


| Basic Information | |
|---|---|
| Family ID | F060283 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 133 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MKVEKEKFDSLLGKLLKAKPEPRKKIKTKGRRGPKTPILAK |
| Number of Associated Samples | 110 |
| Number of Associated Scaffolds | 133 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 24.24 % |
| % of genes near scaffold ends (potentially truncated) | 22.56 % |
| % of genes from short scaffolds (< 2000 bps) | 71.43 % |
| Associated GOLD sequencing projects | 100 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.28 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (63.158 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (34.587 % of family members) |
| Environment Ontology (ENVO) | Unclassified (38.346 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (42.105 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 18.84% β-sheet: 0.00% Coil/Unstructured: 81.16% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.28 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 133 Family Scaffolds |
|---|---|---|
| PF12762 | DDE_Tnp_IS1595 | 24.06 |
| PF12686 | DUF3800 | 3.76 |
| PF01381 | HTH_3 | 2.26 |
| PF13274 | DUF4065 | 2.26 |
| PF05066 | HARE-HTH | 1.50 |
| PF00574 | CLP_protease | 1.50 |
| PF12760 | Zn_Tnp_IS1595 | 1.50 |
| PF05973 | Gp49 | 1.50 |
| PF00072 | Response_reg | 0.75 |
| PF04365 | BrnT_toxin | 0.75 |
| PF04101 | Glyco_tran_28_C | 0.75 |
| PF01242 | PTPS | 0.75 |
| PF13474 | SnoaL_3 | 0.75 |
| PF10546 | P63C | 0.75 |
| PF13350 | Y_phosphatase3 | 0.75 |
| PF02621 | VitK2_biosynth | 0.75 |
| PF15919 | HicB_lk_antitox | 0.75 |
| PF09335 | SNARE_assoc | 0.75 |
| PF02661 | Fic | 0.75 |
| PF13673 | Acetyltransf_10 | 0.75 |
| PF13384 | HTH_23 | 0.75 |
| PF02452 | PemK_toxin | 0.75 |
| PF00691 | OmpA | 0.75 |
| PF14534 | DUF4440 | 0.75 |
| PF05534 | HicB | 0.75 |
| PF00881 | Nitroreductase | 0.75 |
| PF10263 | SprT-like | 0.75 |
| PF02769 | AIRS_C | 0.75 |
| PF06803 | DUF1232 | 0.75 |
| COG ID | Name | Functional Category | % Frequency in 133 Family Scaffolds |
|---|---|---|---|
| COG0616 | Periplasmic serine protease, ClpP class | Posttranslational modification, protein turnover, chaperones [O] | 3.01 |
| COG0740 | ATP-dependent protease ClpP, protease subunit | Posttranslational modification, protein turnover, chaperones [O] | 3.01 |
| COG1030 | Membrane-bound serine protease NfeD, ClpP class | Posttranslational modification, protein turnover, chaperones [O] | 1.50 |
| COG3343 | DNA-directed RNA polymerase, delta subunit | Transcription [K] | 1.50 |
| COG3657 | Putative component of the toxin-antitoxin plasmid stabilization module | Defense mechanisms [V] | 1.50 |
| COG4679 | Phage-related protein gp49, toxin component of the Tad-Ata toxin-antitoxin system | Defense mechanisms [V] | 1.50 |
| COG0398 | Uncharacterized membrane protein YdjX, related to fungal oxalate transporter, TVP38/TMEM64 family | Function unknown [S] | 0.75 |
| COG0586 | Membrane integrity protein DedA, putative transporter, DedA/Tvp38 family | Cell wall/membrane/envelope biogenesis [M] | 0.75 |
| COG0720 | 6-pyruvoyl-tetrahydropterin synthase | Coenzyme transport and metabolism [H] | 0.75 |
| COG1238 | Uncharacterized membrane protein YqaA, VTT domain | Function unknown [S] | 0.75 |
| COG1427 | Chorismate dehydratase (menaquinone biosynthesis, futalosine pathway) | Coenzyme transport and metabolism [H] | 0.75 |
| COG1598 | Antitoxin component HicB of the HicAB toxin-antitoxin system | Defense mechanisms [V] | 0.75 |
| COG2337 | mRNA-degrading endonuclease MazF, toxin component of the MazEF toxin-antitoxin module | Defense mechanisms [V] | 0.75 |
| COG2929 | Ribonuclease BrnT, toxin component of the BrnT-BrnA toxin-antitoxin system | Defense mechanisms [V] | 0.75 |
| COG3339 | Uncharacterized membrane protein YkvA, DUF1232 family | Function unknown [S] | 0.75 |
| COG4226 | Predicted nuclease of the RNAse H fold, HicB family | General function prediction only [R] | 0.75 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 63.91 % |
| Unclassified | root | N/A | 36.09 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2088090014|GPIPI_17466794 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 26241 | Open in IMG/M |
