


| Basic Information | |
|---|---|
| Family ID | F060964 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 132 |
| Average Sequence Length | 42 residues |
| Representative Sequence | PFRITYAWLDGRDSIVLNEIRTNVPVDETKFGRPAPLKPR |
| Number of Associated Samples | 119 |
| Number of Associated Scaffolds | 132 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 1.52 % |
| % of genes near scaffold ends (potentially truncated) | 97.73 % |
| % of genes from short scaffolds (< 2000 bps) | 89.39 % |
| Associated GOLD sequencing projects | 114 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.28 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (60.606 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (11.364 % of family members) |
| Environment Ontology (ENVO) | Unclassified (19.697 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (48.485 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 5.88% β-sheet: 0.00% Coil/Unstructured: 94.12% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.28 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 132 Family Scaffolds |
|---|---|---|
| PF13620 | CarboxypepD_reg | 2.27 |
| PF08450 | SGL | 2.27 |
| PF02661 | Fic | 1.52 |
| PF07519 | Tannase | 1.52 |
| PF12796 | Ank_2 | 0.76 |
| PF08240 | ADH_N | 0.76 |
| PF05635 | 23S_rRNA_IVP | 0.76 |
| PF07631 | PSD4 | 0.76 |
| PF13360 | PQQ_2 | 0.76 |
| PF00589 | Phage_integrase | 0.76 |
| PF00005 | ABC_tran | 0.76 |
| COG ID | Name | Functional Category | % Frequency in 132 Family Scaffolds |
|---|---|---|---|
| COG3386 | Sugar lactone lactonase YvrE | Carbohydrate transport and metabolism [G] | 2.27 |
| COG3391 | DNA-binding beta-propeller fold protein YncE | General function prediction only [R] | 2.27 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 60.61 % |
| Unclassified | root | N/A | 39.39 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300004140|Ga0058894_1471061 | Not Available | 675 | Open in IMG/M |
| 3300005093|Ga0062594_102150018 | Not Available | 602 | Open in IMG/M |
| 3300005180|Ga0066685_10936080 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 577 | Open in IMG/M |
| 3300005329|Ga0070683_101078564 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 771 | Open in IMG/M |
| 3300005436|Ga0070713_101805965 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 593 | Open in IMG/M |
| 3300005450|Ga0066682_10640991 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 661 | Open in IMG/M |
| 3300005468|Ga0070707_100050571 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3984 | Open in IMG/M |
| 3300005541|Ga0070733_10365513 | Not Available | 958 | Open in IMG/M |
| 3300005544|Ga0070686_100547416 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 905 | Open in IMG/M |
| 3300005555|Ga0066692_10831856 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 567 | Open in IMG/M |
| 3300005558|Ga0066698_10734936 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 647 | Open in IMG/M |
| 3300005591|Ga0070761_10702641 | Not Available | 633 | Open in IMG/M |
| 3300005617|Ga0068859_101710070 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 695 | Open in IMG/M |
| 3300005764|Ga0066903_107386969 | Not Available | 568 | Open in IMG/M |
| 3300006034|Ga0066656_10586050 | Not Available | 722 | Open in IMG/M |
| 3300006049|Ga0075417_10084870 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1419 | Open in IMG/M |
| 3300006049|Ga0075417_10094986 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1346 | Open in IMG/M |
| 3300006050|Ga0075028_100068606 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1747 | Open in IMG/M |
| 3300006050|Ga0075028_100182465 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1125 | Open in IMG/M |
| 3300006050|Ga0075028_100471672 | Not Available | 729 | Open in IMG/M |
| 3300006354|Ga0075021_10168583 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1329 | Open in IMG/M |
| 3300006354|Ga0075021_10466600 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 797 | Open in IMG/M |
| 3300006791|Ga0066653_10262757 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 878 | Open in IMG/M |
| 3300006796|Ga0066665_10842012 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 718 | Open in IMG/M |
