


| Basic Information | |
|---|---|
| Family ID | F060713 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 132 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MNKRSTLGGGTLLALALLFIGLTVLFNYALRGWRLDLTQNRLY |
| Number of Associated Samples | 122 |
| Number of Associated Scaffolds | 132 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 88.64 % |
| % of genes near scaffold ends (potentially truncated) | 99.24 % |
| % of genes from short scaffolds (< 2000 bps) | 90.15 % |
| Associated GOLD sequencing projects | 119 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.47 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (67.424 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (18.939 % of family members) |
| Environment Ontology (ENVO) | Unclassified (32.576 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (40.909 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 47.89% β-sheet: 0.00% Coil/Unstructured: 52.11% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.47 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 132 Family Scaffolds |
|---|---|---|
| PF12679 | ABC2_membrane_2 | 38.64 |
| PF12730 | ABC2_membrane_4 | 10.61 |
| PF03379 | CcmB | 4.55 |
| PF00005 | ABC_tran | 4.55 |
| PF01694 | Rhomboid | 1.52 |
| PF00106 | adh_short | 0.76 |
| PF09334 | tRNA-synt_1g | 0.76 |
| PF01614 | IclR | 0.76 |
| PF00392 | GntR | 0.76 |
| PF11755 | DUF3311 | 0.76 |
| COG ID | Name | Functional Category | % Frequency in 132 Family Scaffolds |
|---|---|---|---|
| COG2386 | ABC-type transport system involved in cytochrome c biogenesis, permease component | Posttranslational modification, protein turnover, chaperones [O] | 4.55 |
| COG0705 | Membrane-associated serine protease, rhomboid family | Posttranslational modification, protein turnover, chaperones [O] | 1.52 |
| COG0018 | Arginyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.76 |
| COG0060 | Isoleucyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.76 |
| COG0143 | Methionyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.76 |
| COG0215 | Cysteinyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.76 |
| COG0495 | Leucyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.76 |
| COG0525 | Valyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.76 |
| COG1414 | DNA-binding transcriptional regulator, IclR family | Transcription [K] | 0.76 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 67.42 % |
| Unclassified | root | N/A | 32.58 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2029527000|GBANfinal_contig34314 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 567 | Open in IMG/M |
| 2088090014|GPIPI_17245539 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1607 | Open in IMG/M |
| 3300001174|JGI12679J13547_1008678 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae | 617 | Open in IMG/M |
| 3300001661|JGI12053J15887_10271026 | Not Available | 837 | Open in IMG/M |
| 3300002853|draft_1002668 | All Organisms → cellular organisms → Bacteria | 1836 | Open in IMG/M |
| 3300003316|rootH1_10063715 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 5470 | Open in IMG/M |
| 3300004479|Ga0062595_100180487 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1277 | Open in IMG/M |
| 3300005293|Ga0065715_11028446 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 527 | Open in IMG/M |
| 3300005328|Ga0070676_11220503 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 572 | Open in IMG/M |
| 3300005332|Ga0066388_106381691 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 595 | Open in IMG/M |
| 3300005336|Ga0070680_100274359 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1428 | Open in IMG/M |
| 3300005366|Ga0070659_101319377 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae | 640 | Open in IMG/M |
| 3300005434|Ga0070709_10135432 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Rudaea → Rudaea cellulosilytica | 1686 | Open in IMG/M |
| 3300005541|Ga0070733_10511932 | Not Available | 803 | Open in IMG/M |
| 3300005546|Ga0070696_100599119 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 888 | Open in IMG/M |
| 3300005549|Ga0070704_100068381 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae | 2569 | Open in IMG/M |
| 3300005598|Ga0066706_10342716 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Rudaea → Rudaea cellulosilytica | 1184 | Open in IMG/M |
