


| Basic Information | |
|---|---|
| Family ID | F060671 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 132 |
| Average Sequence Length | 45 residues |
| Representative Sequence | VSLLMLAVVALFPVVLLALLLITSGLEGRVVGDPTPRVGAGERPGPRDRR |
| Number of Associated Samples | 81 |
| Number of Associated Scaffolds | 132 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 50.00 % |
| % of genes near scaffold ends (potentially truncated) | 25.00 % |
| % of genes from short scaffolds (< 2000 bps) | 79.55 % |
| Associated GOLD sequencing projects | 74 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.43 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (91.667 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (18.939 % of family members) |
| Environment Ontology (ENVO) | Unclassified (27.273 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (32.576 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 29.49% β-sheet: 0.00% Coil/Unstructured: 70.51% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.43 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 132 Family Scaffolds |
|---|---|---|
| PF03167 | UDG | 40.91 |
| PF02811 | PHP | 34.85 |
| PF01523 | PmbA_TldD | 3.79 |
| PF13408 | Zn_ribbon_recom | 1.52 |
| PF00239 | Resolvase | 1.52 |
| PF02371 | Transposase_20 | 1.52 |
| PF00293 | NUDIX | 1.52 |
| PF12705 | PDDEXK_1 | 1.52 |
| PF01568 | Molydop_binding | 0.76 |
| PF07508 | Recombinase | 0.76 |
| PF13302 | Acetyltransf_3 | 0.76 |
| PF05239 | PRC | 0.76 |
| PF08281 | Sigma70_r4_2 | 0.76 |
| PF10944 | DUF2630 | 0.76 |
| PF05362 | Lon_C | 0.76 |
| PF13581 | HATPase_c_2 | 0.76 |
| PF05552 | TM_helix | 0.76 |
| COG ID | Name | Functional Category | % Frequency in 132 Family Scaffolds |
|---|---|---|---|
| COG0692 | Uracil-DNA glycosylase | Replication, recombination and repair [L] | 40.91 |
| COG1573 | Uracil-DNA glycosylase | Replication, recombination and repair [L] | 40.91 |
| COG3663 | G:T/U-mismatch repair DNA glycosylase | Replication, recombination and repair [L] | 40.91 |
| COG0312 | Zn-dependent protease PmbA/TldA or its inactivated homolog | General function prediction only [R] | 3.79 |
| COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 2.27 |
| COG2452 | Predicted site-specific integrase-resolvase | Mobilome: prophages, transposons [X] | 1.52 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 1.52 |
| COG0466 | ATP-dependent Lon protease, bacterial type | Posttranslational modification, protein turnover, chaperones [O] | 0.76 |
| COG0668 | Small-conductance mechanosensitive channel | Cell wall/membrane/envelope biogenesis [M] | 0.76 |
| COG1067 | Predicted ATP-dependent protease | Posttranslational modification, protein turnover, chaperones [O] | 0.76 |
| COG1750 | Predicted archaeal serine protease, S18 family | General function prediction only [R] | 0.76 |
| COG3264 | Small-conductance mechanosensitive channel MscK | Cell wall/membrane/envelope biogenesis [M] | 0.76 |
| COG3480 | Predicted secreted protein YlbL, contains PDZ domain | Signal transduction mechanisms [T] | 0.76 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 93.18 % |
| Unclassified | root | N/A | 6.82 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000443|F12B_11227412 | Not Available | 732 | Open in IMG/M |
| 3300003203|JGI25406J46586_10114331 | All Organisms → cellular organisms → Bacteria | 797 | Open in IMG/M |
| 3300003373|JGI25407J50210_10024800 | All Organisms → cellular organisms → Bacteria | 1555 | Open in IMG/M |
| 3300003373|JGI25407J50210_10098571 | All Organisms → cellular organisms → Bacteria | 723 | Open in IMG/M |
| 3300003373|JGI25407J50210_10109310 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia | 682 | Open in IMG/M |
| 3300003373|JGI25407J50210_10129573 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 621 | Open in IMG/M |
| 3300003373|JGI25407J50210_10134351 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
| 3300003373|JGI25407J50210_10153332 | Not Available | 567 | Open in IMG/M |
| 3300005562|Ga0058697_10048190 | All Organisms → cellular organisms → Bacteria | 1624 | Open in IMG/M |
| 3300005562|Ga0058697_10488349 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
| 3300005562|Ga0058697_10545155 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
| 3300005843|Ga0068860_100516448 | All Organisms → cellular organisms → Bacteria | 1194 | Open in IMG/M |
| 3300005937|Ga0081455_10378422 | All Organisms → cellular organisms → Bacteria | 990 | Open in IMG/M |
| 3300005981|Ga0081538_10013059 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 6607 | Open in IMG/M |
| 3300005981|Ga0081538_10035304 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3286 | Open in IMG/M |
