


| Basic Information | |
|---|---|
| Family ID | F060377 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 133 |
| Average Sequence Length | 39 residues |
| Representative Sequence | MHTFLPFVVVWFTQLRAREFDAATFRSFAGEAATVRGFF |
| Number of Associated Samples | 117 |
| Number of Associated Scaffolds | 133 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 78.79 % |
| % of genes near scaffold ends (potentially truncated) | 20.30 % |
| % of genes from short scaffolds (< 2000 bps) | 90.98 % |
| Associated GOLD sequencing projects | 113 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.41 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (99.248 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (19.549 % of family members) |
| Environment Ontology (ENVO) | Unclassified (36.090 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (33.835 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 52.24% β-sheet: 0.00% Coil/Unstructured: 47.76% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.41 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 133 Family Scaffolds |
|---|---|---|
| PF16798 | DUF5069 | 42.86 |
| PF03364 | Polyketide_cyc | 24.81 |
| PF02566 | OsmC | 6.77 |
| PF13515 | FUSC_2 | 3.76 |
| PF10604 | Polyketide_cyc2 | 1.50 |
| PF00989 | PAS | 0.75 |
| PF03466 | LysR_substrate | 0.75 |
| PF00070 | Pyr_redox | 0.75 |
| PF07681 | DoxX | 0.75 |
| COG ID | Name | Functional Category | % Frequency in 133 Family Scaffolds |
|---|---|---|---|
| COG1764 | Organic hydroperoxide reductase OsmC/OhrA | Defense mechanisms [V] | 6.77 |
| COG1765 | Uncharacterized OsmC-related protein | General function prediction only [R] | 6.77 |
| COG2259 | Uncharacterized membrane protein YphA, DoxX/SURF4 family | Function unknown [S] | 0.75 |
| COG4270 | Uncharacterized membrane protein | Function unknown [S] | 0.75 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 99.25 % |
| Unclassified | root | N/A | 0.75 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459010|GIO7OMY02GHW5F | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
| 2170459016|G1P06HT01DONLA | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 507 | Open in IMG/M |
| 2189573002|GZIGXIF01B36JD | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 2189573004|GZGWRS402FOP2L | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 532 | Open in IMG/M |
| 3300000559|F14TC_104010439 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 556 | Open in IMG/M |
| 3300004463|Ga0063356_102409890 | All Organisms → cellular organisms → Bacteria | 805 | Open in IMG/M |
| 3300005164|Ga0066815_10097889 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300005181|Ga0066678_10692954 | All Organisms → cellular organisms → Bacteria | 679 | Open in IMG/M |
| 3300005186|Ga0066676_10564241 | All Organisms → cellular organisms → Bacteria | 772 | Open in IMG/M |
| 3300005289|Ga0065704_10327039 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 843 | Open in IMG/M |
| 3300005367|Ga0070667_101013135 | All Organisms → cellular organisms → Bacteria | 775 | Open in IMG/M |
| 3300005435|Ga0070714_101378388 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 688 | Open in IMG/M |
| 3300005450|Ga0066682_10135094 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1565 | Open in IMG/M |
| 3300005457|Ga0070662_101257142 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 637 | Open in IMG/M |
| 3300005540|Ga0066697_10647701 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
| 3300005554|Ga0066661_10272824 | All Organisms → cellular organisms → Bacteria | 1045 | Open in IMG/M |
| 3300005555|Ga0066692_10488865 | All Organisms → cellular organisms → Bacteria | 784 | Open in IMG/M |
| 3300005566|Ga0066693_10044983 | All Organisms → cellular organisms → Bacteria | 1455 | Open in IMG/M |
| 3300005569|Ga0066705_10023287 | All Organisms → cellular organisms → Bacteria | 3232 | Open in IMG/M |
| 3300005764|Ga0066903_103100979 | All Organisms → cellular organisms → Bacteria | 900 | Open in IMG/M |
| 3300005843|Ga0068860_101919389 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
| 3300005843|Ga0068860_102322397 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 557 | Open in IMG/M |
| 3300006046|Ga0066652_100788960 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 908 | Open in IMG/M |
| 3300006163|Ga0070715_10596896 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