| 3300005602|Ga0070762_10047382 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2360 | Open in IMG/M |
| 3300005602|Ga0070762_10566662 | Not Available | 751 | Open in IMG/M |
| 3300005614|Ga0068856_100565361 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Rudaea → Rudaea cellulosilytica | 1158 | Open in IMG/M |
| 3300005719|Ga0068861_101828685 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 603 | Open in IMG/M |
| 3300005764|Ga0066903_101854450 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae | 1154 | Open in IMG/M |
| 3300005844|Ga0068862_101495125 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 681 | Open in IMG/M |
| 3300005844|Ga0068862_102630040 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 515 | Open in IMG/M |
| 3300006804|Ga0079221_10483356 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 798 | Open in IMG/M |
| 3300009093|Ga0105240_10353810 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1666 | Open in IMG/M |
| 3300009143|Ga0099792_10140922 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas | 1318 | Open in IMG/M |
| 3300009174|Ga0105241_11730351 | Not Available | 608 | Open in IMG/M |
| 3300009174|Ga0105241_12517194 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 516 | Open in IMG/M |
| 3300009789|Ga0126307_11100858 | Not Available | 642 | Open in IMG/M |
| 3300010321|Ga0134067_10074430 | Not Available | 1129 | Open in IMG/M |
| 3300010360|Ga0126372_12190460 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 602 | Open in IMG/M |
| 3300010371|Ga0134125_12531425 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 558 | Open in IMG/M |
| 3300010376|Ga0126381_104574147 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 533 | Open in IMG/M |
| 3300010376|Ga0126381_104682684 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 527 | Open in IMG/M |
| 3300010401|Ga0134121_10610688 | Not Available | 1022 | Open in IMG/M |
| 3300011120|Ga0150983_15315693 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 534 | Open in IMG/M |
| 3300012199|Ga0137383_11260577 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 529 | Open in IMG/M |
| 3300012285|Ga0137370_10684348 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 637 | Open in IMG/M |
| 3300012582|Ga0137358_10747116 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 653 | Open in IMG/M |
| 3300012925|Ga0137419_11682897 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 541 | Open in IMG/M |
| 3300012975|Ga0134110_10065772 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1439 | Open in IMG/M |
| 3300012977|Ga0134087_10011567 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 3061 | Open in IMG/M |
| 3300014325|Ga0163163_10139931 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2462 | Open in IMG/M |
| 3300014493|Ga0182016_10227423 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1184 | Open in IMG/M |
| 3300014968|Ga0157379_10760097 | Not Available | 913 | Open in IMG/M |
| 3300015053|Ga0137405_1100914 | Not Available | 1045 | Open in IMG/M |
| 3300015241|Ga0137418_10298310 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1349 | Open in IMG/M |
| 3300015241|Ga0137418_10415864 | Not Available | 1094 | Open in IMG/M |
| 3300017930|Ga0187825_10331282 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 573 | Open in IMG/M |
| 3300017959|Ga0187779_10024128 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 3479 | Open in IMG/M |
| 3300017972|Ga0187781_10147282 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1651 | Open in IMG/M |
| 3300017975|Ga0187782_11425607 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 545 | Open in IMG/M |
| 3300018086|Ga0187769_11290533 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 552 | Open in IMG/M |
| 3300019789|Ga0137408_1326305 | Not Available | 1289 | Open in IMG/M |
| 3300020078|Ga0206352_10979293 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 522 | Open in IMG/M |
| 3300020082|Ga0206353_11403272 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 628 | Open in IMG/M |
| 3300020140|Ga0179590_1100606 | Not Available | 779 | Open in IMG/M |
| 3300021088|Ga0210404_10417004 | Not Available | 752 | Open in IMG/M |
| 3300021358|Ga0213873_10047610 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1125 | Open in IMG/M |