| 3300006871|Ga0075434_100648331 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1074 | Open in IMG/M |
| 3300009012|Ga0066710_102844632 | Not Available | 682 | Open in IMG/M |
| 3300009094|Ga0111539_11161628 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 897 | Open in IMG/M |
| 3300009137|Ga0066709_103460537 | Not Available | 573 | Open in IMG/M |
| 3300009162|Ga0075423_10199532 | All Organisms → cellular organisms → Bacteria | 2099 | Open in IMG/M |
| 3300009176|Ga0105242_11618097 | Not Available | 682 | Open in IMG/M |
| 3300009691|Ga0114944_1019161 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2350 | Open in IMG/M |
| 3300009792|Ga0126374_11818562 | Not Available | 510 | Open in IMG/M |
| 3300009809|Ga0105089_1064346 | Not Available | 594 | Open in IMG/M |
| 3300010043|Ga0126380_10148458 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Spongiibacteraceae | 1497 | Open in IMG/M |
| 3300010047|Ga0126382_11775975 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
| 3300010048|Ga0126373_10090470 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2810 | Open in IMG/M |
| 3300010120|Ga0127451_1020839 | Not Available | 533 | Open in IMG/M |
| 3300010141|Ga0127499_1028042 | Not Available | 555 | Open in IMG/M |
| 3300010304|Ga0134088_10116813 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1261 | Open in IMG/M |
| 3300010329|Ga0134111_10416703 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 577 | Open in IMG/M |
| 3300010333|Ga0134080_10642492 | Not Available | 521 | Open in IMG/M |
| 3300010358|Ga0126370_10901641 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 798 | Open in IMG/M |
| 3300010358|Ga0126370_11038653 | Not Available | 751 | Open in IMG/M |
| 3300010359|Ga0126376_11206866 | All Organisms → cellular organisms → Bacteria | 772 | Open in IMG/M |
| 3300010366|Ga0126379_12396322 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 627 | Open in IMG/M |
| 3300010366|Ga0126379_13447503 | Not Available | 530 | Open in IMG/M |
| 3300010379|Ga0136449_102157776 | Not Available | 815 | Open in IMG/M |
| 3300010400|Ga0134122_13029490 | Not Available | 524 | Open in IMG/M |
| 3300010401|Ga0134121_11092757 | Not Available | 790 | Open in IMG/M |
| 3300010860|Ga0126351_1176271 | Not Available | 508 | Open in IMG/M |
| 3300011120|Ga0150983_12580980 | Not Available | 767 | Open in IMG/M |
| 3300011120|Ga0150983_15442134 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1914 | Open in IMG/M |
| 3300011120|Ga0150983_16337827 | Not Available | 613 | Open in IMG/M |
| 3300011270|Ga0137391_10342532 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Spongiibacteraceae | 1285 | Open in IMG/M |
| 3300011423|Ga0137436_1001302 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 6801 | Open in IMG/M |
| 3300011429|Ga0137455_1002543 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 5085 | Open in IMG/M |
| 3300012199|Ga0137383_10121556 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1905 | Open in IMG/M |
| 3300012202|Ga0137363_10939414 | Not Available | 734 | Open in IMG/M |
| 3300012205|Ga0137362_11232825 | Not Available | 633 | Open in IMG/M |
| 3300012211|Ga0137377_11183753 | Not Available | 694 | Open in IMG/M |
| 3300012231|Ga0137465_1204071 | Not Available | 593 | Open in IMG/M |
| 3300012356|Ga0137371_10567174 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 873 | Open in IMG/M |
| 3300012361|Ga0137360_10948947 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 742 | Open in IMG/M |
| 3300012362|Ga0137361_10334636 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1388 | Open in IMG/M |
| 3300012379|Ga0134058_1164116 | Not Available | 611 | Open in IMG/M |
| 3300012469|Ga0150984_104420585 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300012923|Ga0137359_10694727 | All Organisms → cellular organisms → Bacteria | 887 | Open in IMG/M |
| 3300012944|Ga0137410_11113365 | Not Available | 677 | Open in IMG/M |
| 3300012948|Ga0126375_11208492 | Not Available | 629 | Open in IMG/M |
| 3300012971|Ga0126369_10612092 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1160 | Open in IMG/M |
| 3300013297|Ga0157378_10366722 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1411 | Open in IMG/M |