| 3300005981|Ga0081538_10040030 | All Organisms → cellular organisms → Bacteria | 2995 | Open in IMG/M |
| 3300005981|Ga0081538_10339233 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
| 3300005981|Ga0081538_10340891 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
| 3300005985|Ga0081539_10024818 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3877 | Open in IMG/M |
| 3300005985|Ga0081539_10165127 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1052 | Open in IMG/M |
| 3300006049|Ga0075417_10376620 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 699 | Open in IMG/M |
| 3300006852|Ga0075433_10070574 | All Organisms → Viruses → Predicted Viral | 3070 | Open in IMG/M |
| 3300006880|Ga0075429_100411197 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1185 | Open in IMG/M |
| 3300006880|Ga0075429_101016500 | All Organisms → cellular organisms → Bacteria | 725 | Open in IMG/M |
| 3300006904|Ga0075424_100867322 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 963 | Open in IMG/M |
| 3300007004|Ga0079218_13003233 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
| 3300009094|Ga0111539_10016395 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 9188 | Open in IMG/M |
| 3300009094|Ga0111539_10112226 | All Organisms → cellular organisms → Bacteria | 3198 | Open in IMG/M |
| 3300009147|Ga0114129_10166009 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 3013 | Open in IMG/M |
| 3300009147|Ga0114129_12324705 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia | 643 | Open in IMG/M |
| 3300009789|Ga0126307_10130757 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2004 | Open in IMG/M |
| 3300009789|Ga0126307_10154857 | All Organisms → cellular organisms → Bacteria | 1835 | Open in IMG/M |
| 3300009789|Ga0126307_10254123 | All Organisms → cellular organisms → Bacteria | 1413 | Open in IMG/M |
| 3300009789|Ga0126307_10277575 | All Organisms → cellular organisms → Bacteria | 1348 | Open in IMG/M |
| 3300009789|Ga0126307_10450176 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1039 | Open in IMG/M |
| 3300009840|Ga0126313_10026988 | All Organisms → cellular organisms → Bacteria | 3898 | Open in IMG/M |
| 3300009840|Ga0126313_10100686 | All Organisms → Viruses → Predicted Viral | 2124 | Open in IMG/M |
| 3300009840|Ga0126313_10138200 | All Organisms → cellular organisms → Bacteria | 1829 | Open in IMG/M |
| 3300009840|Ga0126313_10167252 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1671 | Open in IMG/M |
| 3300009840|Ga0126313_10258987 | All Organisms → cellular organisms → Bacteria | 1351 | Open in IMG/M |
| 3300009840|Ga0126313_11456143 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
| 3300010037|Ga0126304_10970722 | Not Available | 579 | Open in IMG/M |
| 3300010038|Ga0126315_10037850 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2552 | Open in IMG/M |
| 3300010038|Ga0126315_10283789 | All Organisms → cellular organisms → Bacteria | 1018 | Open in IMG/M |
| 3300010041|Ga0126312_10366588 | All Organisms → cellular organisms → Bacteria | 1022 | Open in IMG/M |
| 3300010042|Ga0126314_10290397 | Not Available | 1166 | Open in IMG/M |
| 3300010042|Ga0126314_10392726 | All Organisms → cellular organisms → Bacteria | 999 | Open in IMG/M |
| 3300010042|Ga0126314_10723816 | All Organisms → cellular organisms → Bacteria | 730 | Open in IMG/M |
| 3300010042|Ga0126314_10845942 | All Organisms → cellular organisms → Bacteria | 675 | Open in IMG/M |
| 3300012204|Ga0137374_10000374 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 44041 | Open in IMG/M |
| 3300012387|Ga0134030_1012700 | Not Available | 514 | Open in IMG/M |
| 3300012395|Ga0134044_1170432 | Not Available | 651 | Open in IMG/M |
| 3300012937|Ga0162653_100076522 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
| 3300012941|Ga0162652_100010085 | All Organisms → cellular organisms → Bacteria | 1155 | Open in IMG/M |
| 3300014487|Ga0182000_10006038 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2753 | Open in IMG/M |
| 3300014487|Ga0182000_10019960 | All Organisms → cellular organisms → Bacteria | 1759 | Open in IMG/M |
| 3300014487|Ga0182000_10142393 | All Organisms → cellular organisms → Bacteria | 858 | Open in IMG/M |
| 3300014487|Ga0182000_10304729 | All Organisms → cellular organisms → Bacteria | 666 | Open in IMG/M |
| 3300014487|Ga0182000_10547755 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300014488|Ga0182001_10113094 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 865 | Open in IMG/M |
| 3300014488|Ga0182001_10583319 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300014497|Ga0182008_10045008 | All Organisms → cellular organisms → Bacteria | 2194 | Open in IMG/M |
| 3300018000|Ga0184604_10135520 | All Organisms → cellular organisms → Bacteria | 799 | Open in IMG/M |