| 3300006800|Ga0066660_10928793 | All Organisms → cellular organisms → Bacteria | 706 | Open in IMG/M |
| 3300006881|Ga0068865_100931699 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 757 | Open in IMG/M |
| 3300007255|Ga0099791_10013974 | All Organisms → cellular organisms → Bacteria | 3397 | Open in IMG/M |
| 3300007258|Ga0099793_10095197 | All Organisms → cellular organisms → Bacteria | 1372 | Open in IMG/M |
| 3300009012|Ga0066710_102021007 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 853 | Open in IMG/M |
| 3300009090|Ga0099827_10291917 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1378 | Open in IMG/M |
| 3300009137|Ga0066709_100357674 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 2009 | Open in IMG/M |
| 3300009176|Ga0105242_10598361 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1065 | Open in IMG/M |
| 3300010154|Ga0127503_10533070 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1266 | Open in IMG/M |
| 3300010325|Ga0134064_10049509 | All Organisms → cellular organisms → Bacteria | 1285 | Open in IMG/M |
| 3300010335|Ga0134063_10416653 | All Organisms → cellular organisms → Bacteria | 661 | Open in IMG/M |
| 3300010335|Ga0134063_10427017 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 654 | Open in IMG/M |
| 3300010375|Ga0105239_13440696 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300010861|Ga0126349_1264581 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 808 | Open in IMG/M |
| 3300012198|Ga0137364_10397144 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1032 | Open in IMG/M |
| 3300012207|Ga0137381_10353654 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1281 | Open in IMG/M |
| 3300012211|Ga0137377_10799010 | All Organisms → cellular organisms → Bacteria | 876 | Open in IMG/M |
| 3300012285|Ga0137370_10009855 | All Organisms → cellular organisms → Bacteria | 4526 | Open in IMG/M |
| 3300012285|Ga0137370_10733034 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
| 3300012349|Ga0137387_10235490 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1318 | Open in IMG/M |
| 3300012354|Ga0137366_10329569 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1120 | Open in IMG/M |
| 3300012356|Ga0137371_10786953 | All Organisms → cellular organisms → Bacteria | 725 | Open in IMG/M |
| 3300012357|Ga0137384_10186204 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1738 | Open in IMG/M |
| 3300012361|Ga0137360_10680877 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 883 | Open in IMG/M |
| 3300012361|Ga0137360_11375665 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 608 | Open in IMG/M |
| 3300012685|Ga0137397_10085773 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 2295 | Open in IMG/M |
| 3300012917|Ga0137395_10795112 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 685 | Open in IMG/M |
| 3300012918|Ga0137396_10120161 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1893 | Open in IMG/M |
| 3300012918|Ga0137396_10529630 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 873 | Open in IMG/M |
| 3300012929|Ga0137404_11341657 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 660 | Open in IMG/M |
| 3300012930|Ga0137407_10671971 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 975 | Open in IMG/M |
| 3300012941|Ga0162652_100019758 | All Organisms → cellular organisms → Bacteria | 930 | Open in IMG/M |
| 3300012955|Ga0164298_10142039 | All Organisms → cellular organisms → Bacteria | 1336 | Open in IMG/M |
| 3300012958|Ga0164299_10160942 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1254 | Open in IMG/M |
| 3300012958|Ga0164299_10326560 | All Organisms → cellular organisms → Bacteria | 955 | Open in IMG/M |
| 3300012961|Ga0164302_11166576 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 613 | Open in IMG/M |
| 3300012972|Ga0134077_10495940 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 540 | Open in IMG/M |
| 3300012984|Ga0164309_10787054 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 764 | Open in IMG/M |
| 3300012986|Ga0164304_11531504 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 553 | Open in IMG/M |
| 3300012987|Ga0164307_11224531 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 623 | Open in IMG/M |
| 3300012988|Ga0164306_10124122 | All Organisms → cellular organisms → Bacteria | 1723 | Open in IMG/M |
| 3300012989|Ga0164305_10232146 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1320 | Open in IMG/M |