| 3300021475|Ga0210392_11405922 | Not Available | 522 | Open in IMG/M |
| 3300021476|Ga0187846_10428530 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 543 | Open in IMG/M |
| 3300021559|Ga0210409_10983450 | Not Available | 718 | Open in IMG/M |
| 3300021560|Ga0126371_12278330 | Not Available | 654 | Open in IMG/M |
| 3300023270|Ga0247784_1071440 | Not Available | 865 | Open in IMG/M |
| 3300024283|Ga0247670_1073938 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 621 | Open in IMG/M |
| 3300025544|Ga0208078_1071742 | Not Available | 718 | Open in IMG/M |
| 3300025911|Ga0207654_10237392 | All Organisms → cellular organisms → Bacteria | 1217 | Open in IMG/M |
| 3300025911|Ga0207654_11214629 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 550 | Open in IMG/M |
| 3300025912|Ga0207707_10066336 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3143 | Open in IMG/M |
| 3300025920|Ga0207649_10810295 | Not Available | 731 | Open in IMG/M |
| 3300025925|Ga0207650_10793787 | Not Available | 802 | Open in IMG/M |
| 3300025945|Ga0207679_10753688 | Not Available | 886 | Open in IMG/M |
| 3300025949|Ga0207667_10085614 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 3263 | Open in IMG/M |
| 3300025960|Ga0207651_10971512 | Not Available | 758 | Open in IMG/M |
| 3300026067|Ga0207678_11508184 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 593 | Open in IMG/M |
| 3300026078|Ga0207702_10924986 | Not Available | 864 | Open in IMG/M |
| 3300026271|Ga0209880_1056463 | Not Available | 848 | Open in IMG/M |
| 3300026329|Ga0209375_1254223 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 587 | Open in IMG/M |
| 3300026343|Ga0209159_1056219 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1897 | Open in IMG/M |
| 3300027109|Ga0208603_1041651 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 707 | Open in IMG/M |
| 3300027565|Ga0209219_1021935 | Not Available | 1566 | Open in IMG/M |
| 3300027576|Ga0209003_1070761 | Not Available | 640 | Open in IMG/M |
| 3300027590|Ga0209116_1061957 | All Organisms → cellular organisms → Bacteria | 813 | Open in IMG/M |
| 3300027616|Ga0209106_1009433 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2031 | Open in IMG/M |
| 3300027633|Ga0208988_1000670 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Neisseriales | 6368 | Open in IMG/M |
| 3300027667|Ga0209009_1178238 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 539 | Open in IMG/M |
| 3300027692|Ga0209530_1206570 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 541 | Open in IMG/M |
| 3300027727|Ga0209328_10135551 | Not Available | 751 | Open in IMG/M |
| 3300027869|Ga0209579_10589677 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 603 | Open in IMG/M |
| 3300027879|Ga0209169_10596029 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 578 | Open in IMG/M |
| 3300027889|Ga0209380_10242680 | Not Available | 1058 | Open in IMG/M |
| 3300027908|Ga0209006_11120188 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 619 | Open in IMG/M |
| 3300028379|Ga0268266_10149071 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2106 | Open in IMG/M |
| 3300028792|Ga0307504_10027479 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1477 | Open in IMG/M |
| 3300029999|Ga0311339_10805440 | Not Available | 904 | Open in IMG/M |
| 3300030503|Ga0311370_11711099 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 644 | Open in IMG/M |
| 3300031128|Ga0170823_14038026 | Not Available | 697 | Open in IMG/M |
| 3300031231|Ga0170824_112246668 | Not Available | 761 | Open in IMG/M |
| 3300031231|Ga0170824_127369614 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1098 | Open in IMG/M |
| 3300031573|Ga0310915_11154312 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 537 | Open in IMG/M |
| 3300031668|Ga0318542_10255760 | Not Available | 891 | Open in IMG/M |
| 3300031680|Ga0318574_10245659 | Not Available | 1035 | Open in IMG/M |
| 3300031681|Ga0318572_10894906 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 527 | Open in IMG/M |
| 3300031708|Ga0310686_117223782 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 515 | Open in IMG/M |
| 3300031715|Ga0307476_11098613 | Not Available | 584 | Open in IMG/M |
| 3300031723|Ga0318493_10455882 | Not Available | 703 | Open in IMG/M |