| 3300014154|Ga0134075_10517188 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 536 | Open in IMG/M |
| 3300014657|Ga0181522_10211994 | All Organisms → cellular organisms → Bacteria | 1141 | Open in IMG/M |
| 3300014866|Ga0180090_1004400 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2015 | Open in IMG/M |
| 3300015054|Ga0137420_1023078 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 514 | Open in IMG/M |
| 3300015054|Ga0137420_1251647 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2624 | Open in IMG/M |
| 3300015358|Ga0134089_10182010 | Not Available | 840 | Open in IMG/M |
| 3300015359|Ga0134085_10095170 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1232 | Open in IMG/M |
| 3300015359|Ga0134085_10327532 | All Organisms → cellular organisms → Bacteria | 677 | Open in IMG/M |
| 3300015371|Ga0132258_10981342 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2134 | Open in IMG/M |
| 3300015373|Ga0132257_103315021 | Not Available | 586 | Open in IMG/M |
| 3300015374|Ga0132255_101778193 | Not Available | 936 | Open in IMG/M |
| 3300016357|Ga0182032_11191914 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 655 | Open in IMG/M |
| 3300016371|Ga0182034_11753350 | Not Available | 547 | Open in IMG/M |
| 3300017657|Ga0134074_1366418 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 534 | Open in IMG/M |
| 3300017934|Ga0187803_10172155 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 852 | Open in IMG/M |
| 3300018033|Ga0187867_10187629 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → Pseudohongiella → Pseudohongiella spirulinae | 1179 | Open in IMG/M |
| 3300018482|Ga0066669_11676587 | Not Available | 583 | Open in IMG/M |
| 3300019228|Ga0180119_1293734 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 885 | Open in IMG/M |
| 3300019377|Ga0190264_11693145 | Not Available | 562 | Open in IMG/M |
| 3300021046|Ga0215015_11096793 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 703 | Open in IMG/M |
| 3300021151|Ga0179584_1270055 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 507 | Open in IMG/M |
| 3300021171|Ga0210405_11019093 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 623 | Open in IMG/M |
| 3300021362|Ga0213882_10422977 | Not Available | 565 | Open in IMG/M |
| 3300021388|Ga0213875_10009795 | All Organisms → cellular organisms → Bacteria | 4834 | Open in IMG/M |
| 3300021432|Ga0210384_10131589 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2245 | Open in IMG/M |
| 3300021477|Ga0210398_11174733 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 607 | Open in IMG/M |
| 3300021559|Ga0210409_11210584 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 631 | Open in IMG/M |
| 3300021858|Ga0213852_1217499 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300022509|Ga0242649_1025891 | Not Available | 729 | Open in IMG/M |
| 3300022529|Ga0242668_1147320 | Not Available | 515 | Open in IMG/M |
| 3300022724|Ga0242665_10237061 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 615 | Open in IMG/M |
| 3300022726|Ga0242654_10058049 | All Organisms → cellular organisms → Bacteria | 1116 | Open in IMG/M |
| 3300024330|Ga0137417_1057831 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 715 | Open in IMG/M |
| 3300024347|Ga0179591_1038708 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3494 | Open in IMG/M |
| 3300025920|Ga0207649_10761507 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 754 | Open in IMG/M |
| 3300025922|Ga0207646_10034133 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4598 | Open in IMG/M |
| 3300026332|Ga0209803_1054941 | All Organisms → cellular organisms → Bacteria | 1744 | Open in IMG/M |
| 3300026376|Ga0257167_1013606 | Not Available | 1114 | Open in IMG/M |
| 3300026540|Ga0209376_1328964 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 585 | Open in IMG/M |
| 3300026548|Ga0209161_10528259 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 524 | Open in IMG/M |
| 3300027680|Ga0207826_1028137 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1559 | Open in IMG/M |
| 3300027873|Ga0209814_10087221 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1318 | Open in IMG/M |
| 3300027873|Ga0209814_10461252 | Not Available | 561 | Open in IMG/M |