| 3300015371|Ga0132258_13147792 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1140 | Open in IMG/M |
| 3300015372|Ga0132256_100917127 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 992 | Open in IMG/M |
| 3300015372|Ga0132256_103236166 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 548 | Open in IMG/M |
| 3300015373|Ga0132257_101093937 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1006 | Open in IMG/M |
| 3300015373|Ga0132257_101425441 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 882 | Open in IMG/M |
| 3300017657|Ga0134074_1334179 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
| 3300017997|Ga0184610_1027769 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1568 | Open in IMG/M |
| 3300018000|Ga0184604_10249745 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 620 | Open in IMG/M |
| 3300018000|Ga0184604_10289621 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
| 3300018027|Ga0184605_10278695 | All Organisms → cellular organisms → Bacteria | 759 | Open in IMG/M |
| 3300018028|Ga0184608_10461755 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 546 | Open in IMG/M |
| 3300018056|Ga0184623_10086053 | All Organisms → cellular organisms → Bacteria | 1449 | Open in IMG/M |
| 3300018066|Ga0184617_1054750 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1024 | Open in IMG/M |
| 3300018066|Ga0184617_1067162 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 947 | Open in IMG/M |
| 3300018067|Ga0184611_1088997 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1064 | Open in IMG/M |
| 3300018071|Ga0184618_10261551 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 733 | Open in IMG/M |
| 3300018073|Ga0184624_10064016 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1518 | Open in IMG/M |
| 3300018073|Ga0184624_10135492 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1075 | Open in IMG/M |
| 3300018075|Ga0184632_10049803 | All Organisms → cellular organisms → Bacteria | 1808 | Open in IMG/M |
| 3300018076|Ga0184609_10053112 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1734 | Open in IMG/M |
| 3300018433|Ga0066667_12287874 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300019789|Ga0137408_1003310 | All Organisms → cellular organisms → Bacteria | 1986 | Open in IMG/M |
| 3300019866|Ga0193756_1003620 | All Organisms → cellular organisms → Bacteria | 1768 | Open in IMG/M |
| 3300019875|Ga0193701_1033129 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1060 | Open in IMG/M |
| 3300019876|Ga0193703_1001127 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 3824 | Open in IMG/M |
| 3300019879|Ga0193723_1047741 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1262 | Open in IMG/M |
| 3300019883|Ga0193725_1076889 | All Organisms → cellular organisms → Bacteria | 817 | Open in IMG/M |
| 3300019885|Ga0193747_1127370 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
| 3300019886|Ga0193727_1028804 | All Organisms → cellular organisms → Bacteria | 1920 | Open in IMG/M |
| 3300019996|Ga0193693_1026932 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 1029 | Open in IMG/M |
| 3300019998|Ga0193710_1009703 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 970 | Open in IMG/M |
| 3300020000|Ga0193692_1087174 | All Organisms → cellular organisms → Bacteria | 674 | Open in IMG/M |
| 3300020016|Ga0193696_1101939 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 737 | Open in IMG/M |
| 3300020062|Ga0193724_1063923 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 772 | Open in IMG/M |
| 3300021078|Ga0210381_10084366 | All Organisms → cellular organisms → Bacteria | 1010 | Open in IMG/M |
| 3300021080|Ga0210382_10024299 | All Organisms → cellular organisms → Bacteria | 2222 | Open in IMG/M |
| 3300021086|Ga0179596_10444789 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 656 | Open in IMG/M |
| 3300021411|Ga0193709_1048974 | All Organisms → cellular organisms → Bacteria | 986 | Open in IMG/M |
| 3300021415|Ga0193694_1051090 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
| 3300021951|Ga0222624_1106424 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 625 | Open in IMG/M |
| 3300025915|Ga0207693_11401039 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 519 | Open in IMG/M |
| 3300025918|Ga0207662_10225376 | All Organisms → cellular organisms → Bacteria | 1222 | Open in IMG/M |
| 3300025930|Ga0207701_10147584 | All Organisms → cellular organisms → Bacteria | 2086 | Open in IMG/M |