| 3300018052|Ga0184638_1335907 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 507 | Open in IMG/M |
| 3300018056|Ga0184623_10097816 | Not Available | 1355 | Open in IMG/M |
| 3300018077|Ga0184633_10369812 | All Organisms → cellular organisms → Bacteria | 721 | Open in IMG/M |
| 3300018081|Ga0184625_10034695 | All Organisms → cellular organisms → Bacteria | 2484 | Open in IMG/M |
| 3300018422|Ga0190265_10296585 | All Organisms → cellular organisms → Bacteria | 1685 | Open in IMG/M |
| 3300018465|Ga0190269_10171561 | All Organisms → cellular organisms → Bacteria | 1145 | Open in IMG/M |
| 3300018465|Ga0190269_10515819 | All Organisms → cellular organisms → Bacteria | 781 | Open in IMG/M |
| 3300018466|Ga0190268_10165043 | All Organisms → cellular organisms → Bacteria | 1155 | Open in IMG/M |
| 3300018466|Ga0190268_10529262 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 811 | Open in IMG/M |
| 3300018476|Ga0190274_10981561 | All Organisms → cellular organisms → Bacteria | 918 | Open in IMG/M |
| 3300018476|Ga0190274_11917527 | All Organisms → cellular organisms → Bacteria | 688 | Open in IMG/M |
| 3300019377|Ga0190264_10077474 | All Organisms → cellular organisms → Bacteria | 1466 | Open in IMG/M |
| 3300019377|Ga0190264_10804104 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia | 716 | Open in IMG/M |
| 3300019767|Ga0190267_10998661 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
| 3300019767|Ga0190267_11077457 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia | 574 | Open in IMG/M |
| 3300019867|Ga0193704_1045547 | All Organisms → cellular organisms → Bacteria | 866 | Open in IMG/M |
| 3300020005|Ga0193697_1070148 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 860 | Open in IMG/M |
| 3300021078|Ga0210381_10201350 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 694 | Open in IMG/M |
| 3300021510|Ga0222621_1076890 | All Organisms → cellular organisms → Bacteria | 705 | Open in IMG/M |
| 3300022756|Ga0222622_10006353 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 5372 | Open in IMG/M |
| 3300022756|Ga0222622_11177086 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
| 3300025972|Ga0207668_10254924 | All Organisms → cellular organisms → Bacteria | 1427 | Open in IMG/M |
| 3300026691|Ga0208348_100932 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
| 3300027750|Ga0209461_10030368 | Not Available | 1026 | Open in IMG/M |
| 3300027750|Ga0209461_10191427 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300027809|Ga0209574_10086388 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 868 | Open in IMG/M |
| 3300027809|Ga0209574_10097856 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 830 | Open in IMG/M |
| 3300027880|Ga0209481_10006166 | All Organisms → cellular organisms → Bacteria | 5097 | Open in IMG/M |
| 3300027907|Ga0207428_10286165 | All Organisms → cellular organisms → Bacteria | 1222 | Open in IMG/M |
| 3300027907|Ga0207428_10317779 | All Organisms → cellular organisms → Bacteria | 1150 | Open in IMG/M |
| 3300028381|Ga0268264_10457238 | All Organisms → cellular organisms → Bacteria | 1238 | Open in IMG/M |
| 3300028704|Ga0307321_1003677 | All Organisms → cellular organisms → Bacteria | 2565 | Open in IMG/M |
| 3300028704|Ga0307321_1128432 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| 3300028711|Ga0307293_10001840 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5273 | Open in IMG/M |
| 3300028713|Ga0307303_10007521 | All Organisms → cellular organisms → Bacteria | 1863 | Open in IMG/M |
| 3300028719|Ga0307301_10009846 | All Organisms → cellular organisms → Bacteria | 2696 | Open in IMG/M |
| 3300028722|Ga0307319_10031849 | All Organisms → cellular organisms → Bacteria | 1635 | Open in IMG/M |
| 3300028744|Ga0307318_10002111 | All Organisms → cellular organisms → Bacteria | 6539 | Open in IMG/M |
| 3300028796|Ga0307287_10310339 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
| 3300028812|Ga0247825_11187553 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 557 | Open in IMG/M |
| 3300028872|Ga0307314_10097450 | All Organisms → cellular organisms → Bacteria | 799 | Open in IMG/M |
| 3300028878|Ga0307278_10000962 | All Organisms → cellular organisms → Bacteria | 14215 | Open in IMG/M |
| 3300028881|Ga0307277_10165081 | All Organisms → cellular organisms → Bacteria | 963 | Open in IMG/M |
| 3300030496|Ga0268240_10023911 | All Organisms → cellular organisms → Bacteria | 1179 | Open in IMG/M |
| 3300030499|Ga0268259_10040170 | All Organisms → cellular organisms → Bacteria | 928 | Open in IMG/M |
| 3300030499|Ga0268259_10062203 | All Organisms → cellular organisms → Bacteria | 781 | Open in IMG/M |
| 3300030510|Ga0268243_1003032 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2818 | Open in IMG/M |