| 3300001545|JGI12630J15595_10012797 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1814 | Open in IMG/M |
| 3300001593|JGI12635J15846_10049367 | All Organisms → cellular organisms → Bacteria | 3220 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101647597 | Not Available | 540 | Open in IMG/M |
| 3300004080|Ga0062385_10140151 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1234 | Open in IMG/M |
| 3300004082|Ga0062384_101273739 | Not Available | 537 | Open in IMG/M |
| 3300004092|Ga0062389_100386152 | All Organisms → cellular organisms → Bacteria | 1512 | Open in IMG/M |
| 3300004479|Ga0062595_102002491 | Not Available | 559 | Open in IMG/M |
| 3300005174|Ga0066680_10542542 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 731 | Open in IMG/M |
| 3300005332|Ga0066388_100902789 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1461 | Open in IMG/M |
| 3300005434|Ga0070709_10614521 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 838 | Open in IMG/M |
| 3300005536|Ga0070697_100279427 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1432 | Open in IMG/M |
| 3300005537|Ga0070730_10023810 | All Organisms → cellular organisms → Bacteria | 4707 | Open in IMG/M |
| 3300005537|Ga0070730_10033699 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3841 | Open in IMG/M |
| 3300005542|Ga0070732_10118326 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1568 | Open in IMG/M |
| 3300005591|Ga0070761_10324160 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidipila → unclassified Acidipila → Acidipila sp. | 930 | Open in IMG/M |
| 3300005602|Ga0070762_10025843 | All Organisms → cellular organisms → Bacteria | 3105 | Open in IMG/M |
| 3300006102|Ga0075015_100455719 | All Organisms → cellular organisms → Bacteria | 730 | Open in IMG/M |
| 3300006162|Ga0075030_100480691 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 988 | Open in IMG/M |
| 3300006173|Ga0070716_100367200 | All Organisms → cellular organisms → Bacteria | 1024 | Open in IMG/M |
| 3300006237|Ga0097621_100938146 | Not Available | 807 | Open in IMG/M |
| 3300006800|Ga0066660_10481027 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1042 | Open in IMG/M |
| 3300006861|Ga0063777_1046167 | Not Available | 506 | Open in IMG/M |
| 3300006903|Ga0075426_10085015 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2263 | Open in IMG/M |
| 3300006903|Ga0075426_10142689 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_61_28 | 1726 | Open in IMG/M |
| 3300007258|Ga0099793_10450786 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Terriglobus → Terriglobus albidus | 636 | Open in IMG/M |
| 3300007265|Ga0099794_10059248 | All Organisms → cellular organisms → Bacteria | 1857 | Open in IMG/M |
| 3300009012|Ga0066710_100723511 | Not Available | 1520 | Open in IMG/M |
| 3300009038|Ga0099829_10231480 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1503 | Open in IMG/M |
| 3300009038|Ga0099829_11189011 | Not Available | 631 | Open in IMG/M |
| 3300009549|Ga0116137_1071848 | Not Available | 1064 | Open in IMG/M |
| 3300010159|Ga0099796_10282126 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 699 | Open in IMG/M |
| 3300010376|Ga0126381_100225285 | Not Available | 2524 | Open in IMG/M |
| 3300010379|Ga0136449_100374150 | All Organisms → cellular organisms → Bacteria | 2544 | Open in IMG/M |
| 3300010858|Ga0126345_1284803 | Not Available | 1081 | Open in IMG/M |
| 3300010865|Ga0126346_1355591 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_59_13 | 1253 | Open in IMG/M |
| 3300011120|Ga0150983_16003615 | Not Available | 1064 | Open in IMG/M |
| 3300011269|Ga0137392_10914555 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 722 | Open in IMG/M |
| 3300011269|Ga0137392_11006766 | Not Available | 684 | Open in IMG/M |
| 3300011270|Ga0137391_10062005 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3202 | Open in IMG/M |
| 3300011271|Ga0137393_11364746 | Not Available | 598 | Open in IMG/M |
| 3300011305|Ga0138532_1139984 | Not Available | 561 | Open in IMG/M |
| 3300012189|Ga0137388_10029138 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4275 | Open in IMG/M |