| 3300031754|Ga0307475_11188978 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 594 | Open in IMG/M |
| 3300031770|Ga0318521_10332386 | Not Available | 898 | Open in IMG/M |
| 3300031777|Ga0318543_10513286 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 537 | Open in IMG/M |
| 3300031793|Ga0318548_10414214 | Not Available | 660 | Open in IMG/M |
| 3300031796|Ga0318576_10106689 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1283 | Open in IMG/M |
| 3300031797|Ga0318550_10244033 | Not Available | 871 | Open in IMG/M |
| 3300031797|Ga0318550_10345034 | Not Available | 721 | Open in IMG/M |
| 3300031799|Ga0318565_10071188 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1641 | Open in IMG/M |
| 3300031846|Ga0318512_10243766 | Not Available | 886 | Open in IMG/M |
| 3300031893|Ga0318536_10676989 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 514 | Open in IMG/M |
| 3300031947|Ga0310909_10053119 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 3121 | Open in IMG/M |
| 3300032010|Ga0318569_10401277 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 639 | Open in IMG/M |
| 3300032025|Ga0318507_10426276 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 577 | Open in IMG/M |
| 3300032060|Ga0318505_10354287 | Not Available | 693 | Open in IMG/M |
| 3300032076|Ga0306924_12018586 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 594 | Open in IMG/M |
| 3300032089|Ga0318525_10330396 | Not Available | 783 | Open in IMG/M |
| 3300032094|Ga0318540_10418407 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 647 | Open in IMG/M |
| 3300032783|Ga0335079_10578741 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 1187 | Open in IMG/M |
| 3300032896|Ga0335075_10107175 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3633 | Open in IMG/M |
| 3300032896|Ga0335075_10651981 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Rudaea → Rudaea cellulosilytica | 1026 | Open in IMG/M |
| 3300032898|Ga0335072_10367797 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1563 | Open in IMG/M |
| 3300032898|Ga0335072_11661542 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 535 | Open in IMG/M |
| 3300032955|Ga0335076_10203737 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1881 | Open in IMG/M |
| 3300033134|Ga0335073_11510850 | Not Available | 647 | Open in IMG/M |
| 3300034268|Ga0372943_0839671 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 610 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 18.94% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 9.85% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 7.58% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 5.30% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 3.79% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.03% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.03% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.03% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.03% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 3.03% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.27% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.27% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.27% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.27% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.27% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.27% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.52% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.52% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.52% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 1.52% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.52% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.52% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.52% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.52% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.76% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.76% |
| Hydrocarbon Resource Environments | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Hydrocarbon Resource Environments | 0.76% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.76% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.76% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.76% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.76% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.76% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.76% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.76% |
| Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 0.76% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.76% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.76% |
| Sugarcane Root And Bulk Soil | Host-Associated → Plants → Rhizome → Unclassified → Unclassified → Sugarcane Root And Bulk Soil | 0.76% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.76% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.76% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.76% |
| Green-Waste Compost | Engineered → Solid Waste → Grass → Composting → Bioreactor → Green-Waste Compost | 0.76% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2029527000 | Green-waste compost microbial community at University of California, Davis, USA, from solid state bioreactor - Inoculum 16S MiniPCR | Engineered | Open in IMG/M |
| 2088090014 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001174 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M1 | Environmental | Open in IMG/M |
| 3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
| 3300002853 | PDIso9.ppmwps2 | Environmental | Open in IMG/M |
| 3300003316 | Sugarcane root Sample L1 | Host-Associated | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
| 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
| 3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
| 3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014493 | Permafrost microbial communities from Stordalen Mire, Sweden - 712S2M metaG | Environmental | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020140 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Host-Associated | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021476 | Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2) | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300023270 | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L169-409R-5 | Environmental | Open in IMG/M |
| 3300024283 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK11 | Environmental | Open in IMG/M |
| 3300025544 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-2 deep-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026271 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-191 (SPAdes) | Environmental | Open in IMG/M |
| 3300026329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 (SPAdes) | Environmental | Open in IMG/M |
| 3300026343 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 (SPAdes) | Environmental | Open in IMG/M |
| 3300027109 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF008 (SPAdes) | Environmental | Open in IMG/M |
| 3300027565 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027576 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027590 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027616 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027633 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027667 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027692 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027727 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028792 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S | Environmental | Open in IMG/M |
| 3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030503 | III_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
| 3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
| 3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
| 3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
| 3300031799 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21 | Environmental | Open in IMG/M |
| 3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
| 3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
| 3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
| 3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
| 3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032896 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4 | Environmental | Open in IMG/M |
| 3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| 3300034268 | Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_FRD_1.2 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| GBAN_4131160 | 2029527000 | Green-Waste Compost | MTKRSTLGGGALIGLALLFIGLTVLFSHLLRGWRIDLTEN |