| 3300030510|Ga0268243_1133176 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
| 3300030903|Ga0308206_1015835 | All Organisms → cellular organisms → Bacteria | 1207 | Open in IMG/M |
| 3300031548|Ga0307408_100038954 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3356 | Open in IMG/M |
| 3300031548|Ga0307408_100121773 | All Organisms → cellular organisms → Bacteria | 2022 | Open in IMG/M |
| 3300031731|Ga0307405_10202376 | All Organisms → cellular organisms → Bacteria | 1443 | Open in IMG/M |
| 3300031731|Ga0307405_10266168 | All Organisms → cellular organisms → Bacteria | 1283 | Open in IMG/M |
| 3300031731|Ga0307405_10272734 | All Organisms → cellular organisms → Bacteria | 1269 | Open in IMG/M |
| 3300031852|Ga0307410_11704247 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 558 | Open in IMG/M |
| 3300031903|Ga0307407_10059699 | All Organisms → cellular organisms → Bacteria | 2222 | Open in IMG/M |
| 3300032002|Ga0307416_103650936 | Not Available | 515 | Open in IMG/M |
| 3300032004|Ga0307414_11087930 | All Organisms → cellular organisms → Bacteria | 738 | Open in IMG/M |
| 3300032004|Ga0307414_11934705 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 550 | Open in IMG/M |
| 3300032126|Ga0307415_100430926 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1134 | Open in IMG/M |
| 3300032126|Ga0307415_101265830 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 697 | Open in IMG/M |
| 3300032159|Ga0268251_10234401 | All Organisms → cellular organisms → Bacteria | 735 | Open in IMG/M |
| 3300034131|Ga0334911_009179 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1324 | Open in IMG/M |
| 3300034151|Ga0364935_0184242 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 669 | Open in IMG/M |
| 3300034172|Ga0334913_048086 | All Organisms → cellular organisms → Bacteria | 907 | Open in IMG/M |
| 3300034172|Ga0334913_132715 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300034174|Ga0334932_033689 | All Organisms → cellular organisms → Bacteria | 868 | Open in IMG/M |
| 3300034176|Ga0364931_0214798 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia | 629 | Open in IMG/M |
| 3300034377|Ga0334931_135856 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia | 587 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 18.94% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 14.39% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 9.09% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 9.09% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Unclassified → Tabebuia Heterophylla Rhizosphere | 8.33% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 7.58% |
| Agave | Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave | 4.55% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 3.79% |
| Sub-Biocrust Soil | Environmental → Terrestrial → Soil → Unclassified → Desert → Sub-Biocrust Soil | 3.79% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 3.03% |
| Agave | Host-Associated → Plants → Phyllosphere → Phylloplane/Leaf Surface → Unclassified → Agave | 3.03% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.27% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.52% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.52% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 1.52% |
| Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 1.52% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.52% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.76% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 0.76% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.76% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.76% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.76% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.76% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000443 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.2B clc assemly | Environmental | Open in IMG/M |
| 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Host-Associated | Open in IMG/M |
| 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Host-Associated | Open in IMG/M |
| 3300005562 | Agave microbial communities from Guanajuato, Mexico - As.Ma.e | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Host-Associated | Open in IMG/M |
| 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Host-Associated | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
| 3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
| 3300010037 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25 | Environmental | Open in IMG/M |
| 3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
| 3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