| 3300012189|Ga0137388_10694697 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 945 | Open in IMG/M |
| 3300012200|Ga0137382_11192077 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 541 | Open in IMG/M |
| 3300012203|Ga0137399_10013901 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella aggregans | 4994 | Open in IMG/M |
| 3300012203|Ga0137399_10122739 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2043 | Open in IMG/M |
| 3300012203|Ga0137399_10779819 | Not Available | 805 | Open in IMG/M |
| 3300012203|Ga0137399_11024419 | Not Available | 695 | Open in IMG/M |
| 3300012203|Ga0137399_11266106 | Not Available | 621 | Open in IMG/M |
| 3300012205|Ga0137362_10003230 | All Organisms → cellular organisms → Bacteria | 10868 | Open in IMG/M |
| 3300012206|Ga0137380_11455015 | Not Available | 570 | Open in IMG/M |
| 3300012206|Ga0137380_11603025 | Not Available | 535 | Open in IMG/M |
| 3300012207|Ga0137381_10237537 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_61_28 | 1583 | Open in IMG/M |
| 3300012349|Ga0137387_10184605 | All Organisms → cellular organisms → Bacteria | 1495 | Open in IMG/M |
| 3300012357|Ga0137384_10663564 | Not Available | 848 | Open in IMG/M |
| 3300012359|Ga0137385_10201891 | All Organisms → cellular organisms → Bacteria | 1735 | Open in IMG/M |
| 3300012361|Ga0137360_10097248 | All Organisms → cellular organisms → Bacteria | 2244 | Open in IMG/M |
| 3300012582|Ga0137358_10157958 | All Organisms → cellular organisms → Bacteria | 1545 | Open in IMG/M |
| 3300012683|Ga0137398_10008764 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 5002 | Open in IMG/M |
| 3300012685|Ga0137397_10035192 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3577 | Open in IMG/M |
| 3300012685|Ga0137397_11289621 | Not Available | 520 | Open in IMG/M |
| 3300012917|Ga0137395_10110333 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1840 | Open in IMG/M |
| 3300012918|Ga0137396_10281949 | All Organisms → cellular organisms → Bacteria | 1227 | Open in IMG/M |
| 3300012918|Ga0137396_11171882 | Not Available | 544 | Open in IMG/M |
| 3300012922|Ga0137394_11359528 | Not Available | 572 | Open in IMG/M |
| 3300012925|Ga0137419_11273677 | Not Available | 617 | Open in IMG/M |
| 3300012927|Ga0137416_10118850 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Terriglobus → Terriglobus albidus | 2020 | Open in IMG/M |
| 3300012929|Ga0137404_11125465 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 721 | Open in IMG/M |
| 3300012929|Ga0137404_11316800 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 666 | Open in IMG/M |
| 3300012944|Ga0137410_10259022 | All Organisms → cellular organisms → Bacteria | 1365 | Open in IMG/M |
| 3300012944|Ga0137410_11730076 | Not Available | 551 | Open in IMG/M |
| 3300014968|Ga0157379_12680816 | Not Available | 500 | Open in IMG/M |
| 3300015241|Ga0137418_10445912 | Not Available | 1046 | Open in IMG/M |
| 3300015264|Ga0137403_10142946 | Not Available | 2364 | Open in IMG/M |
| 3300017929|Ga0187849_1059165 | Not Available | 1750 | Open in IMG/M |
| 3300017955|Ga0187817_10399822 | Not Available | 877 | Open in IMG/M |
| 3300018074|Ga0184640_10015774 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2803 | Open in IMG/M |
| 3300018088|Ga0187771_10179926 | All Organisms → cellular organisms → Bacteria | 1748 | Open in IMG/M |
| 3300020199|Ga0179592_10156849 | All Organisms → cellular organisms → Archaea → environmental samples → uncultured archaeon | 1040 | Open in IMG/M |
| 3300020199|Ga0179592_10505879 | Not Available | 517 | Open in IMG/M |
| 3300020579|Ga0210407_10060611 | All Organisms → cellular organisms → Bacteria | 2833 | Open in IMG/M |
| 3300020579|Ga0210407_10080493 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2455 | Open in IMG/M |
| 3300020580|Ga0210403_10112539 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2212 | Open in IMG/M |
| 3300020583|Ga0210401_10045493 | All Organisms → cellular organisms → Bacteria | 4152 | Open in IMG/M |
| 3300021168|Ga0210406_11375235 | Not Available | 505 | Open in IMG/M |
| 3300021170|Ga0210400_10082560 | All Organisms → cellular organisms → Bacteria | 2527 | Open in IMG/M |