| 3300028906|Ga0308309_10907192 | Not Available | 765 | Open in IMG/M |
| 3300031114|Ga0308187_10245607 | Not Available | 648 | Open in IMG/M |
| 3300031114|Ga0308187_10318462 | Not Available | 589 | Open in IMG/M |
| 3300031231|Ga0170824_127315350 | Not Available | 579 | Open in IMG/M |
| 3300031538|Ga0310888_10532988 | Not Available | 706 | Open in IMG/M |
| 3300031708|Ga0310686_105180660 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1383 | Open in IMG/M |
| 3300031716|Ga0310813_12262103 | Not Available | 515 | Open in IMG/M |
| 3300031718|Ga0307474_11626655 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 507 | Open in IMG/M |
| 3300031720|Ga0307469_10210098 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1528 | Open in IMG/M |
| 3300031747|Ga0318502_10050551 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2187 | Open in IMG/M |
| 3300031823|Ga0307478_11057550 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 678 | Open in IMG/M |
| 3300031823|Ga0307478_11544724 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
| 3300031879|Ga0306919_11212269 | Not Available | 573 | Open in IMG/M |
| 3300031913|Ga0310891_10053429 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1138 | Open in IMG/M |
| 3300031947|Ga0310909_10723907 | Not Available | 826 | Open in IMG/M |
| 3300032261|Ga0306920_104272900 | Not Available | 514 | Open in IMG/M |
| 3300033812|Ga0364926_114754 | Not Available | 563 | Open in IMG/M |
| 3300033814|Ga0364930_0191677 | Not Available | 696 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 11.36% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 8.33% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 8.33% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 8.33% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 7.58% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 5.30% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.55% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 3.79% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 3.03% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.03% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.03% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.03% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.27% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.27% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.27% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.52% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.52% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.52% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.52% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 1.52% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.76% |
| Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 0.76% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.76% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.76% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.76% |
| Thermal Springs | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Thermal Springs | 0.76% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.76% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.76% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.76% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.76% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.76% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.76% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.76% |
| Exposed Rock | Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock | 0.76% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.76% |
| Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.76% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.76% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.76% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.76% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.76% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.76% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300004140 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF224 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009691 | Hot spring microbial communities from Beatty, Nevada to study Microbial Dark Matter (Phase II) - OV2 TP2 | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300009809 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_30_40 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010120 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_2_24_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010141 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_5_8_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300010860 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-2 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011423 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT119_2 | Environmental | Open in IMG/M |
| 3300011429 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT600_2 | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012231 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT828_2 | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012379 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
| 3300014657 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaG | Environmental | Open in IMG/M |
| 3300014866 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT890_16_10D | Environmental | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015359 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015 | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300017657 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015 | Environmental | Open in IMG/M |
| 3300017934 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3 | Environmental | Open in IMG/M |
| 3300018033 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_10 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019228 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT790_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019377 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T | Environmental | Open in IMG/M |
| 3300021046 | Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depth | Environmental | Open in IMG/M |
| 3300021151 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_06_16RNAfungal (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021362 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R09 | Environmental | Open in IMG/M |
| 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Host-Associated | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021858 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2015 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022509 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-27-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022529 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022724 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022726 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300024347 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026332 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes) | Environmental | Open in IMG/M |
| 3300026376 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-02-B | Environmental | Open in IMG/M |
| 3300026540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes) | Environmental | Open in IMG/M |
| 3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
| 3300027680 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 80 (SPAdes) | Environmental | Open in IMG/M |
| 3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300031114 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_182 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031538 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031913 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D4 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300033812 | Sediment microbial communities from East River floodplain, Colorado, United States - 65_j17 | Environmental | Open in IMG/M |
| 3300033814 | Sediment microbial communities from East River floodplain, Colorado, United States - 55_j17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0058894_14710611 | 3300004140 | Forest Soil | LKLPFRITYAWLDGRDSIVLTDIKTNVPVDEAKFGRPAPLKPR* |
| Ga0062594_1021500182 | 3300005093 | Soil | NGIKLPFRMTYAWLDGRDAIVLDEIRTNVPVDEAKFGRPAPLK* |
| Ga0066685_109360802 | 3300005180 | Soil | QKTCPKKDAFPFRITYAWLDGRDSIMLKEIKTNVPVDEAKFGRPAPLNPR* |