| GPIPI_01953950 | 2088090014 | Soil | MNKRSTLGGGTLLALALLFIGLTVLFNYXXXXXXI |
| JGI12679J13547_10086782 | 3300001174 | Forest Soil | MNKRSTLGGGTLLALALLFIGLTMLFNHALRGWRLDLTQHRLYT |
| JGI12053J15887_102710261 | 3300001661 | Forest Soil | MNKRSTLGGGALLALALLLIGLTMLFNHALRGWRLDLTQ |
| draft_10026683 | 3300002853 | Hydrocarbon Resource Environments | MNKRSTLGGGTLLALALLFIGLTVLGNYALRGWRLDLTQN |
| rootH1_100637157 | 3300003316 | Sugarcane Root And Bulk Soil | MTNRSTLGGGALLALALLLIGLTVLFDHALRGWRIDLTANH |
| Ga0062595_1001804871 | 3300004479 | Soil | MNKRSTLGGGTLLALGLLLIGLTVLFNYALRGWRLDLTQNRLYTT |
| Ga0065715_110284461 | 3300005293 | Miscanthus Rhizosphere | MIKRSTLGGGALLALALLFIGLTVLFNSSLRGWRLDLTANRLYTTA |
| Ga0070676_112205032 | 3300005328 | Miscanthus Rhizosphere | MTKRSTIGSGALIALAVLFIGLTILFASLLRGWRLDLTQNG |
| Ga0066388_1063816911 | 3300005332 | Tropical Forest Soil | MALSKRSTIGGGALIALVLLFIGLTILFGTVFRGWRIDLTQNGLY |
| Ga0070680_1002743593 | 3300005336 | Corn Rhizosphere | MTKRSKLGAGTLAALALVFIGLTILFQHSLRGWRLDLTQNHLYTTAP |
| Ga0070659_1013193771 | 3300005366 | Corn Rhizosphere | MTNRSTLGGGALLALALLLIGLTILFDHALRGWRVDLTANHLYTTAPGTDRILKG |
| Ga0070709_101354323 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MKRSILGGGTLIALAVLFVGLTVFFQHTLRGWRLDLTENHLY |
| Ga0070733_105119321 | 3300005541 | Surface Soil | MNKRSTLGGGALLALALLFIGFTLLFNHALRGWRL |
| Ga0070696_1005991192 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | MNKRSTLGGGTLLALGLLLIGLTVLFNYALRGWRLDLTQNRLY |
| Ga0070704_1000683815 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | MIKRSTLGGGALLALALLFIGLTVLFNASLRGWRLDLTANR |
| Ga0066706_103427161 | 3300005598 | Soil | MNTRSTLGGGTLLGLALLFIGLTILFNHALRGWRLDLTQN |
| Ga0070762_100473821 | 3300005602 | Soil | MNKRSTLGGGALLALALLFVGFTLLFNHVLRGWRLDLTEN |
| Ga0070762_105666621 | 3300005602 | Soil | MTKRSTLGGGTLLALALLLIGLTMLFNHALRGWRLDL |
| Ga0068856_1005653613 | 3300005614 | Corn Rhizosphere | MTNRSTLGGGALLALALLLIGLTILFDHALRGWRVDLTA |
| Ga0068861_1018286852 | 3300005719 | Switchgrass Rhizosphere | MMTKRSTLGGGALIALALLFIGLTVLFGSVLRGWRIDLTQN |
| Ga0066903_1018544503 | 3300005764 | Tropical Forest Soil | MNKRSTLGGGMLLALALLFIGLTVLFNYTLRGWRLDLT |
| Ga0068862_1014951251 | 3300005844 | Switchgrass Rhizosphere | MSTPMKRSVLGGGALLALALLFIGLTILFGSLFRGWRVDLTQNGL |
| Ga0068862_1026300402 | 3300005844 | Switchgrass Rhizosphere | MAMTKRSTIGSGALIALAVLFIGLTILFASLLRGWRLDLTQNG |
| Ga0079221_104833562 | 3300006804 | Agricultural Soil | MMKRSTLGGGALIGLALLFIGLTILFNHSLRGWRLDLTQNHL |
| Ga0105240_103538103 | 3300009093 | Corn Rhizosphere | MTNRSTLGGGALLALALLLIGLTILFDHALRGWRVDLTANHLYTTAPGTDRILKGL |
| Ga0099792_101409221 | 3300009143 | Vadose Zone Soil | MTNRSTLGGSALIALALLLVGLTVLFDHALRGWRLDLTANHLYTTAPG |
| Ga0105241_117303511 | 3300009174 | Corn Rhizosphere | MTNRSTLGGGALLALALLLIGLTILFDHALRGWRVD |
| Ga0105241_125171942 | 3300009174 | Corn Rhizosphere | MTNRSTLGGGALIALALLLIGLTVLFDHALRGWRLDLTANHLYTTAPGTDRIL |
| Ga0126307_111008581 | 3300009789 | Serpentine Soil | MLTKRSTLGGGTLLALALIFIGLTILFSSLLTGWRLDLTENKLYSTAP |
| Ga0134067_100744303 | 3300010321 | Grasslands Soil | MNQRSTLGGGTLLALALLFIGLTILFNYALRGWRLDLTQNRLY |
| Ga0126372_121904602 | 3300010360 | Tropical Forest Soil | MMTKRSTLGGATLAGLALLFIGLTVLCNFALRGWRLDLTQNRL |
| Ga0134125_125314251 | 3300010371 | Terrestrial Soil | MTKRSTLGWGAVAALALAFIGLTIVFNYSLAGWQLDLTQNRLYTISPGTDRI |
| Ga0126381_1045741471 | 3300010376 | Tropical Forest Soil | MTKRSTLGGATLLALALLFIGLTVLFNFALRGWRVDLTQNH |
| Ga0126381_1046826842 | 3300010376 | Tropical Forest Soil | MAKRSTLGGGTLLALALIFIGLTILFNHALRGWRLDLTQN |
| Ga0134121_106106883 | 3300010401 | Terrestrial Soil | MNKRSTLGGGTLLALALLFIGLTVLFNYTLRGWRLDLTQNRLYTT |
| Ga0150983_153156932 | 3300011120 | Forest Soil | MTKRSTLGGGALVALALLFIGLTVLFNHTLRGWRLDLTQNRL |
| Ga0137383_112605772 | 3300012199 | Vadose Zone Soil | MNKRSTLGGGTLLALALLFIGLTILFNYALRGWRLDLTQNR |
| Ga0137370_106843482 | 3300012285 | Vadose Zone Soil | MNTRSTLGGGTLLGLALLFIGLTILFNHALRGWRL |
| Ga0137358_107471161 | 3300012582 | Vadose Zone Soil | MNKRSTLSGGTLLALALLFIGLTMLFNHALRGWRLDLTQHRL |
| Ga0137419_116828971 | 3300012925 | Vadose Zone Soil | MSKRATLGGGALLALALLLIGLTMLFNHALRGWRLDLTQNRLYTT |
| Ga0134110_100657723 | 3300012975 | Grasslands Soil | MNKRSTLGGGTLLALALLFIGLTILFNHALRGWRLDLTQNRLYTT |