| 3300021171|Ga0210405_10697806 | Not Available | 784 | Open in IMG/M |
| 3300021405|Ga0210387_10005375 | All Organisms → cellular organisms → Bacteria | 9793 | Open in IMG/M |
| 3300021420|Ga0210394_10000079 | All Organisms → cellular organisms → Bacteria | 230797 | Open in IMG/M |
| 3300021420|Ga0210394_10081720 | All Organisms → cellular organisms → Bacteria | 2791 | Open in IMG/M |
| 3300021433|Ga0210391_10987002 | Not Available | 656 | Open in IMG/M |
| 3300021478|Ga0210402_10946449 | Not Available | 788 | Open in IMG/M |
| 3300021559|Ga0210409_10024093 | All Organisms → cellular organisms → Bacteria | 5887 | Open in IMG/M |
| 3300022504|Ga0242642_1011149 | Not Available | 1110 | Open in IMG/M |
| 3300022726|Ga0242654_10192313 | Not Available | 705 | Open in IMG/M |
| 3300024178|Ga0247694_1034121 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 572 | Open in IMG/M |
| 3300025165|Ga0209108_10548658 | Not Available | 548 | Open in IMG/M |
| 3300025915|Ga0207693_10459140 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 995 | Open in IMG/M |
| 3300026319|Ga0209647_1022071 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3911 | Open in IMG/M |
| 3300026319|Ga0209647_1029453 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3241 | Open in IMG/M |
| 3300026446|Ga0257178_1006427 | Not Available | 1218 | Open in IMG/M |
| 3300026551|Ga0209648_10097391 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2418 | Open in IMG/M |
| 3300027645|Ga0209117_1002152 | All Organisms → cellular organisms → Bacteria | 6861 | Open in IMG/M |
| 3300027648|Ga0209420_1184909 | Not Available | 559 | Open in IMG/M |
| 3300027678|Ga0209011_1143163 | Not Available | 675 | Open in IMG/M |
| 3300027846|Ga0209180_10768057 | Not Available | 518 | Open in IMG/M |
| 3300027854|Ga0209517_10049123 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3210 | Open in IMG/M |
| 3300027857|Ga0209166_10033258 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3121 | Open in IMG/M |
| 3300027869|Ga0209579_10149682 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1244 | Open in IMG/M |
| 3300028047|Ga0209526_10032315 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3679 | Open in IMG/M |
| 3300028379|Ga0268266_11261484 | All Organisms → cellular organisms → Bacteria | 714 | Open in IMG/M |
| 3300028536|Ga0137415_10189830 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella aggregans | 1877 | Open in IMG/M |
| 3300028673|Ga0257175_1081011 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 623 | Open in IMG/M |
| 3300031057|Ga0170834_113438125 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division NC10 → unclassified candidate division NC10 → candidate division NC10 bacterium CSP1-5 | 1427 | Open in IMG/M |
| 3300031090|Ga0265760_10259375 | Not Available | 604 | Open in IMG/M |
| 3300031128|Ga0170823_12441557 | Not Available | 517 | Open in IMG/M |
| 3300031708|Ga0310686_110955398 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1419 | Open in IMG/M |
| 3300031708|Ga0310686_119255598 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Rhodanobacter → unclassified Rhodanobacter → Rhodanobacter sp. FW510-R10 | 1989 | Open in IMG/M |
| 3300031753|Ga0307477_10366627 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 989 | Open in IMG/M |
| 3300031754|Ga0307475_10361369 | All Organisms → cellular organisms → Bacteria | 1166 | Open in IMG/M |
| 3300031754|Ga0307475_10446169 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1040 | Open in IMG/M |
| 3300031754|Ga0307475_11067397 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 633 | Open in IMG/M |
| 3300031823|Ga0307478_10000879 | All Organisms → cellular organisms → Bacteria | 28469 | Open in IMG/M |
| 3300031823|Ga0307478_10761023 | Not Available | 811 | Open in IMG/M |
| 3300031962|Ga0307479_10825564 | Not Available | 902 | Open in IMG/M |
| 3300031962|Ga0307479_11001218 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 805 | Open in IMG/M |
| 3300032160|Ga0311301_10436979 | All Organisms → cellular organisms → Bacteria | 1980 | Open in IMG/M |
| 3300032205|Ga0307472_101499480 | Not Available | 658 | Open in IMG/M |