| Ga0070683_1010785641 | 3300005329 | Corn Rhizosphere | PFRITYAWLDGRDSIALREIKTNVPVDQAKFGKPAPLKPQ* |
| Ga0070713_1018059652 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | YRDVNGIKIPYRLTFAWLDGRDSIEIKDVQVNVPIPDAKFGTPEQAKGQ* |
| Ga0066682_106409912 | 3300005450 | Soil | QKTCPKKDAFPFRITYAWLDGRDSIMLKEIKTNVPVDEAKFGRPPPLNPR* |
| Ga0070707_1000505711 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | IKLPFRITYAWLDGRDAIVLNEIRTNVPVDDTKFGRPAPLKPQ* |
| Ga0070733_103655131 | 3300005541 | Surface Soil | KLPFRITYAWLDGRDSIVLNEIKTNVPVNEAKFGRPAPLNPK* |
| Ga0070686_1005474161 | 3300005544 | Switchgrass Rhizosphere | DVNGIKLPFRMTYAWLDGRDAIVLDEIRTNVPVDEAKFGRPAPLK* |
| Ga0066692_108318562 | 3300005555 | Soil | FRITYAWLDGRDSIVLNEIKTNVPASEAKFGRPAPLKTR* |
| Ga0066698_107349362 | 3300005558 | Soil | VNGIKLPFRITYAWLDGRDSIVLNEIQTNIAIDEAKFGRPAPLKPR* |
| Ga0070761_107026412 | 3300005591 | Soil | GMKFPFRIAYVWLDGRDSILLDEVKTNVPIEEAKFGRPAPLKK* |
| Ga0068859_1017100701 | 3300005617 | Switchgrass Rhizosphere | AWLDGRDSIVLNEVQTNVPVDETKFGRPTPLAAR* |
| Ga0066903_1073869691 | 3300005764 | Tropical Forest Soil | FRITYAWLDGRDAILLREITTNVPVDEAKFGRPAPLKR* |
| Ga0066656_105860501 | 3300006034 | Soil | PFRITFAWLDGRDSIVLNEIRTNVAIDEAKFGKPAPLKPR* |
| Ga0075417_100848701 | 3300006049 | Populus Rhizosphere | PFRITYAWLDGRDSIVLNEIKTNVPVEEAKFGKPAPLKPR* |
| Ga0075417_100949861 | 3300006049 | Populus Rhizosphere | VGGIKLPFRITYAWLDGRDSIVLNEIQTNVPVDETKFGRPAPLKPR* |
| Ga0075028_1000686064 | 3300006050 | Watersheds | YAWLGGRDSIVLREITPNAAIDEAKFGKPAPLKPR* |
| Ga0075028_1001824653 | 3300006050 | Watersheds | PFHITYAWLDGRDSIVLSEIKTNVAVDEAKFGKPAPLKKP* |
| Ga0075028_1004716722 | 3300006050 | Watersheds | NGIKLPFRITYAWLDGRDSIVLNDIKTNVAIDETKFGKPAPLKK* |
| Ga0075021_101685831 | 3300006354 | Watersheds | FHITYAWLGGRDSIVLREITLNAAIDEAKFGKPAPLKPR* |
| Ga0075021_104666001 | 3300006354 | Watersheds | PHHLTFAWLDGRDSISLNDVKINVAVDETKFGKPAPLQR* |
| Ga0066653_102627573 | 3300006791 | Soil | FPFRITYAWLDGRDSIMLKEIKTNVPVDEAKFGRPAPLNPR* |
| Ga0066665_108420122 | 3300006796 | Soil | RVIRVIRGQKTCPKKDAFTFRITYAWLDGRDSIMLKEIKTNVPVDEAKFGRPAPLNPR* |
| Ga0075434_1006483311 | 3300006871 | Populus Rhizosphere | YAWLDGRDSIVLSEIRTNVPIDEAKFGKPAPLKR* |
| Ga0066710_1028446322 | 3300009012 | Grasslands Soil | FPFRITFAWLDGRDSIVLNEIRTNVAIDEAKFGKPAPLKPR |
| Ga0111539_111616281 | 3300009094 | Populus Rhizosphere | DVNGIKLPFRMTYAWLDGRDAIVLDEIRTNVPVDETKFGRPAPLK* |
| Ga0066709_1034605372 | 3300009137 | Grasslands Soil | ITFAWLDGRDSIVLIDIKTNVPVDEAKFGKPAPLNPR* |
| Ga0075423_101995324 | 3300009162 | Populus Rhizosphere | FRITYAWLDGRDAIVLNDVRTNVPVDDAKFGRPAPLTPR* |
| Ga0105242_116180972 | 3300009176 | Miscanthus Rhizosphere | NGIKLPFRITYAWLDGRDAIVLDDVRTNVAVDEGKFGRPAPLKPQ* |
| Ga0114944_10191614 | 3300009691 | Thermal Springs | NGIKLPFRITFAWLDGRDSIVLNTIATNIAIDQSKFGRPAPLKPR* |
| Ga0126374_118185621 | 3300009792 | Tropical Forest Soil | AWLDGRDSIVLSEIKTNVPIDEAKFGRPAPLKPR* |
| Ga0105089_10643461 | 3300009809 | Groundwater Sand | FRITFAWLDGRDSIVLNTITTNVPIDQTKFGRPAPLKSR* |
| Ga0126380_101484583 | 3300010043 | Tropical Forest Soil | YRDVNGIKLPFHITYAWLNRRDSIVLNEIKTNVPVDEAKFSKPAPLKPR* |
| Ga0126382_117759752 | 3300010047 | Tropical Forest Soil | KIPFRWTFAWLAGRDSIELKEVQTNVPIDEAKFGRPALMKGR* |
| Ga0126373_100904704 | 3300010048 | Tropical Forest Soil | TYAWLDGRDSIVLSEIKTNVPADEAKFGKPAPLKPR* |
| Ga0127451_10208391 | 3300010120 | Grasslands Soil | TFAWLDGRDSIVLNEVRTNLPVDEAKFGRPAPLKK* |
| Ga0127499_10280421 | 3300010141 | Grasslands Soil | DYRDIGGIRLPFRITYAWLNGRDSIVLNEIKTNVAVDEAKFGRPAPLKPR* |
| Ga0134088_101168133 | 3300010304 | Grasslands Soil | KFPFRITFAWLDGRDSIVLNEIRTNVAIDEAKFGKPAPLKPR* |
| Ga0134111_104167031 | 3300010329 | Grasslands Soil | KLPFRITYAWLDGRDSIVLNEIQTNIAIDEAKFGRPAPLKPR* |
| Ga0134080_106424921 | 3300010333 | Grasslands Soil | TFAWLDGRDSIVLNEIRTNVAIDEAKFGRPAPLKK* |
| Ga0126370_109016413 | 3300010358 | Tropical Forest Soil | YAWLDGRDSIVLNEIRTNVTIDETKFGRPAPVKR* |
| Ga0126370_110386532 | 3300010358 | Tropical Forest Soil | TYAWLDGRDSIVLSEIKTNTPVDETKFGRPAPVKPR* |
| Ga0126376_112068661 | 3300010359 | Tropical Forest Soil | KIAFRCTFAWLDGRDSIELKEVQTNVPIDDARFGRPAQVKGR* |
| Ga0126379_123963221 | 3300010366 | Tropical Forest Soil | DYRDVNGIKLPFRITYAWLDGRDSILLKEITTNVPVDEAKFGRPAPLKR* |