| 3300010042 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012387 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012395 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_8_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012937 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t5i015 | Environmental | Open in IMG/M |
| 3300012941 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t4i015 | Environmental | Open in IMG/M |
| 3300014487 | Bulk soil microbial communities from Mexico - Magueyal (Ma) metaG | Environmental | Open in IMG/M |
| 3300014488 | Bulk soil microbial communities from Mexico - San Felipe (SF) metaG | Environmental | Open in IMG/M |
| 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Host-Associated | Open in IMG/M |
| 3300018000 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coex | Environmental | Open in IMG/M |
| 3300018052 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2 | Environmental | Open in IMG/M |
| 3300018056 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1 | Environmental | Open in IMG/M |
| 3300018077 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b1 | Environmental | Open in IMG/M |
| 3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018465 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 IS | Environmental | Open in IMG/M |
| 3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300019377 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T | Environmental | Open in IMG/M |
| 3300019767 | Populus adjacent soil microbial communities from riparian zone of Oak Creek, Arizona, USA - 239 T | Environmental | Open in IMG/M |
| 3300019867 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3m1 | Environmental | Open in IMG/M |
| 3300020005 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3m2 | Environmental | Open in IMG/M |
| 3300021078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_coex redo | Environmental | Open in IMG/M |
| 3300021510 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_coex | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026691 | Grasslands soil microbial communities from Gorham, Kansas, USA that are Nitrogen fertilized -NN621 (SPAdes) | Environmental | Open in IMG/M |
| 3300027750 | Agave microbial communities from Guanajuato, Mexico - As.Ma.rz (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027809 | Agave microbial communities from Guanajuato, Mexico - Mg.Ma.rz (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028704 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_379 | Environmental | Open in IMG/M |
| 3300028711 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_150 | Environmental | Open in IMG/M |
| 3300028713 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_184 | Environmental | Open in IMG/M |
| 3300028719 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_182 | Environmental | Open in IMG/M |
| 3300028722 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_368 | Environmental | Open in IMG/M |
| 3300028744 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_367 | Environmental | Open in IMG/M |
| 3300028796 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141 | Environmental | Open in IMG/M |
| 3300028812 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Vanillin_Day48 | Environmental | Open in IMG/M |
| 3300028872 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_204 | Environmental | Open in IMG/M |
| 3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
| 3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
| 3300030496 | Bulk soil microbial communities from Mexico - Penjamo (Pe) metaG (v2) | Environmental | Open in IMG/M |
| 3300030499 | Agave microbial communities from Guanajuato, Mexico - As.Ma.rz (v2) | Host-Associated | Open in IMG/M |
| 3300030510 | Bulk soil microbial communities from Mexico - Magueyal (Ma) metaG (v2) | Environmental | Open in IMG/M |
| 3300030903 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_369 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
| 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Host-Associated | Open in IMG/M |
| 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Host-Associated | Open in IMG/M |
| 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Host-Associated | Open in IMG/M |
| 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
| 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Host-Associated | Open in IMG/M |
| 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Host-Associated | Open in IMG/M |
| 3300032159 | Agave microbial communities from Guanajuato, Mexico - As.Ma.e (v2) | Host-Associated | Open in IMG/M |
| 3300034131 | Sub-biocrust soil microbial communities from Mojave Desert, California, United States - 7HMS | Environmental | Open in IMG/M |