| 3300025930|Ga0207701_10278499 | All Organisms → cellular organisms → Bacteria | 1456 | Open in IMG/M |
| 3300025930|Ga0207701_10632621 | All Organisms → cellular organisms → Bacteria | 909 | Open in IMG/M |
| 3300026306|Ga0209468_1162566 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 570 | Open in IMG/M |
| 3300026324|Ga0209470_1298848 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
| 3300026329|Ga0209375_1084035 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1468 | Open in IMG/M |
| 3300026374|Ga0257146_1003849 | All Organisms → cellular organisms → Bacteria | 2500 | Open in IMG/M |
| 3300026557|Ga0179587_10953781 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
| 3300027560|Ga0207981_1093204 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
| 3300028714|Ga0307309_10134281 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 615 | Open in IMG/M |
| 3300028803|Ga0307281_10044407 | All Organisms → cellular organisms → Bacteria | 1380 | Open in IMG/M |
| 3300030777|Ga0075402_11510877 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
| 3300030844|Ga0075377_11715013 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1378 | Open in IMG/M |
| 3300030923|Ga0138296_1529774 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 769 | Open in IMG/M |
| 3300031015|Ga0138298_1038387 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300031015|Ga0138298_1613249 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 825 | Open in IMG/M |
| 3300031057|Ga0170834_101326722 | All Organisms → cellular organisms → Bacteria | 1474 | Open in IMG/M |
| 3300031231|Ga0170824_113835730 | All Organisms → cellular organisms → Bacteria | 964 | Open in IMG/M |
| 3300031231|Ga0170824_117977165 | All Organisms → cellular organisms → Bacteria | 9883 | Open in IMG/M |
| 3300031231|Ga0170824_126612133 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
| 3300031474|Ga0170818_101344670 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 537 | Open in IMG/M |
| 3300031719|Ga0306917_10432159 | All Organisms → cellular organisms → Bacteria | 1030 | Open in IMG/M |
| 3300031720|Ga0307469_10951094 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 799 | Open in IMG/M |
| 3300033412|Ga0310810_10217314 | All Organisms → cellular organisms → Bacteria | 2140 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 19.55% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 17.29% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 10.53% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 9.77% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.51% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 3.76% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 3.76% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 2.26% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.26% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 2.26% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.26% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.50% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 1.50% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.50% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.50% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.50% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 1.50% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.75% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.75% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.75% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.75% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.75% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.75% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.75% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.75% |
| Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.75% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.75% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.75% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.75% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.75% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.75% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.75% |
| Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.75% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.75% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459010 | Grass soil microbial communities from Rothamsted Park, UK - December 2009 direct MP BIO1O1 lysis 0-9cm (no DNA from 10 to 21cm!!!) | Environmental | Open in IMG/M |