| 3300032892|Ga0335081_10720741 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1206 | Open in IMG/M |
| 3300032898|Ga0335072_11351485 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
| 3300033977|Ga0314861_0002878 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 17318 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 34.59% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 13.53% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 6.77% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 6.02% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 3.76% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 3.76% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.01% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.01% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.26% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.26% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.26% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.50% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.50% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.50% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.50% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.50% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 1.50% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.75% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.75% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.75% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.75% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.75% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.75% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.75% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.75% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.75% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.75% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.75% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.75% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.75% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2088090014 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001545 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006861 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 3 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009549 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_100 | Environmental | Open in IMG/M |
| 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010858 | Boreal forest soil eukaryotic communities from Alaska, USA - C3-2 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010865 | Boreal forest soil eukaryotic communities from Alaska, USA - C3-3 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300011305 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 10 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300017929 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_100 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300018074 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2 | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300022504 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-2-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022726 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300024178 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK35 | Environmental | Open in IMG/M |
| 3300025165 | Soil microbial communities from Rifle, Colorado, USA - sediment 10ft 1 | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026319 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026446 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-11-B | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027645 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027648 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027678 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
| 3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028673 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-69-B | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
| 3300033977 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - SJ75 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| GPIPI_00625840 | 2088090014 | Soil | MKVEKDRFDTLLGKMIATRPEPRKKIKTKGRKGSKSPILSLKL |