| 3300034151 | Sediment microbial communities from East River floodplain, Colorado, United States - 2_s17 | Environmental | Open in IMG/M |
| 3300034172 | Sub-biocrust soil microbial communities from Mojave Desert, California, United States - 9HMS | Environmental | Open in IMG/M |
| 3300034174 | Sub-biocrust soil microbial communities from Mojave Desert, California, United States - 28HNS | Environmental | Open in IMG/M |
| 3300034176 | Sediment microbial communities from East River floodplain, Colorado, United States - 21_j17 | Environmental | Open in IMG/M |
| 3300034377 | Sub-biocrust soil microbial communities from Mojave Desert, California, United States - 27HNS | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| F12B_112274121 | 3300000443 | Soil | MSLLMLAVVALFPIVLLALLLITSGLEGRVVRQPTPKVGAGERPGTRDQG* |
| JGI25406J46586_101143312 | 3300003203 | Tabebuia Heterophylla Rhizosphere | VSLLMLAVVALFPVILLALLLITSGLEGRVVGEPASRVGVGERPRARE* |
| JGI25407J50210_100248002 | 3300003373 | Tabebuia Heterophylla Rhizosphere | VSLLMLAVVALFPVVLLALLLITSGLEGRVMGKPTSTVAAGKRPGPRE* |
| JGI25407J50210_100985711 | 3300003373 | Tabebuia Heterophylla Rhizosphere | VSLLMLAVVALFPVVLLALLLITSGLEGRVVRSGEQPGTRE* |
| JGI25407J50210_101093101 | 3300003373 | Tabebuia Heterophylla Rhizosphere | VSLLMLAVVALFPVVLLALLLITSGLEGRVVGEPTSTVAAGERPAPRE |
| JGI25407J50210_101295731 | 3300003373 | Tabebuia Heterophylla Rhizosphere | MSLLMLAVVALFPVVLLALLLITSGLEGRVVGDSASRVGAGDRPGTRD* |
| JGI25407J50210_101343511 | 3300003373 | Tabebuia Heterophylla Rhizosphere | VSLLMLGVVALFPILLLGLLLLTSGLEGRVVGQPTKGNGAGERSGPGPGARDQG* |
| JGI25407J50210_101533321 | 3300003373 | Tabebuia Heterophylla Rhizosphere | VSLLMLAVVALFPVVLLALLLITSGLEGRVVAEPTSTAPAGERPGPRE* |
| Ga0058697_100481902 | 3300005562 | Agave | VSLLMLAVVALFPVVLLALLLITSGLEGRVVGQPTPRVGATERPGTPEQR* |
| Ga0058697_104883491 | 3300005562 | Agave | VSLLMLAVVALFPVVLLALLLITSGLEGRVVGSGERPGARD* |
| Ga0058697_105451552 | 3300005562 | Agave | FPVVLLALLLITSGLEGRVVGQPTPRVGAGERPGTHDQG* |
| Ga0068860_1005164481 | 3300005843 | Switchgrass Rhizosphere | VLLLALLLITSGLEGRVVGDSTPGVGAGDGPGTRD* |
| Ga0081455_103784221 | 3300005937 | Tabebuia Heterophylla Rhizosphere | VSLLMLAVVALFPVVLLVMLLITSGLEGRVVDSGERSGGRD* |
| Ga0081538_100130599 | 3300005981 | Tabebuia Heterophylla Rhizosphere | MSLLMLAVVALFPVVLLALLLITSGLEGRVVGDSTPRVGAGDRPGTRD* |
| Ga0081538_100353045 | 3300005981 | Tabebuia Heterophylla Rhizosphere | VSLLMLAVVALFPIVLLALLLITSGLEGRVVGRPTSEVGTGDRSGPPE* |
| Ga0081538_100400304 | 3300005981 | Tabebuia Heterophylla Rhizosphere | MSLLMLAVVALFPVVLLGLLLITSGLEGRVVGDSASRAGAGDRPGTRD* |
| Ga0081538_103392332 | 3300005981 | Tabebuia Heterophylla Rhizosphere | VSLLMLAVVALFPVVLLALLLITSGREGRVVGSGEPPGAQD* |
| Ga0081538_103408912 | 3300005981 | Tabebuia Heterophylla Rhizosphere | VSLLMLAVVALFPVVLLALLLITSGLEGRVVGQPTPRVGAGERPGTRDQG* |
| Ga0081539_100248184 | 3300005985 | Tabebuia Heterophylla Rhizosphere | VSLLMLAVVALFPVLLLGLLLITSGLEGRVVGEPASRVGVGERPGTRE* |
| Ga0081539_101651272 | 3300005985 | Tabebuia Heterophylla Rhizosphere | VSLLMLAVVALFPIALLALLLITSGMERRVVGDATSGVDAGEPPAPRDRR* |
| Ga0075417_103766201 | 3300006049 | Populus Rhizosphere | VSLLMLAVVALFPVVLLALLLVTSGLEGRVVGSGEQPGSQD* |
| Ga0075433_100705743 | 3300006852 | Populus Rhizosphere | MLAVVALFPLVLLALLLLTSGLEGRVGDRVPRAGTAERPDPRDRR* |
| Ga0075429_1004111972 | 3300006880 | Populus Rhizosphere | MLAVVALFPLVLLALLLLTSDLEGRVGDRVPRAGTAERPDPRDRR* |
| Ga0075429_1010165001 | 3300006880 | Populus Rhizosphere | MLAVVALFPVVLLALLLVTSGLEGRVVGSGEQPGSQD* |
| Ga0075424_1008673222 | 3300006904 | Populus Rhizosphere | VSLLMFAVVALFPVVLLALLLITAGLEGRVGDSGERSGGRD* |
| Ga0079218_130032331 | 3300007004 | Agricultural Soil | VSLLMLAVVALFPIVLLALLLITSGLEGRVVGRPTSEVGTGDRSGTPG* |
| Ga0111539_100163955 | 3300009094 | Populus Rhizosphere | MLAVVVLFPIVLLALLLITSGMERRVVGGSSSGAGAGERPAPTDRR* |
| Ga0111539_101122262 | 3300009094 | Populus Rhizosphere | MLAVVALFPVVLLALLLITAGLEGRVGDSGERSGGRD* |
| Ga0114129_101660094 | 3300009147 | Populus Rhizosphere | VSLLMLAVVALFPVVLLALLLITAGLEGRVGDSGERSGGRD* |
| Ga0114129_123247052 | 3300009147 | Populus Rhizosphere | MLAVVALFPVVLLALLLVTSGLEGRVVGSGEQPGSRD* |
| Ga0126307_101307573 | 3300009789 | Serpentine Soil | MSLLMLAVVALFPVVLLALLLITSGLEGRVVGDSTPSAGPGERSGTRD* |
| Ga0126307_101548573 | 3300009789 | Serpentine Soil | MLAVVALFPVILLALLLITSGLEGRVVGEPTSQVGVGERPGAPE* |
| Ga0126307_102541232 | 3300009789 | Serpentine Soil | MLAVVALFPLILLALLLITSGLEGRVVGEPPTSRVGVGERPGTRE* |
| Ga0126307_102775752 | 3300009789 | Serpentine Soil | MLAVVALFPVLLLALLLITSGLEGRVVGEPTSQVGVGERPGGHE* |
| Ga0126307_104501762 | 3300009789 | Serpentine Soil | MSLLMLAVVALFPVVLLALLLITSGLEGRVVGDSTPGAGAGERPGTRD* |
| Ga0126313_100269883 | 3300009840 | Serpentine Soil | MLAVVVLFPVVLLALLLITSGLEGRVVRQPTPKVGAGERPGTRDQG* |