| 2170459016 | Litter degradation ZMR2 | Engineered | Open in IMG/M |
| 2189573002 | Grass soil microbial communities from Rothamsted Park, UK - FE1 (NaCl 30g/L 5ml) | Environmental | Open in IMG/M |
| 2189573004 | Grass soil microbial communities from Rothamsted Park, UK - FG2 (Nitrogen) | Environmental | Open in IMG/M |
| 3300000559 | Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300005164 | Soil and rhizosphere microbial communities from Laval, Canada - mgLAC | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 | Host-Associated | Open in IMG/M |
| 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
| 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300010154 | Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010861 | Boreal forest soil eukaryotic communities from Alaska, USA - C4-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012941 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t4i015 | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300017657 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015 | Environmental | Open in IMG/M |
| 3300017997 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coex | Environmental | Open in IMG/M |
| 3300018000 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coex | Environmental | Open in IMG/M |
| 3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
| 3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
| 3300018056 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1 | Environmental | Open in IMG/M |
| 3300018066 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_b1 | Environmental | Open in IMG/M |
| 3300018067 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_coex | Environmental | Open in IMG/M |
| 3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
| 3300018073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1 | Environmental | Open in IMG/M |
| 3300018075 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1 | Environmental | Open in IMG/M |
| 3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300019866 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1m1 | Environmental | Open in IMG/M |
| 3300019875 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3s2 | Environmental | Open in IMG/M |
| 3300019876 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3a2 | Environmental | Open in IMG/M |
| 3300019879 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2 | Environmental | Open in IMG/M |
| 3300019883 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a2 | Environmental | Open in IMG/M |
| 3300019885 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1m2 | Environmental | Open in IMG/M |
| 3300019886 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c2 | Environmental | Open in IMG/M |
| 3300019996 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3a2 | Environmental | Open in IMG/M |
| 3300019998 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3m1 | Environmental | Open in IMG/M |
| 3300020000 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3a1 | Environmental | Open in IMG/M |
| 3300020016 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3m1 | Environmental | Open in IMG/M |
| 3300020062 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a1 | Environmental | Open in IMG/M |
| 3300021078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_coex redo | Environmental | Open in IMG/M |
| 3300021080 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo | Environmental | Open in IMG/M |
| 3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021411 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3c2 | Environmental | Open in IMG/M |
| 3300021415 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3s1 | Environmental | Open in IMG/M |
| 3300021951 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300026306 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 (SPAdes) | Environmental | Open in IMG/M |
| 3300026324 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes) | Environmental | Open in IMG/M |
| 3300026329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 (SPAdes) | Environmental | Open in IMG/M |
| 3300026374 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-08-A | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027560 | Soil and rhizosphere microbial communities from Laval, Canada - mgLPC (SPAdes) | Environmental | Open in IMG/M |