| Ga0126379_134475031 | 3300010366 | Tropical Forest Soil | ITYAWLDGRDSIVLSEIKTNVSVDEAKFGKPGPLKR* |
| Ga0136449_1021577762 | 3300010379 | Peatlands Soil | FAWLDGRDSIELKEVQTNVPIDEAKFGRPATMKGR* |
| Ga0134122_130294901 | 3300010400 | Terrestrial Soil | LPFRITYAWLDGRDAIVLNEIQTNVPVDETKFGRPAPLR* |
| Ga0134121_110927573 | 3300010401 | Terrestrial Soil | GIKLPFRITYAWLDGRDSIVLNDIKTNVPIDDAKFGRPAPMKK* |
| Ga0126351_11762711 | 3300010860 | Boreal Forest Soil | RITYAWLDGRDAIELREIKTNVPVDEAKFGKPAPLKPR* |
| Ga0150983_125809801 | 3300011120 | Forest Soil | PFRITYAWLDGRDSIVLNDIKTNVAVDDAKFGKPAPMKK* |
| Ga0150983_154421344 | 3300011120 | Forest Soil | ADYKDVNGIKLPFRITYAWLDGRDSIVLNEIKTNVPIDEAKFGRPAPLKK* |
| Ga0150983_163378271 | 3300011120 | Forest Soil | NGIKLPFRITYAWLDGRDSIVLSEIKTNVAIDEAKFGRPAPLKR* |
| Ga0137391_103425323 | 3300011270 | Vadose Zone Soil | LPSGYPWLDGHDSIVLNDIKINVPIDEAKFGRPAPMKPK* |
| Ga0137436_10013021 | 3300011423 | Soil | IKLPFRITYAWLDGRDAIVLNEIQTNVPVDEAKFGRPAPLK* |
| Ga0137455_10025436 | 3300011429 | Soil | YRDVNGIKLPFRITYAWLDGRDAIVLNEIQTNVPIDEAKFGRPAPLK* |
| Ga0137383_101215561 | 3300012199 | Vadose Zone Soil | TYAWLDGRDSIVLNDIKTNVPVDETKFGKPAPLKPR* |
| Ga0137363_109394141 | 3300012202 | Vadose Zone Soil | YAWLDGRDSIVLTEIKTNVPVDEAKFGKPAPLKPQ* |
| Ga0137362_112328251 | 3300012205 | Vadose Zone Soil | YAWLDGRDSIVLNEIRTNVPVDETKFGRPAPLKAR* |
| Ga0137377_111837532 | 3300012211 | Vadose Zone Soil | PFRITYAWLDGRDSIVLSEIKTNVPIDESTFGRPAPLKR* |
| Ga0137465_12040711 | 3300012231 | Soil | GIKLPFRITYAWLDGRDAIVLNEIQTNVPIDEAKFGRPAPLK* |
| Ga0137371_105671743 | 3300012356 | Vadose Zone Soil | DVSGIKLPFRITYAWLDGRDSIVLNDIKTNVPVDETKFGKPAPLKPR* |
| Ga0137360_109489472 | 3300012361 | Vadose Zone Soil | IELPFRISYAWLDGRDPIILNDIKANVPVSEAKFGRPAPLKA* |
| Ga0137361_103346362 | 3300012362 | Vadose Zone Soil | GIKLPFRITYAWLDGRDSIVLNEIKTNVPVDEAKFGRPAPLKR* |
| Ga0134058_11641162 | 3300012379 | Grasslands Soil | ITFAWLDGRDSIVLNEIRTNVAIDEAKFGRPAPLKK* |
| Ga0150984_1044205852 | 3300012469 | Avena Fatua Rhizosphere | AWLDGRDSIVLSEIKTNVPIDEAKFGRPAPLKAR* |
| Ga0137359_106947271 | 3300012923 | Vadose Zone Soil | TYAWLDGRDSIVLTEIKTNVPVDEAKFGKPAPLKPR* |
| Ga0137410_111133651 | 3300012944 | Vadose Zone Soil | PFRITYAWLDGRDSIVLNDIKTNVPIDEAKFARPAPMKKP* |
| Ga0126375_112084922 | 3300012948 | Tropical Forest Soil | RITYAWLDGRDSIVLSEIRTNVPIDEAKFGKPAPLKR* |
| Ga0126369_106120921 | 3300012971 | Tropical Forest Soil | PFRITYAWLDGRDSIVLNEIRTNVPVDETKFGRPAPLKPR* |
| Ga0157378_103667223 | 3300013297 | Miscanthus Rhizosphere | YAWLDGRDSIVLNEIQTNVPVDEAKFGKPAPLKPRR* |
| Ga0134075_105171881 | 3300014154 | Grasslands Soil | TYAWLDGRDTIMLSEIKTNVPVDESKFERPAPVKQR* |
| Ga0181522_102119942 | 3300014657 | Bog | MPFRMTFAWLNGRDAIRLNEVRANVSIDPAVFGKPATRQTAGSK* |
| Ga0180090_10044001 | 3300014866 | Soil | RITYAWLDGRDAIVLNEIQTNVPIDEAKFGRPAPLK* |
| Ga0137420_10230781 | 3300015054 | Vadose Zone Soil | GIELPFRITYAWLDGRDPIILNDIKANVPVSEAKFGAKFGRPAPLKA* |
| Ga0137420_12516474 | 3300015054 | Vadose Zone Soil | VALPNGIELPFRITYAWLDGRDPIILNDIKANVPVSEAKFGRPAPLKA* |
| Ga0134089_101820103 | 3300015358 | Grasslands Soil | KFPFRITFAWLDGRDSIVLNEIRTNVAIDEAKFGRPAPLKK* |
| Ga0134085_100951701 | 3300015359 | Grasslands Soil | CPKKDAFPFRITYAWLDGRDSIMLKEIKTNVPVDEAKFGRPAPLNPR* |
| Ga0134085_103275322 | 3300015359 | Grasslands Soil | DFADYKDVNGIKLPFRITYAWLDGRDSIVLSEIKTNVPIDEAKFGRPAPVKK* |
| Ga0132258_109813424 | 3300015371 | Arabidopsis Rhizosphere | LPFRMTFAWLDGRDAIVLDEIRTNVPVDEAKFGKPAPLK* |
| Ga0132257_1033150211 | 3300015373 | Arabidopsis Rhizosphere | RITYAWLDGRDSILLTEITTNVPIDEGKFGKPAPLKR* |
| Ga0132255_1017781931 | 3300015374 | Arabidopsis Rhizosphere | FRMTYAWLDGRDAIVLDEIRTNVPVDEAKFGRPALLQK* |
| Ga0182032_111919142 | 3300016357 | Soil | VNGIKLPFRITYAWLDGRDSIVLSEIKTNVRADEAK |
| Ga0182034_117533502 | 3300016371 | Soil | FHITYAWLDGRDSIVLNDIKTNVPVDDSKFAKPAPLKK |
| Ga0134074_13664181 | 3300017657 | Grasslands Soil | PFRITYAWLDGRDSIMLSEVTTNVPVDEAKFGRPAPLKPR |
| Ga0187803_101721551 | 3300017934 | Freshwater Sediment | VNGIKLPFRITYAWLDVRDSIVLTEIKTNVAVDDAKFGKP |
| Ga0187867_101876291 | 3300018033 | Peatland | VNGIKLPFHITYAWLDGRDSIMLSEIKTNVAIDEAKFGRPAPLKR |
| Ga0066669_116765871 | 3300018482 | Grasslands Soil | GLKLPFRITYAWLDGRDAIVLNEIRTNVPVDDVKFGRPAPLKPQ |