| JGI12630J15595_100127976 | 3300001545 | Forest Soil | MKVDKNKFDALLGKLLKAKPEPRKKIKTEGRKGSKSPILAK* |
| JGI12635J15846_100493675 | 3300001593 | Forest Soil | MKVEKEKFDSLLGKLLKAKPEPRKKIKTQGKRGPKPIIPPNS* |
| JGIcombinedJ26739_1016475972 | 3300002245 | Forest Soil | MKVEKGKFDDVLTKLLKAKPEPRKKIKTTGRRGSKAPILSPR* |
| Ga0062385_101401511 | 3300004080 | Bog Forest Soil | MKVEKEKFDALLTKLIKAKPEPRKKIKTTGKRGKPILTPR* |
| Ga0062384_1012737391 | 3300004082 | Bog Forest Soil | VRVEKQKFDDLLGKLLKAKPEPRKKIKTQGRRGPKTAILSRGSSGTDNS* |
| Ga0062389_1003861521 | 3300004092 | Bog Forest Soil | MKVEKQRFDDLLGKLLKAKPEPRKKIKTAKRKPAKIINSVPR* |
| Ga0062595_1020024913 | 3300004479 | Soil | MAKVRKDRFDALLTKLLAAKPEPRKKIKTQGRTGSKSPILGKKVC* |
| Ga0066680_105425422 | 3300005174 | Soil | MKVGKRKFDDALTKMLRAKPEPRKKIKTQGRRGPKTPILASRELLV |
| Ga0066388_1009027892 | 3300005332 | Tropical Forest Soil | MKVEKNKFDKLLVKLLSAEPEPRKKIKTQGRKGSKAPILAK* |
| Ga0070709_106145212 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MKVEKKKFDSLLGKLLKAKPEPRQKIKTQGRKGSKTPILAK* |
| Ga0070697_1002794273 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | GEYMAKVRKDRFDALLTKLLAAKPEPRKKIKTQGRTGSKSPILGKKVC* |
| Ga0070730_100238108 | 3300005537 | Surface Soil | MKVDKGKFDVLLGKLLRAKPEPRKKIKTKGKRGPKTPILSR* |
| Ga0070730_100336995 | 3300005537 | Surface Soil | VEKGTLKVEKQKFDNALSKLLKAKPEPRKAIKTTGRRTSKPILPVKP* |
| Ga0070732_101183263 | 3300005542 | Surface Soil | MRVEKEKFDSLLGKLLKAKPEPRKKIKTQGKRGPKTSIIPANDHLKRP* |
| Ga0070761_103241603 | 3300005591 | Soil | MKVEKEKFDSLLGKLLKAKPEPRKKIKTSGKRGPKSPILSR* |
| Ga0070762_100258435 | 3300005602 | Soil | MNKRVIVRKTEFDDILGKLLKAKPEPRKQIKTQGRKGSKAPILAKT* |
| Ga0075015_1004557192 | 3300006102 | Watersheds | MKANKEKFDALLGRLLKAKPKPRKKIKTQGRKGSKSPVLAKP* |
| Ga0075030_1004806913 | 3300006162 | Watersheds | MKVEKQKFDALLGKLLKAKPEPRKKIKTPGRKGSKAPILAK* |
| Ga0070716_1003672001 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | HAFEMKVEKQKFDSLLGKLLKAKPEPRKKIKTQGRKGSKAPILAK* |
| Ga0097621_1009381463 | 3300006237 | Miscanthus Rhizosphere | MKVEKEKFDSLLGKLLKAKPEPRKKIKTKGRRGPKTPILAK* |
| Ga0066660_104810272 | 3300006800 | Soil | MKVEKEKFDSLLGKLLKTKPEPRRKIKTQGRKGSKTPILAKP* |
| Ga0063777_10461673 | 3300006861 | Peatlands Soil | FEMKVEKEKFDSLLGKLLKAKPEPRKKIKTQGKRGSKSPILGRNAG* |
| Ga0075426_100850156 | 3300006903 | Populus Rhizosphere | MKVEKQKFDTLLEKLIKAKPKPRKKIETTGKRTTSILPSK* |
| Ga0075426_101426893 | 3300006903 | Populus Rhizosphere | MKVQKDKFDKLLGKLISSKPEPRKKIKTQGRKGPKTPILAK* |
| Ga0099793_104507862 | 3300007258 | Vadose Zone Soil | MKADKEKFDALLSKLLKAKPEPLRKIKTQGKRGPKTPILSR* |
| Ga0099794_100592483 | 3300007265 | Vadose Zone Soil | MKVEKEKFDLLLGKLLKAKPEPRKKIKTQGRRGSKAPILIKNSQT* |
| Ga0066710_1007235113 | 3300009012 | Grasslands Soil | MEVDKGKFDAVLSKLIKAKPEPRKKIKTQGRRGPKKPILRKP |
| Ga0099829_102314802 | 3300009038 | Vadose Zone Soil | MKVEKEKFDALLGKLLKAKPEPRKQIKTRGKHGSKKPILPEKS* |
| Ga0099829_111890112 | 3300009038 | Vadose Zone Soil | MKVEKEKFDALLGKLLKAKPEPRKKIKTQGRHGTKKPIIRSNSA* |
| Ga0116137_10718481 | 3300009549 | Peatland | MKVEKNKFDAALAKLLKAKPAPKKNIKTSGKRGSKKGGWPID* |
| Ga0099796_102821262 | 3300010159 | Vadose Zone Soil | FKILKVEKEKFDAVLQRLLKAKPHPRNKVKTNGKRGSKQPLLKK* |
| Ga0126381_1002252853 | 3300010376 | Tropical Forest Soil | MKTEKKKFDAVLSKLLCAKPVPRKKIKTQGKHGSKKPILIKHEV* |
| Ga0136449_1003741505 | 3300010379 | Peatlands Soil | MVNVVVEKNKFDNVLGRLLQTSPKPLKKIKTGGKRGPKTPILAKS* |
| Ga0126345_12848033 | 3300010858 | Boreal Forest Soil | MKVEKKKFDDALAKLLRAKPQPRKKIKTKGRRGPKPILSR* |
| Ga0126346_13555912 | 3300010865 | Boreal Forest Soil | MKVEKEKFDSLLGRLLKAKPEPRKKIKTTGKHGSKKPIISQS* |
| Ga0150983_160036152 | 3300011120 | Forest Soil | LVVMKVGKEKFDSLLGKLLKAKPEPRKKIKTSGKHGSKRPILSS* |
| Ga0137392_109145552 | 3300011269 | Vadose Zone Soil | MKVEKDKFDTALATLLKAKPAPKKAIKTRGKRGSKKPIITPSPQQ* |
| Ga0137392_110067663 | 3300011269 | Vadose Zone Soil | MKVEKQKFDSLLGKLLKAKPEPRKKIKTRGRRGSKAPILT |
| Ga0137391_100620052 | 3300011270 | Vadose Zone Soil | MKKTKVLVAKSKFDNVLGNLLRKSPIQRKQIKTQGRKGSKTPILAKP* |
| Ga0137393_113647463 | 3300011271 | Vadose Zone Soil | MKVEKEKFDSLLGKLLKAKPEPHKKTKIQGRKGSKTPI |