| 3300028714 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_196 | Environmental | Open in IMG/M |
| 3300028803 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_120 | Environmental | Open in IMG/M |
| 3300030777 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FB5 SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030844 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA11 EcM (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030923 | Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A3_MS_autumn Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300031015 | Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A9_MS_autumn Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| F62_00730250 | 2170459010 | Grass Soil | MLLSFVVVWFTQLRAREFDAATFRSFAGEAATVHGFF |
| 2ZMR_04037920 | 2170459016 | Switchgrass, Maize And Mischanthus Litter | LSFTFVWFMPLRARGFDAATFGSFAGEAATLHGFF |
| FE1_01147220 | 2189573002 | Grass Soil | MHTFLPFVVVWFTQLPAREFDAATFRSFADEAATVRDFF |
| FG2_10080440 | 2189573004 | Grass Soil | FLSFVVVGVTPLRAREFDAATFRSFDEAATVRGFF |
| F14TC_1040104392 | 3300000559 | Soil | MFLPFVVVWFTQLRAREFDAATFRSFAGEAVTVHGFF* |
| Ga0063356_1024098902 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MHTFLPFVVVWFTPLRAPEFDAATFRSLSDEATKVHGFF* |
| Ga0066815_100978892 | 3300005164 | Soil | MHIFLPFAIVWFTPLRAREFDAATFRSFADEAATAPGFF* |
| Ga0066678_106929541 | 3300005181 | Soil | MHIFLPFVVVWFTQLRAREFDAATFRSFAGEAATVRGFF* |
| Ga0066676_105642412 | 3300005186 | Soil | MHIFLPFGVVWFSQLRAREFDAATFRSFAGEAATVRGFF* |
| Ga0065704_103270392 | 3300005289 | Switchgrass Rhizosphere | MHMFLSFVVVWFRQLRAREFDAVTFRSFADEAATVRGFFSHSVFR* |
| Ga0070667_1010131352 | 3300005367 | Switchgrass Rhizosphere | MHIFLSFVVVWFTQLRAREFDAATFRSFAGEAATVRGFF* |
| Ga0070714_1013783881 | 3300005435 | Agricultural Soil | FHFFEVLMHPFLPFVVVWFTQLRAREFYAATFRSFADEAATKRGSF* |
| Ga0066682_101350944 | 3300005450 | Soil | MHTFLPFVVVSLRRLRAGEFDAATFPSLAGEAAALRVFF* |
| Ga0070662_1012571422 | 3300005457 | Corn Rhizosphere | MHTFLPFVVDWFTPLRAREFDAATFRSFADEAATAPGFF* |
| Ga0066697_106477012 | 3300005540 | Soil | MFLPFVVVWFTQLRAREFEAATFRSFAGEAATLRGFF* |
| Ga0066661_102728242 | 3300005554 | Soil | MFLPFVVVWFTQLRAREFDAATFRSFAGEAATVRGFF* |
| Ga0066692_104888652 | 3300005555 | Soil | MFLPFVVVWFTQLRAREFDAATFRRFAGEAATVRGFF* |
| Ga0066693_100449833 | 3300005566 | Soil | MHTFLPFVAVWFTQLRGGEFDAATFRSFAGEATTVRGFF* |
| Ga0066705_100232871 | 3300005569 | Soil | MHTFLPFVAGWFTQLRGGEFDAATFRSFAGEATTVRGFF* |
| Ga0066903_1031009792 | 3300005764 | Tropical Forest Soil | MHTFLPFVVVWFTQLRAREFDAATFRSFAGEAATVRGFF* |
| Ga0068860_1019193892 | 3300005843 | Switchgrass Rhizosphere | MHIFLPFAIVWFTPLRAREFDAATFRSFVDEAATAPGFF* |
| Ga0068860_1023223972 | 3300005843 | Switchgrass Rhizosphere | KVLMHTFLSFVVVWFTPLRAREFYAATFRSFDEAATVRGFF* |
| Ga0066652_1007889602 | 3300006046 | Soil | MFLPFVVVWFTQLRAREFDAATLRSFAGEAATVRGFF* |
| Ga0070715_105968961 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | MHTFLSFVVVWFTPLRAREFDAATFRSFDEAATVPGFF* |
| Ga0066660_109287932 | 3300006800 | Soil | MHMFLPFVVVWFTQLRAREFEAATFRSFAGEAATLRGFF* |
| Ga0068865_1009316992 | 3300006881 | Miscanthus Rhizosphere | MHTFLPFVVIWFTQLRAREFDAATFRSFADEAATLRGFF* |
| Ga0099791_100139741 | 3300007255 | Vadose Zone Soil | MFLPFVVFWFTQLRAREFDAVIFRSFVGEAATVRGFF* |
| Ga0099793_100951973 | 3300007258 | Vadose Zone Soil | MFLPFVVVSFTQLRARESDAATFRSFAGEPTTVRGFF* |
| Ga0066710_1020210072 | 3300009012 | Grasslands Soil | MHTFLPFVVVWFTPLRAREFDAATFRSFADEAATVRGFF |
| Ga0099827_102919172 | 3300009090 | Vadose Zone Soil | MFLPFVVVWFTQLRAREFDAATFRSFAGEAMTVRGFF* |
| Ga0066709_1003576743 | 3300009137 | Grasslands Soil | MHTFLPFVVVWFTPLRAREFDAATFRSFAGEAATVRGFF* |
| Ga0105242_105983611 | 3300009176 | Miscanthus Rhizosphere | FLPFAIVWFTPLRAREFDAATFRSFVDEAATAPGFF* |
| Ga0105237_118654931 | 3300009545 | Corn Rhizosphere | QFHFFKVLMHTFLSFVVVWVTPLSAREFYAATFRSFDEAATVRGFF* |
| Ga0127503_105330702 | 3300010154 | Soil | MHTFSSFVVVCFTPLRAREFYGATFRSFDEAATVRGFF* |
| Ga0134064_100495092 | 3300010325 | Grasslands Soil | MHTFLPFVVVWFTPLRAREFDAATFRSFAGEATTVRGFF* |
| Ga0134063_104166531 | 3300010335 | Grasslands Soil | MFLPFVVVWFTQLRAREFDVATFRRFAGEAATVRGFF* |
| Ga0134063_104270171 | 3300010335 | Grasslands Soil | TFLPFVAGWFTQLRGGEFDAATFRSFAGEATTVRGFF* |
| Ga0105239_134406962 | 3300010375 | Corn Rhizosphere | MHTFLSFVVVWFTPLRAREFDAATFRSFDEAATVRGFF* |
| Ga0126349_12645811 | 3300010861 | Boreal Forest Soil | VLMHMFLPFVVVSFTQLRARGSDAATFRSFAGEAATVRGFF* |