| Ga0134087_100115675 | 3300012977 | Grasslands Soil | MNKRSTLGGGTLLALALLFIGLTILFNYALRGWRLDLTQNRLY |
| Ga0163163_101399315 | 3300014325 | Switchgrass Rhizosphere | MIKRSTLGGGALLALALLFIGLTVLFNASLRGWRLDLTANRLY |
| Ga0182016_102274233 | 3300014493 | Bog | MMKRSTLGAGTLVALALLFAGITLVAASVLRSWRID |
| Ga0157379_107600971 | 3300014968 | Switchgrass Rhizosphere | MALTKRSTIGGGALIALVLLFIGLTVLFASVFRGWRIDLTQNGLYT |
| Ga0137405_11009142 | 3300015053 | Vadose Zone Soil | MNKRSTLSGGTLLALALLFIGLTMLFNHALRGWRLDLTQHRLY |
| Ga0137418_102983101 | 3300015241 | Vadose Zone Soil | MNKRSTLSGGTLLALALLFIGLTMLFNHALRGWRLDLTQHRLYT |
| Ga0137418_104158643 | 3300015241 | Vadose Zone Soil | MSKRATLGGGALLALALLLIGLTMLFNHALRGWRLDLTQHRLYT |
| Ga0187825_103312821 | 3300017930 | Freshwater Sediment | MNKRVSLGGGVLVALALIFAGVAILLDHALRGARIDLTQNH |
| Ga0187779_100241286 | 3300017959 | Tropical Peatland | MNKRWTLGGGTIVALVLLFIGLTVLFNYALRGWRLDLTQNHL |
| Ga0187781_101472823 | 3300017972 | Tropical Peatland | MNKRSTLGGGTVLALALLFVGLTVLSNYALRGWRLDLTQNRLYTT |
| Ga0187782_114256071 | 3300017975 | Tropical Peatland | MRNRKTLGTGTLIALALLFAGITILGGMALRGWRIDLTQNHLY |
| Ga0187769_112905332 | 3300018086 | Tropical Peatland | MNKRSTLGGGTVLALALLFVGLTVLSNYALRGWRLDLT |
| Ga0137408_13263054 | 3300019789 | Vadose Zone Soil | MMNRSTLGGSALLALALLLVGLTVLFDHALRGWRLDLTANHLYTT |
| Ga0206352_109792932 | 3300020078 | Corn, Switchgrass And Miscanthus Rhizosphere | VTKRSKLGGSTLLALALLFVGLTLLFQHTLRGWRLDLTQNHLYTTAPGTN |
| Ga0206353_114032722 | 3300020082 | Corn, Switchgrass And Miscanthus Rhizosphere | MTKRSKLGGSTLLALALLFVGLTLLFQHALRGWRLDLTQNHLYT |
| Ga0179590_11006062 | 3300020140 | Vadose Zone Soil | MTKRSTLGGGTLLALALLFVGLTVLFNYALRGWRLDLTQNHLYT |
| Ga0210404_104170042 | 3300021088 | Soil | MKRSTLGGGTLLALALLFAGITMVGGYVLRSWRIDLTQNHLYTTAPGTDRI |
| Ga0213873_100476103 | 3300021358 | Rhizosphere | MTKRSTLGGGALLALALLFIGLTLLFNQTLRGWRLDLTANRL |
| Ga0210392_114059221 | 3300021475 | Soil | MTTKRLTLGGSTLVALALIFIALTVLFNYALRGWRLDLTQNH |
| Ga0187846_104285301 | 3300021476 | Biofilm | MKNPLTQRSTIGAGTLLALALLFVGLTILFNYALRGWRLDLTANHL |
| Ga0210409_109834502 | 3300021559 | Soil | MTKRSTLGGGTLLALALLLIGLTMLFNHALRGWRLDLTQNRLYTTAS |
| Ga0126371_122783302 | 3300021560 | Tropical Forest Soil | MTKRSTLGWGAVAALALAFIGLTILCNHSLAGWQL |
| Ga0247784_10714401 | 3300023270 | Plant Litter | MTKRSTLGIGALIALAVLFIGLTILFNSVLRGWRVDLTQ |
| Ga0247670_10739381 | 3300024283 | Soil | MNKRSTLGGGTLLALALLFIGLTVLFNYALRGWRLDLT |
| Ga0208078_10717421 | 3300025544 | Arctic Peat Soil | MIKRSTLGGGTLLALALLFVGLTILFDHALHGWRLDLTQN |
| Ga0207654_102373921 | 3300025911 | Corn Rhizosphere | MTKRSTIGGGVLLALALLFIGLTILFGNLLRGWRVDLTQNGLY |
| Ga0207654_112146291 | 3300025911 | Corn Rhizosphere | MTNRSTLGGGALLALALLLIGLTILFDHALRGWRVDLTANHLYTTAPGTD |
| Ga0207707_100663361 | 3300025912 | Corn Rhizosphere | MTKRSKLGGSTLLALALLFVGLTLLFQHALRGWRLDLTQNHLY |
| Ga0207649_108102951 | 3300025920 | Corn Rhizosphere | MTKRSKLGGSTLLALALLFVGLTLLFQHALRGWRLDLTQNHLYTT |
| Ga0207650_107937872 | 3300025925 | Switchgrass Rhizosphere | MTNRSTLGGGALLALALLLIGLTILFDHALRGWRVDLTANHLYTTAP |
| Ga0207679_107536881 | 3300025945 | Corn Rhizosphere | MTNRSTLGGGALLALALLLIGLTILFDHALRGWRVDLTANHLYT |
| Ga0207667_100856145 | 3300025949 | Corn Rhizosphere | MTKRSTLGWGAVAALALAFIGLTIVFNYSLAGWQLDLTQNRL |
| Ga0207651_109715122 | 3300025960 | Switchgrass Rhizosphere | MIKRSTLGGGALLALALLFIGLTVLFNSSLRGWRLDLT |
| Ga0207678_115081842 | 3300026067 | Corn Rhizosphere | MMTKRSTLGGGALLALALLFIGLTILFGSLLRGWRLDLTQN |
| Ga0207702_109249861 | 3300026078 | Corn Rhizosphere | MTKRSTLGWGAVAALALTFIGLTILFNYSLAGWQLDLTQNRLYTISP |
| Ga0209880_10564632 | 3300026271 | Soil | MIKRSTLGGGTLLALTLLFVGLTILFDHALHGWRLDLTQNR |
| Ga0209375_12542232 | 3300026329 | Soil | MNTRSTLGGGTLLALALLFIGLTILFNHALRGWRLDLT |
| Ga0209159_10562191 | 3300026343 | Soil | MNTRSTLGGGTLLGLALLFIGLTILFNHALRGWRLDLTQNRL |
| Ga0208603_10416511 | 3300027109 | Forest Soil | MTKRSTLGGGALVALALLFIGLTVLFNHTLRGWRLDLTQ |
| Ga0209219_10219353 | 3300027565 | Forest Soil | MNRRSRLGGGTLLGLGLLLVGLTVLFNYALRGWRL |
| Ga0209003_10707611 | 3300027576 | Forest Soil | MTRRSTLGGATLLALALLFIALTVLFNFSLRGWRLDLTQNHLYTTA |
| Ga0209116_10619571 | 3300027590 | Forest Soil | MKRSTLGGGTLIALALLFAGITLLSGYALRSWRIDLTQNRLYT |
| Ga0209106_10094333 | 3300027616 | Forest Soil | MNKRSTLSGGTLLALALLFIGLTMLFNHALRGWRLDLTQHRLYTTAA |