| Ga0126313_101006862 | 3300009840 | Serpentine Soil | MFLASLSRDSFLLMLAVVALFPVVLLALLLITSGLEGRVVGAGERPGPRE* |
| Ga0126313_101382002 | 3300009840 | Serpentine Soil | MLAVVALFPVILLALLLITSGLEGRVVGEPTSRVGAGERPGARE* |
| Ga0126313_101672523 | 3300009840 | Serpentine Soil | MLAVVALFPVVLLALLLITSGLEGRVVGDPTPRVGAGERPGPRDQR* |
| Ga0126313_102589872 | 3300009840 | Serpentine Soil | MLAVVALFPVILLALLLITSGLEGRVVGEPPTSRVGVGERPGTRE* |
| Ga0126313_114561432 | 3300009840 | Serpentine Soil | VLLALLLITSGLEGRVVGDSTPGAGAGERPGTRD* |
| Ga0126304_109707222 | 3300010037 | Serpentine Soil | MLAVVALFPVVLLALLLITSGLEGRVVGEPTSTVAAGERPGPRE* |
| Ga0126315_100378502 | 3300010038 | Serpentine Soil | MLAVVALFPVVLLALLLITSGLEGRVVGDPTPEVGASERPGPRDRR* |
| Ga0126315_102837893 | 3300010038 | Serpentine Soil | LFPVVLLALLLITSGLEGRVVGDPTPRVGAGERPGPRDQR* |
| Ga0126312_103665881 | 3300010041 | Serpentine Soil | PVILLALLLITSGLEGRVVGEPPTSRVGVGERPGTRE* |
| Ga0126314_102903971 | 3300010042 | Serpentine Soil | MLAVVALFPVVLLALLLITSGLEGRVVGDPTPEVGAGERPGPRDRR* |
| Ga0126314_103927262 | 3300010042 | Serpentine Soil | MLAVVALFPVILLALLLITSGLEGRVVGEPTSRVGVGERPGARE* |
| Ga0126314_107238162 | 3300010042 | Serpentine Soil | ALFPVVLLALLLITSGLEGRVVGDPTPEVGASERPGPRDRR* |
| Ga0126314_108459422 | 3300010042 | Serpentine Soil | MLAVVALFPAVLLALLLITSGLEGRVVGDPTPRVGAGERPGPRDQR* |
| Ga0137374_100003749 | 3300012204 | Vadose Zone Soil | MLAVVALFPVTLLAILLLTSGLEGKFVRSNPSPPRQARNRPGTRHD* |
| Ga0134030_10127001 | 3300012387 | Grasslands Soil | GGCPGVSLLMLAVVALFPVVLLALLLITSGMERRVVGDSTSGAGAGERPAPPDRR* |
| Ga0134044_11704322 | 3300012395 | Grasslands Soil | GCPVVSLLMLAVVALFPIVLLALLLITSGMERRVVGDSTSGAGAGERPAPPDRC* |
| Ga0162653_1000765221 | 3300012937 | Soil | AVVALFPVLLLALLLITSGLEGRVVGDSTPGVGSGDGPGTRD* |
| Ga0162652_1000100852 | 3300012941 | Soil | MSLLMLAVVALFPIVLLALLLITSGLEGRVVGDSTPGVGAGDRPGTRD* |
| Ga0182000_100060384 | 3300014487 | Soil | MLAVVALFPVILLALLLITSGLEGRVVGEPTSRVGVGERPGTRE* |
| Ga0182000_100199602 | 3300014487 | Soil | MLAVVVLFPVVLLALLLITSGLEGRVVRQPTPKVGAGERPGTRGQG* |
| Ga0182000_101423932 | 3300014487 | Soil | MLAVVALFPVVLLALLLITSGLEGRVVGQPTPRVGAGERPGTHDQG* |
| Ga0182000_103047292 | 3300014487 | Soil | MLAVVALFPVILLALLLITSGLEGRVVGEPASRVGVGERPGTRE* |
| Ga0182000_105477551 | 3300014487 | Soil | MLAVVALFPVILLGLLLITSGLEGRVVGEPASRVGVGEGPGARE* |
| Ga0182001_101130942 | 3300014488 | Soil | MSLLMLAVVALFPVVLLALLLITSGLEGRVVGDSTPRARAGDRPGTRD* |
| Ga0182001_105833192 | 3300014488 | Soil | MLAVVALFPVILLALLLITSGLEGRVVGEPTPEVGVGERPGARE* |
| Ga0182008_100450082 | 3300014497 | Rhizosphere | MLAVVALFPVVLLALLLITSGLEGRVVRQPTPKVGAGERPGTRGQG* |
| Ga0184604_101355201 | 3300018000 | Groundwater Sediment | ILLLGLLLLTSGLEGRVVGEPTPRVGAADRRGPRE |
| Ga0184638_13359071 | 3300018052 | Groundwater Sediment | VSLLMLAVVALFPVVLLALLLITSGLEGRVVGDPTPKVGAGERPGTPPE |
| Ga0184623_100978162 | 3300018056 | Groundwater Sediment | VSLLMLAVVALFPVVLLALLLITSGLEGRVKGDPTPKVGAGERPGTPPE |
| Ga0184633_103698121 | 3300018077 | Groundwater Sediment | LFPVLLLALLLITSGLEGRVVGDSTPGVGSGDGPGTRD |
| Ga0184625_100346953 | 3300018081 | Groundwater Sediment | VSLLMLAVVALFPVVLLALLLVTSGLEGRVVGSREQPGSRD |
| Ga0190265_102965852 | 3300018422 | Soil | MSLLMLAVVALFPVVLLALLLITSGLEGRVVGDSTPSAGPGERSGTRD |
| Ga0190269_101715612 | 3300018465 | Soil | VSLLMLAVVALFPVILLALLLITSGLEGRVVGEPTSRVGAGERPGTRE |
| Ga0190269_105158192 | 3300018465 | Soil | MSLLMLAVVALFPVVLLALLLITSGLEGRVVGDSTPSAGTGERSGTRD |
| Ga0190268_101650432 | 3300018466 | Soil | VSLLMLAVVALFPVVLLALLLITSGLEGRVVRQPTPRVDAGERPGTRDQG |
| Ga0190268_105292622 | 3300018466 | Soil | VSLLMLAVVALFPVVLLALLLVTSGLEGRVVGSGEQPGSRD |
| Ga0190274_109815612 | 3300018476 | Soil | VSLLMLAVVALFPVVLLALLLVTSGLEGRVVGPGEQPPTGD |
| Ga0190274_119175272 | 3300018476 | Soil | ALFPVVLLALLLITSGLEGRVVGDSTPSAGPGERSGTRD |
| Ga0190264_100774742 | 3300019377 | Soil | VSLLMLAVVALFPVVLLALLLITSGLEGRVVGDPTPRAGAAERSGRREQG |
| Ga0190264_108041041 | 3300019377 | Soil | VSLLMLAVVALFPVVLLALLLITSGLEGRVVGEPTGEVAVRDRSGAGEQR |
| Ga0190267_109986612 | 3300019767 | Soil | VSLLMLAVVALFPVVLLALLLITSGLEGRVVGDSTPRVRAGERPETRE |
| Ga0190267_110774572 | 3300019767 | Soil | VSLLMLAVVALFPVILLALLLITSGLEGRVVGEPTSRVGVGERPGARE |
| Ga0193704_10455473 | 3300019867 | Soil | LFPVLLLALLLITSGLEGRVVGDSPPGVGAGDGPGTRD |
| Ga0193697_10701482 | 3300020005 | Soil | VSLLMLAVVALFPVVLLALLLVTSGLEGRVVGSGEQPGSQD |
| Ga0210381_102013502 | 3300021078 | Groundwater Sediment | MLAVVALFPVVLLALLLITSGMERRVVGDSTSRAGTGERPAPRDRR |
| Ga0222621_10768901 | 3300021510 | Groundwater Sediment | ALFPVLLLALLLITSGLEGRVVGDSPPGVGAGDGPGTRD |
| Ga0222622_100063538 | 3300022756 | Groundwater Sediment | VSLLMLAVVALFPVVLLALLLITSGMERRMVGDSTSRAGTGERPAPRDRR |
| Ga0222622_111770861 | 3300022756 | Groundwater Sediment | VALFPILLLALLLLTSGLEGRVVGEPTPRVGAADRPGPRE |