| Ga0137364_103971442 | 3300012198 | Vadose Zone Soil | MHTFLPFMAVWFTQLRGGEFDAATFRSFAGEATTVRGFF* |
| Ga0137381_103536542 | 3300012207 | Vadose Zone Soil | MFLPFVVVWFMQLRAREFDAATFRNFAGEAATVRGFF* |
| Ga0137377_107990101 | 3300012211 | Vadose Zone Soil | MHVFLPFGVVWFSQLRAREFDAATFRSFAGEAATVRGFF* |
| Ga0137370_100098551 | 3300012285 | Vadose Zone Soil | FFKVLMHTFLPFVAVWFTQLRGGEFDAATFRSFAGEATTVRGFF* |
| Ga0137370_107330342 | 3300012285 | Vadose Zone Soil | MFLPFVVVWFTQLRAREFDVATFRSFAGEAATVRGFF* |
| Ga0137387_102354903 | 3300012349 | Vadose Zone Soil | MFLPFVVVWFTPLRAREFDAATFRSFADEAATVRGFF* |
| Ga0137366_103295692 | 3300012354 | Vadose Zone Soil | MFLPFVVVWFTQLRAREFDAATFRSFAGEAATMRGFF* |
| Ga0137371_107869532 | 3300012356 | Vadose Zone Soil | MHTFLPFVVVWFTPLRAREFDAATFRNFAGEAATVRGFF* |
| Ga0137384_101862042 | 3300012357 | Vadose Zone Soil | MFLPFVVVWFTQLRAREFDAATVRRFAGEAATVRGFF* |
| Ga0137360_106808772 | 3300012361 | Vadose Zone Soil | MFLPFVVVWFTQLRARDFDAATFRSFSGEEATVRGFF* |
| Ga0137360_113756652 | 3300012361 | Vadose Zone Soil | LHFFKVFVHIFLSFTVVWFTPVRARGFDAATFGSFAGEAATLRGFF* |
| Ga0137397_100857735 | 3300012685 | Vadose Zone Soil | MHTFLSFVVVWFTPLFAREFDAATFRSFDEAATVRGFF* |
| Ga0137395_107951122 | 3300012917 | Vadose Zone Soil | MFLRFVVVWFTQLRAREFDAATFRSFAGEAATVRGFF* |
| Ga0137396_101201613 | 3300012918 | Vadose Zone Soil | MHTFLPFVVVWVTPLRAREFDAATFRSFDEAATVRGFF* |
| Ga0137396_105296302 | 3300012918 | Vadose Zone Soil | MFLPFVVVWFTQLRAREFDAATFRSFAGEATTVRGFF* |
| Ga0137404_113416572 | 3300012929 | Vadose Zone Soil | HFFKVLMHMFLPFVVVWFTQLRAREFDAATFRSFSDEAATVRGFF* |
| Ga0137407_106719712 | 3300012930 | Vadose Zone Soil | MFLPFVVVWFTQLRAREFDAATFRSFSDEAATVRGFF* |
| Ga0162652_1000197581 | 3300012941 | Soil | MSLPFVVVWVTQLRAREFDAATFRSFAGEAATVRGFF* |
| Ga0164298_101420393 | 3300012955 | Soil | MHTFLSFVVVWFTPLRAHEFDAATFRSFDEAATVPGFF* |
| Ga0164299_101609423 | 3300012958 | Soil | SSFVVVCFTPLRAREFYGATFRSFDEAATVRGFF* |
| Ga0164299_103265604 | 3300012958 | Soil | MHTFLSFVVVWFTPLRAREFDAATFRSFADEAATVSGFF* |
| Ga0164302_111665761 | 3300012961 | Soil | KVLLHIFLPFVVVWFTPLRAREFDAAPFRSFADEAATAPGFF* |
| Ga0134077_104959402 | 3300012972 | Grasslands Soil | HTFLPFVAVWSTQLRGGEFDAATFRSFAGEAATVRGFF* |
| Ga0164309_107870542 | 3300012984 | Soil | MHTFLSFVVVWFTPLRAREFDAATFRSFDEAATVAGFF* |
| Ga0164304_115315042 | 3300012986 | Soil | FFKVLMHTFLSFVVVWFTPLRAREFDAATFRSFDEAATVPGFF* |
| Ga0164307_112245312 | 3300012987 | Soil | MHPFLPFVVVWFTQLRAREFDAAIFRSFADEAATVRGFF* |
| Ga0164306_101241223 | 3300012988 | Soil | MHTFLSFVVVWFTPLRAREFDAATFRSFADEAATVRGFF* |
| Ga0164305_102321462 | 3300012989 | Soil | MHPFLPFVVVWFTQLRARELDAATFRSFADEAATVRGFF* |
| Ga0132258_131477922 | 3300015371 | Arabidopsis Rhizosphere | MHIFLSFVVVWFTQLCAREFDAATFRSFAGEAATVRGFF* |
| Ga0132256_1009171273 | 3300015372 | Arabidopsis Rhizosphere | MHIFLPFAIVWFTPLRAREFDAATFRGFADEAATAPGFF* |
| Ga0132256_1032361662 | 3300015372 | Arabidopsis Rhizosphere | MHILLPFAIVWFMQLRAREFDAATFRSFAAVAATAPGFF* |
| Ga0132257_1010939371 | 3300015373 | Arabidopsis Rhizosphere | MHRFLPFVVVWFTPLRAREFDAATFPSFAEAATVRGFF* |
| Ga0132257_1014254411 | 3300015373 | Arabidopsis Rhizosphere | QFHFFKVLMHIFLSFVVVWFTQLRAREFNAATFRSFAGEAATVRGFF* |
| Ga0134074_13341792 | 3300017657 | Grasslands Soil | MHTFLPFVVVSLRRLRAGEFDAATFPSLAGEAATLRVFF |
| Ga0184610_10277692 | 3300017997 | Groundwater Sediment | MFLPFVVVGFTQLRARESDAATFRSFAGEAATVRGFF |
| Ga0184604_102497452 | 3300018000 | Groundwater Sediment | MFLPFVVVSFTQLRAREFDAATFRSFAGEAATVRGFF |
| Ga0184604_102896212 | 3300018000 | Groundwater Sediment | MHTFLPFVVVWFTPLRAREFGAATFRNFAGEAATVRGFF |
| Ga0184605_102786952 | 3300018027 | Groundwater Sediment | MFLPFVVVWFTQLRAREFDAATFRSFAGEAATVRGFF |
| Ga0184608_104617552 | 3300018028 | Groundwater Sediment | MFLPFVVVRFTQLRVREFDAATFRSFAGEAATVRGFF |
| Ga0184623_100860532 | 3300018056 | Groundwater Sediment | MFLPFVVVWFMQLHAREFDAATFRSFAGEAATVRGFF |
| Ga0184617_10547503 | 3300018066 | Groundwater Sediment | MFLPFVVVSFTQLRAREFDAATFRSFAGEAAMVRTFF |
| Ga0184617_10671622 | 3300018066 | Groundwater Sediment | MHTFLPFVVVWFTPLRAREFDAATFRSLSDEATKVHGFF |
| Ga0184611_10889972 | 3300018067 | Groundwater Sediment | MSLPFVVVWLTQLRAREFDAATFRSFAGEAATVRGFF |
| Ga0184618_102615512 | 3300018071 | Groundwater Sediment | MHIFLPFVVVWFTQLRAREFDAATFRSFAGEAATVRGFF |
| Ga0184624_100640162 | 3300018073 | Groundwater Sediment | MSLPFVVVWFTQLRAREFDAATFRSFAGEAATVRGFF |
| Ga0184624_101354922 | 3300018073 | Groundwater Sediment | MHIFLPFAIVWFTPLRAREFDAATFRSFADEAATAPGFF |