| Ga0208988_10006701 | 3300027633 | Forest Soil | MNKRSTLGGGTLLALALLFIGLTILFNHALRGWRL |
| Ga0209009_11782382 | 3300027667 | Forest Soil | MNKRSTLGGGTLLALALLFIGLTMLFNHALRGWRLDLTQH |
| Ga0209530_12065702 | 3300027692 | Forest Soil | MTKRSSLGWGAVAALALSCIGLTVLFNYSLAGWQLDLTQNRLYTISPGTDRILASIR |
| Ga0209328_101355512 | 3300027727 | Forest Soil | MNKRSTLGGGTLLALALLFIGLTMLFNHALRGWRLDL |
| Ga0209579_105896772 | 3300027869 | Surface Soil | MMKRSTLGGATLLAVALLFIGLTVLFNYTLRGWRADLTQ |
| Ga0209169_105960291 | 3300027879 | Soil | MNKRSTLGGGTLLALGLLFIGLTVLANYALRGWRLDLTQN |
| Ga0209380_102426801 | 3300027889 | Soil | MNKRSTLGGGTLLALALLFIGLTILFNHALRGWRLDLTQNRLYT |
| Ga0209006_111201881 | 3300027908 | Forest Soil | MTNRSTLGGGTLLALALLLIGLTVLFDHALRSWRLDLTANHLYTTAPGTDRILKGL |
| Ga0268266_101490714 | 3300028379 | Switchgrass Rhizosphere | MMNRSTLGGSALLALALLLVGLTVLFDHALRGWRL |
| Ga0307504_100274793 | 3300028792 | Soil | MNKRSTLSGGALLALALLFIGLTMLFNHALRGWRLDLTQHRLY |
| Ga0311339_108054402 | 3300029999 | Palsa | MMKRSTLGGGALLALALLFVGLTILFDHALHGWRVDLTQNRLYSTAPG |
| Ga0311370_117110991 | 3300030503 | Palsa | MMKRSTLGGGALLALALLFVGLTILFDHDLHGWRLDLTQNRLYST |
| Ga0170823_140380261 | 3300031128 | Forest Soil | MNKRSTLGGGALLALALLFIGLTLLFNHALRGWRLDL |
| Ga0170824_1122466682 | 3300031231 | Forest Soil | MMNRSTLGGSALLALALLLVGLTVLFDHALRGWRLDLTANHLY |
| Ga0170824_1273696141 | 3300031231 | Forest Soil | MTNRLTLGGGALLALALLLIGLTVLFDHALRGWRVDLTANHLYTTAPG |
| Ga0310915_111543122 | 3300031573 | Soil | MNKRSTLGGGMLLALALLFIGLTVLFNYTLRGWRLDLTHN |
| Ga0318542_102557601 | 3300031668 | Soil | MNKRSTLGGGMLLALALLFIGLTVLFNYTLRGWRLDLTHNRLY |
| Ga0318574_102456593 | 3300031680 | Soil | MNKRSTLGGGTLLALALLFIGLTVLFNYALRGWRLDLTQNRLY |
| Ga0318572_108949062 | 3300031681 | Soil | MNKRLTLGGGTLLALALLFIGLTVLFNYALRGWRLDLTQNRLYT |
| Ga0310686_1172237821 | 3300031708 | Soil | MKRSTLGSGSLIALALLFAGITMVGGYALRGWRIDLT |
| Ga0307476_110986131 | 3300031715 | Hardwood Forest Soil | MTKRLTLGGGTLLAVALIFIALTVLFNYGLRGWRLDLTQNHLYTTASG |
| Ga0318493_104558821 | 3300031723 | Soil | MNKRSTLGGGMLLALALLFIGLTVLFNYTLRGWRL |
| Ga0307475_111889781 | 3300031754 | Hardwood Forest Soil | MNKRSTLGGGTMLALALLFIGLTVLCNYVLRGWRLDLTQ |
| Ga0318521_103323861 | 3300031770 | Soil | MNKRLTLGGGTLLALALLFVGLTVLFNYALRGWRLDLTQNRLYTT |
| Ga0318543_105132862 | 3300031777 | Soil | MNKRSTLGGGTLLALALLFIGLTVLFNYALRGWRLDLTHNRLYT |
| Ga0318548_104142141 | 3300031793 | Soil | MNKRSTLGGGMLLALALLFIGLTVLFNYTLRGWRLD |
| Ga0318576_101066893 | 3300031796 | Soil | MNKRLTLGGGTLLALALLFVGLTVLFNYALRGWRLDLTQNRLYTTA |
| Ga0318550_102440331 | 3300031797 | Soil | MNKRSTLGGGTLLALALLFIGLTVLFNYTLRGWRLDLTHN |
| Ga0318550_103450341 | 3300031797 | Soil | MNKRSTLGGGMLLALALLFIGLTVLFNYTLRGWRLDLTHNRLYT |
| Ga0318565_100711881 | 3300031799 | Soil | MNKRSTLGGGMLLALALLFIGLTVLFNYTLRGWRLDLTHNRLYTT |
| Ga0318512_102437661 | 3300031846 | Soil | MNKRSTLGGGTLLALALLFIGLTVLFNYALRGWRLDLTQNRLYTTT |
| Ga0318536_106769892 | 3300031893 | Soil | MNKRLTLGGGTLVALALLFIGLTVLFNYALRGWRLDLTQN |
| Ga0310909_100531196 | 3300031947 | Soil | MNKRLTLGGGTLLALALLFIGLTVLFNYALRGWRL |
| Ga0318569_104012772 | 3300032010 | Soil | MNKRLTLGGGTLLALALLFIGLTVLFNYALRGWRLDLTQNRLYTT |
| Ga0318507_104262762 | 3300032025 | Soil | MNKRSTLGGGTLLALALLFIGLTVLFNYALRGWRLDLTHNRLYTT |
| Ga0318505_103542871 | 3300032060 | Soil | MNKRSTLGGGMLLALALLFIGLTVLFNYTLRGWRLDLTHNHLY |
| Ga0306924_120185862 | 3300032076 | Soil | MNKRSTLGGGMLLALALLFIGLTVLFNYALRGWRLDLT |
| Ga0318525_103303961 | 3300032089 | Soil | MTNRSTLGGGTLIALALLFAGITILAGYVLRGWRLD |
| Ga0318540_104184071 | 3300032094 | Soil | MNKRSTIGGGTLLALALLFIGLTVLFNYALRGWRLDLTQNRTYT |
| Ga0335079_105787413 | 3300032783 | Soil | MKRSTLGGGTLLALAVLFVGVTLVAGYLMRSWRIDLTQNHLYT |
| Ga0335075_101071756 | 3300032896 | Soil | MTKRSSLGWGAVAALALTFIGLTILCNYSLAGWQLDLTQN |
| Ga0335075_106519813 | 3300032896 | Soil | MMTKRTTIGGGVLLALALLFIGLTILFGSLLRGWRIDLTQNG |
| Ga0335072_103677971 | 3300032898 | Soil | MNKRLTLGGGALLALALIFAGVTILLNQALRGWRIDLTQNHLYTTA |
| Ga0335072_116615422 | 3300032898 | Soil | MTKRSTLGWGAVLALALAFIGLTIVFNYSLAGWQLDLTQNRL |
| Ga0335076_102037371 | 3300032955 | Soil | MNKRMTLGGGLLVALALLFAGVTILLGHALRGWRIDLTQNHLYTTAP |
| Ga0335073_115108501 | 3300033134 | Soil | VNKRLTFGGGVLVALALIFTGVTILLDHALRGARIDLTQNHLYTV |
| Ga0372943_0839671_3_131 | 3300034268 | Soil | MTNRSTLGGSALLALALLLVGLTVLFDHALRGWRLDLTANHLY |
| ⦗Top⦘ |