| Ga0207668_102549243 | 3300025972 | Switchgrass Rhizosphere | ALFPVLLLALLLITSGLEGRVVGDSTPGVGAGDGPGTRD |
| Ga0208348_1009321 | 3300026691 | Soil | SLLMLAVVALFPVVLLALLLITSGLEGRVVGDSTPSAGTGERSGTRD |
| Ga0209461_100303682 | 3300027750 | Agave | VSLLMLAVVALFPVVLLALLLITSGLEGRVVGDPTPRVGAGERP |
| Ga0209461_101914272 | 3300027750 | Agave | VSLLMLAVVALFPVVLLALLLITSGLEGRVVGDPTPRVGAGERPGPRDRR |
| Ga0209574_100863882 | 3300027809 | Agave | VSLLMLAVVALFPVVLLALLLITSGLEGRVVGQPTPRVGAGERPGTPEQR |
| Ga0209574_100978562 | 3300027809 | Agave | VSLLMLAVVALFPVVLLALLLITSGLEGRVVGSGERPGARD |
| Ga0209481_100061661 | 3300027880 | Populus Rhizosphere | AVVALFPIVLLALLLITSGMERRVVGGSSSGAGAGERPAPPDRR |
| Ga0207428_102861652 | 3300027907 | Populus Rhizosphere | VSLLMLAVVALFPVVLLALLLITAGLEGRVGDSGERSGGRD |
| Ga0207428_103177793 | 3300027907 | Populus Rhizosphere | FPLVLLALLLLTSGLEGRVGDRVPRAGTAERPDPRDRR |
| Ga0268264_104572383 | 3300028381 | Switchgrass Rhizosphere | VLLLALLLITSGLEGRVVGDSTPGVGAGDGPGTRD |
| Ga0307321_10036773 | 3300028704 | Soil | VSLLMLAVVALFPIVLLALLLITSGMERRVVGDSTSRAGTGERPAPRDRR |
| Ga0307321_11284322 | 3300028704 | Soil | LAVVALFPVLLLALLLITSGLEGRVVGDSTPGVGAGDGPGTRD |
| Ga0307293_100018404 | 3300028711 | Soil | VSLLMLAVVALFPIVLLALLLITSGMERRMVGDSTSRAGTGERPAPRDRR |
| Ga0307303_100075213 | 3300028713 | Soil | PIVLLALLLITSGMERRVVGDSTSRAGTGERPAPRDRR |
| Ga0307301_100098461 | 3300028719 | Soil | DSFLLMLAVVALFPVVLLALLLVTSGLEGRVVGSGEQPGSQD |
| Ga0307319_100318492 | 3300028722 | Soil | MSLLMLAVVALFPIVLLALLLITSGLEGRVVGDSTPGAGAGERPGTRD |
| Ga0307318_100021118 | 3300028744 | Soil | VSLLMLAVVALFPVVLLALLLITSGMERRVVGDSTSRAGTGERPAPRDRR |
| Ga0307287_103103391 | 3300028796 | Soil | LAVVALFPIVLLALLLITSGLEGRVVGDSTPGAGAGERPGTRD |
| Ga0247825_111875531 | 3300028812 | Soil | VSLLMLAVVALFPVTLLAILLLTSGLEGKFVSPHPAKTP |
| Ga0307314_100974502 | 3300028872 | Soil | MLAVVALFPIVLLALLLITSGMERRMVGDSTSRAGTGERPAPRDRR |
| Ga0307278_1000096212 | 3300028878 | Soil | VSLLMLAVVALFPIVLLALLLITSGLEGRVVGGTTPRVGVGDRQGPRE |
| Ga0307277_101650811 | 3300028881 | Soil | ALFPILLLGLLLLTSGLEGRVVGEPTPRVGAADRRGPRE |
| Ga0268240_100239113 | 3300030496 | Soil | VSLLMLAVVALFPVILLALLLITSGLEGRVVGEPTSRVGVGEGPGARE |
| Ga0268259_100401701 | 3300030499 | Agave | VSLLMLAVVALFPVVLALLLITSGLEGRVVGQPTPRVGATERPGTPEQR |
| Ga0268259_100622031 | 3300030499 | Agave | VSLLMLAVVALFPVVLLALLLITSGLEGRVVRQPTPKVGAGERPGTRDQG |
| Ga0268243_10030324 | 3300030510 | Soil | VSLLMLAVVALFPVILLALLLITSGLEGRVVGEPTSRVGVGERPGTRE |
| Ga0268243_11331762 | 3300030510 | Soil | VSLLMLAVVALFPVVLLALLLITSGLEGRVVGQPTPRVGAGERPGTHDQG |
| Ga0308206_10158353 | 3300030903 | Soil | ALFPVLLLALLLITSGLEGRVVGDSTPGVGAGDRPGTRD |
| Ga0307408_1000389543 | 3300031548 | Rhizosphere | VSLLMLAVVALFPVILLALLLITSGLEGRVVGEPTSRVGAGERPGARE |
| Ga0307408_1001217732 | 3300031548 | Rhizosphere | MSLLMLAVVALFPLVLLGLLLITSGLEGRVVGDSAPRVGAGDRPGTRD |
| Ga0307405_102023762 | 3300031731 | Rhizosphere | VSLLMLAVVALFPVVLLALLLITSGLEGRVVGDPTPRVGAGERPGPRDQR |
| Ga0307405_102661683 | 3300031731 | Rhizosphere | VSLLMLAVVALFPVILLGLLLITSGLEGRVVGEPTPRVGVGERPGARE |
| Ga0307405_102727342 | 3300031731 | Rhizosphere | MFLASLSRDSFLLMLAVVALFPVVLLALLLITSGLEGRVVGAGERPGPRE |
| Ga0307410_117042472 | 3300031852 | Rhizosphere | VSLLMLAVVALFPVILLALLLITSGLEGRVVGEPTSQVGVGERPGARE |
| Ga0307407_100596991 | 3300031903 | Rhizosphere | VSLLMLAVVALFPVILLALLLITSGLEGRVVGEPTSRLGAGERPGARE |
| Ga0307416_1036509362 | 3300032002 | Rhizosphere | VSLLMLGVVALFPVLLLALLLITSGLEGRVVGQPTPRVDAGERPGPHDQQ |
| Ga0307414_110879302 | 3300032004 | Rhizosphere | VSLLMLAVVALFPVILLALLLITSGLEGRVVGEPTSQVGVGERPGAPE |
| Ga0307414_119347051 | 3300032004 | Rhizosphere | MFLASLSRDSFLLMLAVVALFPVVLLALLLITSGLEGRVVGAGERPGPR |
| Ga0307415_1004309262 | 3300032126 | Rhizosphere | VSLLMLAVVALFPVVLLALLLITSGLEGRVVGDPSPRVGAGERPGPRDQR |
| Ga0307415_1012658302 | 3300032126 | Rhizosphere | VSLLMLAVVALFPVVLLALLLITSGLEGRVVGDPTPEVGAGERPGPRDRR |
| Ga0268251_102344012 | 3300032159 | Agave | FPVILLALLLITSGLEGRVVGEPTSQVGVGDRPGARE |
| Ga0334911_009179_726_866 | 3300034131 | Sub-Biocrust Soil | MLAVVALFPVVLLALLLITSGLEGRVVGQPTPRVGAGERPGTPEQR |
| Ga0364935_0184242_263_409 | 3300034151 | Sediment | MSLLMLAVVALFPVVLLALLLITSGLEGRVVGDSTPRVRAGERPETRE |
| Ga0334913_048086_574_708 | 3300034172 | Sub-Biocrust Soil | MLAVVALFPVVLLALLLITSGLEGRVVAEPTPRVGVAERPGTRE |
| Ga0334913_132715_20_160 | 3300034172 | Sub-Biocrust Soil | MLAVVALFPVVLLALLLITSGLEGRVVGQPTPKVGAGERPGTHDRR |
| Ga0334932_033689_496_636 | 3300034174 | Sub-Biocrust Soil | MLAVVALFPVVLLALLLITSGLEGRVVGQPTPRVGAGERPGTRDQG |
| Ga0364931_0214798_426_539 | 3300034176 | Sediment | MLAVVALFPVVLLALLLVTSGLEGRVVGSGEQPGSQD |
| Ga0334931_135856_414_557 | 3300034377 | Sub-Biocrust Soil | MMLAVVALFPVVLLALLLITSGLEGRVVGQPTPRVGAGERPGTRDQG |
| ⦗Top⦘ |