| Ga0138532_11399843 | 3300011305 | Peatlands Soil | MKVEKEKFDSLLGKLLKAKPEPRKKIKTQGKRGSKS |
| Ga0137388_100291383 | 3300012189 | Vadose Zone Soil | MRVEKEKFDSLLGKLLAKKPEPRKKIKTQGRKGSKAPILAK* |
| Ga0137388_106946971 | 3300012189 | Vadose Zone Soil | MKVEKRKFDNALTKMLRAKPAPRKKIKTQGLARRGALA* |
| Ga0137382_111920771 | 3300012200 | Vadose Zone Soil | KFDQALTKMLRAKPEPRKKIKTPGRRGPKTPMLVKP* |
| Ga0137399_100139015 | 3300012203 | Vadose Zone Soil | MKVEKEKFDSLLGKLLKAKPEPRKKIKTQGKHGPKTPILSKS* |
| Ga0137399_101227392 | 3300012203 | Vadose Zone Soil | MKVQKEKFDAVLTKLLKAKPEPRKKIKAQGRKGSKAPILAKP* |
| Ga0137399_107798192 | 3300012203 | Vadose Zone Soil | MKVEKEKFDSLLGKLLKAKPEPRKKIKTQGKHVSKNPIIKP* |
| Ga0137399_110244192 | 3300012203 | Vadose Zone Soil | EKEKFDLLLGKLLKAKPEPRKKIKTQGRRGSKAPILIKNSQT* |
| Ga0137399_112661062 | 3300012203 | Vadose Zone Soil | MKVEKEKFDAALAKLLRAKPQPRKKIKTQGKRGPKPIFRPS* |
| Ga0137362_100032307 | 3300012205 | Vadose Zone Soil | MKVEKEKFDSLLGKLLKAKPKPRKKMKISGKRTPKPILSNR* |
| Ga0137380_114550151 | 3300012206 | Vadose Zone Soil | MKANKEKFDALLGRLLKAKPEPRKKIKTQGRKGSKAPILAKP* |
| Ga0137380_116030252 | 3300012206 | Vadose Zone Soil | MKVGKEKFDSLLGKLLKAKPEPRKKIKTSGKRTRTPIILK* |
| Ga0137381_102375371 | 3300012207 | Vadose Zone Soil | MKVEKQEFDSLLGKLLKAKPEPRKQIKTQGRKGSKAPILAKP* |
| Ga0137370_110393241 | 3300012285 | Vadose Zone Soil | LRNRQPCYHARKRKGEKRKFDNALTKLLRAKPEPRKKIKTPGRRGPKTPIL |
| Ga0137387_101846051 | 3300012349 | Vadose Zone Soil | NIACMKVEKENFDALLGKLLKAKPEPRKKIKTQARRGPKTPILIKNSSS* |
| Ga0137384_106635643 | 3300012357 | Vadose Zone Soil | MKVEKQEFDSLLGKLLKAKPEPRKQIKTQGRKGSKAPI |
| Ga0137385_102018913 | 3300012359 | Vadose Zone Soil | MKVEKENFDALLGKLLKAKPEPRKKIKTQARRGPKTPILIKNSSS* |
| Ga0137360_100972484 | 3300012361 | Vadose Zone Soil | MKVEKQKFDALLGKLLKAKPEPRKKIKTQGRKGSKTPILAK* |
| Ga0137358_101579584 | 3300012582 | Vadose Zone Soil | MKVEKEKFDALLSKLIKAKPEPRKKIKTHGKRGSKAPIIPKNPQ* |
| Ga0137398_100087645 | 3300012683 | Vadose Zone Soil | MKVEKEKFDSLLGKLLKAKPEPRKQIKTAKRKPAKIIQSAAR* |
| Ga0137397_100351924 | 3300012685 | Vadose Zone Soil | MKVEKEKFDSLLGKLLKAKPEPRKKIKTQGRHGSKKPILKP* |
| Ga0137397_112896211 | 3300012685 | Vadose Zone Soil | MKVEKQKFDDALAKLLCAKPQPRKKIKASGKRTAKPILAKP* |
| Ga0137395_101103333 | 3300012917 | Vadose Zone Soil | MKVHKDKFDGVLAKLLRAKPQPRKKIKTQGNRGPKKPILSPDQP* |
| Ga0137396_102819492 | 3300012918 | Vadose Zone Soil | AREMKVGKRKFDDALTKMLRAKPEPRKKIKTQGRRGPKTPILAKP* |
| Ga0137396_111718821 | 3300012918 | Vadose Zone Soil | MKVGKRKFDDALTKMLRAKPEPRKKIKTQGRRGPKTP |
| Ga0137394_113595283 | 3300012922 | Vadose Zone Soil | MKVEKEKFDSLLGKLLKAKPEPRKKIKTEGKHGSKAPIIKNG* |
| Ga0137419_112736772 | 3300012925 | Vadose Zone Soil | MKVEKQKFDDAPAKLLRAKPQPRKKIKTQGRRGPKTPILST* |
| Ga0137416_101188501 | 3300012927 | Vadose Zone Soil | MKANKEKFDALLSRLLKAKPEPRKKIKTQGKRGPK |
| Ga0137404_111254651 | 3300012929 | Vadose Zone Soil | MKVEKQKFDDALTKLLCAKPQPRKKIKASGKRTAKPILAKP* |
| Ga0137404_113168001 | 3300012929 | Vadose Zone Soil | MKVEKEKFDSLLGKLIKAKPEPRKKIKTQGRKGPKTPI |
| Ga0137410_102590225 | 3300012944 | Vadose Zone Soil | MKVEKEKFDSLLGKLLKTRPTPRKNIKTQGKRGTKAILRAGEEKSQT* |
| Ga0137410_117300761 | 3300012944 | Vadose Zone Soil | MRVKKEKFDSVLAKLLKAKPEPRKKIKTQGRKGPKTPILAK* |
| Ga0157379_126808161 | 3300014968 | Switchgrass Rhizosphere | MKVEKQKFDSLLGKLLKAKPEPRKKIKTKGKHGPKAPILSHSTSH* |
| Ga0137418_104459124 | 3300015241 | Vadose Zone Soil | MKVEKQKFDTLLGKVLIAKPAPRKKIKTPGKRGPKKPIIPHQND* |
| Ga0137403_101429465 | 3300015264 | Vadose Zone Soil | MKVEKQKFDSMLGKFLNAKPEPRKKIKTQGRKGSKTPILAK* |
| Ga0187849_10591651 | 3300017929 | Peatland | MKVEKNKFDAALAKLLKAKPAPKKNIKTSGKRGSKKGGWPID |
| Ga0187817_103998222 | 3300017955 | Freshwater Sediment | MKVEKEKFDSLLGKLLKAKPEPRKKIKTQGRRGPKTPILGKN |
| Ga0184640_100157744 | 3300018074 | Groundwater Sediment | MKVEKEKFDAALAKLLKAKPEPRKKIKTEGKHGPKTPILAKP |
| Ga0187771_101799262 | 3300018088 | Tropical Peatland | MKVEKAKFDALLIKMIKAKPEPRQKIKTEGRKGSKAPILAK |
| Ga0179592_101568493 | 3300020199 | Vadose Zone Soil | MKVEKQKFDDLLGKLLKAKPEPRKKIRTRGKHGPKKPIISQSQGQ |
| Ga0179592_105058791 | 3300020199 | Vadose Zone Soil | KEKFDCALSKLIKAKPEPRKAIKTPGRKRRETPIISK |
| Ga0210407_100606114 | 3300020579 | Soil | MKVEKEKFDSLLGKLLKAKPEPRKKIKTQGRKGSKTPIISGHSNQ |
