300026067 | Corn Rhizosphere | LHQGFMSDDVPTSNKTRVRRQPPVPVTLAVFLASVVGFMLVVTGLFALLRYLGGWR |
| Ga0207702_101359681 | 3300026078 | Corn Rhizosphere | MSDDIPTSNETRVRRQPPVPLTLAIFLASVVGFMVVVTGLFALLRYLGGWR |
| Ga0207698_105222303 | 3300026142 | Corn Rhizosphere | QGFMSDDVPTSNKTRVRRQPPVPVTLAVFLASVVGFMLVVTGLFALLRYLGGWR |
| Ga0209468_10488443 | 3300026306 | Soil | MTDDTPDVDKARVRRQPRVPVTLAVFLASVVGFMLVVTGLFALMRFLGKH |
| Ga0209387_10453732 | 3300027639 | Agricultural Soil | MTDETPDLDKVRIRRQPPVPLTLAVFLGAILGFLVVVTGLFTLLRFLGGH |
| Ga0307413_117049932 | 3300031824 | Rhizosphere | MTDETPDADKIRIRRQPPVPVAFAVFLASVVGFMVVVAGLFALMRYLGKH |
| Ga0307407_104425393 | 3300031903 | Rhizosphere | PDPEKVRIRRQPPVPLTLALFLAAVLGFLVVVTGLFTLFRFLDGR |
| Ga0307407_107211862 | 3300031903 | Rhizosphere | MTDETPDHNKVRIRRQPPVPLTLAVFLASIVGFLVVVAGLFALLRFLGGH |
| Ga0307412_104520732 | 3300031911 | Rhizosphere | MTDQTPEGDKAPIRRQAPVPLALLLFLASVAGFMIVVTGLFALLRYLGGH |
| Ga0308175_1000972743 | 3300031938 | Soil | MSDEGPTSNKTRVRRQPPVPLTLAVFLASIVGFMVVVTGLFALLRYLGGWR |
| Ga0308175_1003549212 | 3300031938 | Soil | MSDEVPTSNKTRVRRQPPVPLTLVVFLASIVGFMVVVTGLFALLRYLGGWR |
| Ga0308176_103400791 | 3300031996 | Soil | MTDETPDADKVRIRRQPPVPVTLVVFLASIAGFMIVVV |
| Ga0308176_112611672 | 3300031996 | Soil | MSDDLPTSNKARVRRQPPVPLTLALFLASVVGFMVVVAGLFALLRYLGGWR |
| Ga0307411_100791064 | 3300032005 | Rhizosphere | MNDEPPDPEKVRIRRQPPVPLTLALFLAAVLGFLVVVTGLFTLFRFLGGR |
| Ga0308173_114312532 | 3300032074 | Soil | MSDDTPTSSKERVRRQPPVTLTLAVFLASVVGFMVVVTGLFALLRFLGGSR |
| Ga0307415_1003385022 | 3300032126 | Rhizosphere | LLHDQLMTDQTPEGDKAPIRRQAPVPLALLLFLASVAGFMIVVTGLFALLRYLGGH |
| Ga0307415_1008673423 | 3300032126 | Rhizosphere | LLMNDEPPDPEKVRIRRQPPVPLTLALFLAAVLGFLVVVTGLFTLFRFLDGR |
| Ga0310810_100059624 | 3300033412 | Soil | VTHPTHLRSMSDETPRSDKERNRRQAPIPLTFALFAASVVGFMVVVAGIFALMRFLGGSR |
| ⦗Top⦘ |