| Ga0184632_100498033 | 3300018075 | Groundwater Sediment | MFLTFVVVWFTQLRAREFDAATFRSFAGEAATVRGFF |
| Ga0184609_100531122 | 3300018076 | Groundwater Sediment | MFLPFVVVWFMQLHAREFDAATFRSFSGEAATVRGFF |
| Ga0066667_122878742 | 3300018433 | Grasslands Soil | MFLPFVVVWFTPLRAREFDAATFRSFADEAATVRGFF |
| Ga0137408_10033104 | 3300019789 | Vadose Zone Soil | MFLPFVVVWFTQLRAREFDAATFRSFSDEAATVRGFF |
| Ga0193756_10036203 | 3300019866 | Soil | MHIFLSFVVVWFTQLRAREFDAATFRSFAGEAATVRGFF |
| Ga0193701_10331291 | 3300019875 | Soil | VLMHIFLPFAIVWFTPLRVREFDAATFRSFSDEAATAPGFF |
| Ga0193703_10011273 | 3300019876 | Soil | MHIFLPFAIVWFTPLRVREFDAATFRSFSDEAATAPGFF |
| Ga0193723_10477412 | 3300019879 | Soil | MHIFLPFAIVWFTQLPAREFGAATFRSFADEGAMVRGFF |
| Ga0193725_10768893 | 3300019883 | Soil | MHAFLPFVVVWFTQLRAREFDAATFRSFADEAATVRGFF |
| Ga0193747_11273702 | 3300019885 | Soil | MHTFLSFVVVWFTPLRAREFDAATFRSFDEPATVCGFF |
| Ga0193727_10288042 | 3300019886 | Soil | MHTFLSFVVVWFTPLRAREFDAATFRSFDEAATVRGFF |
| Ga0193693_10269321 | 3300019996 | Soil | FKVLMHTFLPFVVVWVTPLRAREFDAATFRSFDEAATVRGFF |
| Ga0193710_10097032 | 3300019998 | Soil | MFLPFVVVWFTQLRARESDAATFRSFAGEAATVRGFF |
| Ga0193692_10871742 | 3300020000 | Soil | MHTFLSFVVVWFTPLCAREFDAATFRSFDEAATVRGFF |
| Ga0193696_11019393 | 3300020016 | Soil | VLMHMFLPFVVVWFMQLRAREFDAATFRSFAGEAATVRGFF |
| Ga0193724_10639232 | 3300020062 | Soil | FLSFVVVWFTQLRAREFDAATFRSFAGEAATVRGFF |
| Ga0210381_100843663 | 3300021078 | Groundwater Sediment | MFLPFVAVGFTQLRARESDAATFRSFAGEAATVRGFF |
| Ga0210382_100242992 | 3300021080 | Groundwater Sediment | MFLPFVVVWFTQLRAREFDAATFRSFADEAATVRGFF |
| Ga0179596_104447892 | 3300021086 | Vadose Zone Soil | MFLPFVVVSFTQLRARESDAATFRSFAGEPATVRGFF |
| Ga0193709_10489741 | 3300021411 | Soil | MFLPFVVVWFTQLRAESDAATFRSFAGEAPTVRGFF |
| Ga0193694_10510901 | 3300021415 | Soil | MFLPFVVVWFTQLRAREFDAATLQSFAGDAPTVRGFF |
| Ga0222624_11064242 | 3300021951 | Groundwater Sediment | VLMHMFLPFVAVGFTQLRARESDAATFRSFAGEAATVRGFF |
| Ga0207693_114010392 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | FFKVLHTLLPFVVVRFTQLRAREFDAATFRSFADEAATVRGFF |
| Ga0207662_102253763 | 3300025918 | Switchgrass Rhizosphere | MHTFLSFVVVWFTPLRVREFYAATFRSFDEAATVRGFF |
| Ga0207701_101475845 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | MHTFLSFVVVWFTPLRAREFYAATFRSFDEAATVRGFF |
| Ga0207701_102784992 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | MHTFLPFVVDWFTPLRAREFDAATFRSFADEAATAPGFF |
| Ga0207701_106326212 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | MHIFLPFAIVWFTPLRAREFDAATFRSFVDEAATAPGFF |
| Ga0209468_11625662 | 3300026306 | Soil | MHTFLPFVAVWFTQLRGGEFDAATFRSFAGEATTVRGFF |
| Ga0209470_12988482 | 3300026324 | Soil | MHIFLPFGVVWFSQLRAREFDAATFRSFAGEAATVRGFF |
| Ga0209375_10840352 | 3300026329 | Soil | MHTFLPFVVVSLRRLRAGEFDAATFPSLAGEAAALRVFF |
| Ga0257146_10038494 | 3300026374 | Soil | MHTFLPFVVVWVTPLRAREFYAATFRSFDEAATVRGFF |
| Ga0179587_109537812 | 3300026557 | Vadose Zone Soil | MFLPFVVVSFTQLRARESDAATFRSFAGEPTTVRGFF |
| Ga0207981_10932042 | 3300027560 | Soil | MHIFLPFAIVWFTPLRAREFDAATFRGFADEAATAPGFF |
| Ga0307309_101342811 | 3300028714 | Soil | HFFKVLMHIFLPFAIVWFTPLRVREFDAATFRSFSDEAATAPGFF |
| Ga0307281_100444073 | 3300028803 | Soil | MHIFLPFAIVWFMQLRAREFDAATFRSFADVAATAPGFF |
| Ga0075402_115108771 | 3300030777 | Soil | MHTFLSFVVVWFTPLRAREFDAATFRSFAEAATVRGFF |
| Ga0075377_117150132 | 3300030844 | Soil | MHIFLPFVVVCFTQLRAREFDAVTFRSFAGEAATVRGFF |
| Ga0138296_15297743 | 3300030923 | Soil | FFFTFVWFTSLRAHGFDAATFGSFAGEAATLRRFF |
| Ga0138298_10383872 | 3300031015 | Soil | VHVFLSFAFVWFTSLRAQGFDAATFGSFAGEAATLRRFF |
| Ga0138298_16132492 | 3300031015 | Soil | VHIFLSFTFVWFMPVRARGFRAATFGSFAGEAVTLRGFF |
| Ga0170834_1013267222 | 3300031057 | Forest Soil | MHTFLPFVVVWFTQLCALEFDAANFQSFADEAATVRGLF |
| Ga0170824_1138357303 | 3300031231 | Forest Soil | MHTFLPFVVVWFTQLPAREFDAATFRSFADEAATVRDLF |
| Ga0170824_1179771656 | 3300031231 | Forest Soil | MHTFLLFVVVCFTQLRAREFDAATFRSFADEAATVRGFF |
| Ga0170824_1266121331 | 3300031231 | Forest Soil | MFLTFVVVWFTQLRARESDAATFRSFAGEAATVRGFF |
| Ga0170818_1013446701 | 3300031474 | Forest Soil | VLLHRFLPSVAVWFTQLRARESDAATFRSFAGEAATVRGFF |
| Ga0306917_104321592 | 3300031719 | Soil | VHVFLSFTFVWFTPLRARGFDAATFRGLAGEAATLRGFF |
| Ga0307469_109510941 | 3300031720 | Hardwood Forest Soil | MHTFLPFVVVWFTPLRAREFDAVTFRSFADEAATVRG |
| Ga0310810_102173142 | 3300033412 | Soil | MHAFLFFVVVWFTPLRAREFDAATFRSFADEAATVRGFF |
| ⦗Top⦘ |