| Ga0180119_12937341 | 3300019228 | Groundwater Sediment | RITYAWLDGRDAIVLNEIQTNVPIDEAKFGRPAPLK |
| Ga0190264_116931452 | 3300019377 | Soil | FRITYAWLDGRDSIVLNDVQTNVPVDETKFGRPAPLKPR |
| Ga0215015_110967932 | 3300021046 | Soil | FRITYAWLDGRDSIVLNEIKTNVPISEAKFGRPAPLNVR |
| Ga0179584_12700551 | 3300021151 | Vadose Zone Soil | IELPFRITYAWLDGRDPIVLNDIKANVPVSEAKFGRPAPLKA |
| Ga0210405_110190932 | 3300021171 | Soil | TYAWLDGRDSIVLNDIKTNVQVSEAKFDRPAPLKAR |
| Ga0213882_104229772 | 3300021362 | Exposed Rock | GIKLPFRILYAWLDGRDSIVLSEIKTNVAVDEAKFGRPAPLKPR |
| Ga0213875_100097951 | 3300021388 | Plant Roots | PLPSAFTYAWLDGRDSIVLNEIETNVPIEEAKFGKPAPLKAR |
| Ga0210384_101315894 | 3300021432 | Soil | GIQFPFHITYAWLDGRDSIVLSEVKTNVPIDEAKFGRPAPLKK |
| Ga0210398_111747333 | 3300021477 | Soil | PFHIAYVWLDGRDSIVLDDVKTNVPIDEAKFGRPAPLKKK |
| Ga0210409_112105841 | 3300021559 | Soil | PSRITYAWLDGRDSIVLSEIKTNVPVSEEKFGRPAPLKAR |
| Ga0213852_12174992 | 3300021858 | Watersheds | NGIKLPFRITYAWLDGRDSIVLNDIKTNVAIDESKFGKPAPLKK |
| Ga0242649_10258911 | 3300022509 | Soil | RDVNGIKLPFRISYVWLDGRDSILLSNIKTNVAIDETKFGRPAPLKK |
| Ga0242668_11473201 | 3300022529 | Soil | LPFHIAYVWLDGRDSIELNEIRTNVPIDEAKFGRPAPMKKK |
| Ga0242665_102370611 | 3300022724 | Soil | SRITYAWLDGRDSIVLSEIKTNVPVSEEKFGRPAPLKSR |
| Ga0242654_100580493 | 3300022726 | Soil | YANYRDVNGLKLPFRITYAWLDGRDSIVLTDIKTNVPIDEAKFGRPAPLKPR |
| Ga0137417_10578312 | 3300024330 | Vadose Zone Soil | FRISYAWLDGRDPIILNDIKANVPVSEAKFGRPAPLKA |
| Ga0179591_10387084 | 3300024347 | Vadose Zone Soil | MPFRITFAWLNGRDAIRLTEVKTNIAIDPALFGKPKPLPKPAISGE |
| Ga0207649_107615071 | 3300025920 | Corn Rhizosphere | GIKLPFRMTYAWLDGRDAIVLDEIRTNVPVDEAKFGRPAPLK |
| Ga0207646_100341331 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | IKLPFRITYAWLDGRDAIVLNEIRTNVPVDDTKFGRPAPLKPQ |
| Ga0209803_10549413 | 3300026332 | Soil | KFPFRITFAWLDGRDSIVLNEIRTNVAIDEAKFGKPAPLKPR |
| Ga0257167_10136061 | 3300026376 | Soil | RHVALPNGIELPFRISYAWLDGRDPIILNDIKANVPVSEAKFGRPAPLKA |
| Ga0209376_13289642 | 3300026540 | Soil | QKTCPKKDAFPFRITYAWLDGRDSIMLKEIKTNVPVDEAKFGRPAPLNPR |
| Ga0209161_105282592 | 3300026548 | Soil | KFPFRITYAWLDGRDTIMLSEIKTNVPVDEAKFGRPAPLKPR |
| Ga0207826_10281373 | 3300027680 | Tropical Forest Soil | FKLPFRITYAWLDGRDSIVLNDIKTNVAIDETKFGKPAPLKK |
| Ga0209814_100872211 | 3300027873 | Populus Rhizosphere | TYAWLDGRDSIVLNEIQTNVPVDETKFGRPAPLKPR |
| Ga0209814_104612522 | 3300027873 | Populus Rhizosphere | RITYAWLDGRDSIVLNEIKTNVPVEEAKFGKPAPLKPR |
| Ga0308309_109071921 | 3300028906 | Soil | ITYAWLDGRDSIVLNEIKTNVPVSEAKFGRPAPLKAR |
| Ga0308187_102456071 | 3300031114 | Soil | IKLAFRITYAWLDGRDSIVLNEIQTNVPVDEAKFGKPAPLKPRR |
| Ga0308187_103184622 | 3300031114 | Soil | YAWLDGRDAIVLNEIQTNVPVDEAKFGRPAPLRPQ |
| Ga0170824_1273153501 | 3300031231 | Forest Soil | LKLPFRITYAWLDGRDAIELREIKTNVAVDEAKFGKPAPLKPR |
| Ga0310888_105329883 | 3300031538 | Soil | FRITFAWLDGRDSIVLNNITANVAIAAAKFGRPAPLKPSR |
| Ga0310686_1051806601 | 3300031708 | Soil | VNGMKFPFRIAYVWLDGRDSIILDDVKTNVPIDEAKFGRPAPLKK |
| Ga0310813_122621031 | 3300031716 | Soil | FRITYAWLDGRDAIELREIKTNVPVDEAKFGKPAPLKPR |
| Ga0307474_116266552 | 3300031718 | Hardwood Forest Soil | LPSRITYAWLDGRDSIVLSEIKTNVPVGEEKFGRPAPLKAR |
| Ga0307469_102100981 | 3300031720 | Hardwood Forest Soil | KLPFRITYAWLDGRDAIVLDQVQTNVPVDEAKFGRPAPLKTQ |
| Ga0318502_100505511 | 3300031747 | Soil | IKLPFRITYAWLDGRDSIELTDIKTNVPIDEAKFGRPAPLKPR |
| Ga0307478_110575502 | 3300031823 | Hardwood Forest Soil | YRDVNGIKLPFRITYAWLDGRDSIVLNEIKTNVPVSEAKFGRPAPLKAR |
| Ga0307478_115447242 | 3300031823 | Hardwood Forest Soil | YRDVNGIKMPYRLTFAWLDGRDSIEIKDVQVNVPIPEAKFGTPEQVKGQ |
| Ga0306919_112122691 | 3300031879 | Soil | LPFRITYAWLDGRDSIELTDIKTNVPIDEAKFGRPAPLKPR |
| Ga0310891_100534291 | 3300031913 | Soil | FPFRITFAWLDGRDSIVLNNITANVAIAAAKFGRPAPLKPSR |
| Ga0310909_107239073 | 3300031947 | Soil | DVNGIKLPFHLTYAWLDGRDSIVLNDIKTNVPIDESKFGKPAPLKK |
| Ga0306920_1042729002 | 3300032261 | Soil | YKDVNGIKLPFRITYAWLDGRDSIVLNEIKTNVPVDEAKFGRPAPVKK |
| Ga0364926_114754_2_154 | 3300033812 | Sediment | DYRDVNGIKLPFRITFAWLDGRDSIILNDITTNVPIDQAKFGRPAPLKPR |
| Ga0364930_0191677_2_145 | 3300033814 | Sediment | DVNGIKLPFRITFAWLDGRDSIILNDITTNVPIDQAKFGRPAPLKPR |
| ⦗Top⦘ |