| Ga0210407_100804932 | 3300020579 | Soil | MKVEKEKFDSLLGKMLKAKPEPRKKIKTSGKRTAKPILSNR |
| Ga0210403_101125393 | 3300020580 | Soil | MKVEKEKFDALLGKLLKAKPEPRKKIKTQGRRGSKAPILIKNSQS |
| Ga0210401_100454932 | 3300020583 | Soil | MKVEKEKFDSLLGKLLKAKPAPRKKIKTSGKRGSKKPLLNS |
| Ga0210406_113752352 | 3300021168 | Soil | KVEKQKFDSILVKLIKAKPEPRKSIKTQGRKGSKAPILINQPK |
| Ga0210400_100825602 | 3300021170 | Soil | MKVEKDKFDSALAKLLKAKPAPRKKIKTTGKRTAKPILPKP |
| Ga0210405_106978062 | 3300021171 | Soil | MKVEKEKFDAVLTKLIKAKPSPRKKIKTQGRRGSKKPLLTNG |
| Ga0210387_100053758 | 3300021405 | Soil | MNKRVIVRKTEFDDILGKLLKAKPEPRKQIKTQGRKGSKAPILAKT |
| Ga0210394_10000079195 | 3300021420 | Soil | MRVEKGKFDSLLGKLLKAKPEPRKKIKTQGRKGSKNPILAKP |
| Ga0210394_100817202 | 3300021420 | Soil | MKVEKQKFDKALTKMLGAKPKPRKKIKTQGRRGPKTPILAKP |
| Ga0210391_109870021 | 3300021433 | Soil | MKVEKQKFDKALTKMLGAKPEPRKKIKTQGRRGPKTPILAKP |
| Ga0210402_109464491 | 3300021478 | Soil | MKANKEKFDALLGRLLKAKPEPRRKIKTTGKRTANPIVPVKP |
| Ga0210409_100240935 | 3300021559 | Soil | MKVEKEKFDALLGKLLKAKPEPRKKIKTQGKHGPKTPIINKED |
| Ga0242642_10111493 | 3300022504 | Soil | MKVEKEKFDSLLGKLLKAKPEPRKKIKTQGKRGPKTPILGKSSDQSRS |
| Ga0242654_101923131 | 3300022726 | Soil | MKVEKQKFDSILVKLIKAKPEPRKSIKTQGRKGSKAPILINQPK |
| Ga0247694_10341212 | 3300024178 | Soil | MKVEKQKFDTILEKLLKAKPEPRKKIKTQGRKGSKAPILAKT |
| Ga0209108_105486581 | 3300025165 | Soil | MKVEKEKLDAALAKLLKAKPEPRKKIKTEGKHGPKTPILAKP |
| Ga0207693_104591402 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | LGERKVKVEKQKFDSLLSKLLATKPEPRKKIKTKGKRG |
| Ga0209647_10220715 | 3300026319 | Grasslands Soil | MKANKEKFDALLSRLLKAKPEPRKKIKTQGKRGPKTPILSR |
| Ga0209647_10294532 | 3300026319 | Grasslands Soil | MTKVSKDKFDSLLSKLIQAKPEPRKKIKTQGRKGSKTPILAK |
| Ga0257178_10064271 | 3300026446 | Soil | KVGKRKFDDALTKMLRAKPEPRKKIKTQGRRGPKTPILAKP |
| Ga0209648_100973912 | 3300026551 | Grasslands Soil | MKVEKEKFDSLLGKLLKAKPEPHKKTKIQGRKGSKTPILAKP |
| Ga0209117_10021526 | 3300027645 | Forest Soil | MKVEKEKFDSLLGKLLKAKPEPRKKIKTQGKRGPKPIIPPNS |
| Ga0209420_11849091 | 3300027648 | Forest Soil | MGSYMSKVEVAKEKFDMLLSKVLRAKPAPRDKIKNGGKHGPKTPILAKP |
| Ga0209011_11431632 | 3300027678 | Forest Soil | MKVEKEKFDSLLGKLLKAKPEPRKKIKTQGRRGSKAPLLFRRPT |
| Ga0209180_107680572 | 3300027846 | Vadose Zone Soil | MKVEKEKFDALLGKLLKAKPEPRKKIKTQGRHGTKKPIIRSNSA |
| Ga0209517_100491233 | 3300027854 | Peatlands Soil | MAKVQKVKFDGLLTKLLSAKPEPRKNIRTNGKRSPKTAILAKQ |
| Ga0209166_100332582 | 3300027857 | Surface Soil | MKVDKGKFDVLLGKLLRAKPEPRKKIKTKGKRGPKTPILSR |
| Ga0209579_101496823 | 3300027869 | Surface Soil | MRVEKEKFDSLLGKLLKAKPEPRKKIKTQGKRGPKTSIIPANDHLKRP |
| Ga0209526_100323155 | 3300028047 | Forest Soil | VEKRKFDQALKKMLRAKPEPRKKIKTQGRRGPKTPILAKP |
| Ga0268266_112614841 | 3300028379 | Switchgrass Rhizosphere | MKVEKNKFDTLLDKLISAKPEPRKKIKTQGRKGSKSPILSRP |
| Ga0137415_101898302 | 3300028536 | Vadose Zone Soil | MKVEKEKFDSLLGKLLKAKPEPRKKIKTQGKHGPKTPILSKS |
| Ga0257175_10810112 | 3300028673 | Soil | FDKALTKLLRAKPEPRKKIKTRGRRGVKTPILAKP |
| Ga0170834_1134381252 | 3300031057 | Forest Soil | LWESGERKVKVEKQKFDSLLGKLLATKPEPRKKIKTKGKRGPKTPILAK |
| Ga0265760_102593751 | 3300031090 | Soil | MKVEKEKFDLLLGKLLKAKPEPRKKIKTQGRRGPKTPILTK |
| Ga0170823_124415571 | 3300031128 | Forest Soil | MKVAKDKFDHALAKLLQAKPEPRKKIKTQGRKGSKAPIL |
| Ga0310686_1109553982 | 3300031708 | Soil | MKVEKRKFDKALTKLLRAEPEPRKKIKTRGRRGVKTPILAKP |
| Ga0310686_1192555984 | 3300031708 | Soil | MKVEKEKFDDLLGKLLKAKPEPRKKIKTAGRRSSKAPLIKPS |
| Ga0307477_103666273 | 3300031753 | Hardwood Forest Soil | MKVEKEKFDSLLGKLLKAKPEPRKKIKTQGKRGSKSPILGRNAG |
| Ga0307475_103613692 | 3300031754 | Hardwood Forest Soil | MKVEKEKFDAALAKLLKAKPEPRKKIKTKGRRGPKTTTPYV |
| Ga0307475_104461692 | 3300031754 | Hardwood Forest Soil | MKVEKEKFDSLLGKLLKAKPEPRKQIKTQGRKGSKAPILSRP |
| Ga0307475_110673972 | 3300031754 | Hardwood Forest Soil | MKVEKREFDKALTKLLRAKPEPRKKIKTRGRRGAKTPILAKP |
| Ga0307478_100008798 | 3300031823 | Hardwood Forest Soil | MNKRVIVKKTEFDDILGKLLKAKPEPRKQIKTQGRKGSKAPILAKT |
| Ga0307478_107610233 | 3300031823 | Hardwood Forest Soil | MKVEKQKFDDALARLLRAKPQPRKKIKTQGKRGPKTAILS |
| Ga0307479_108255641 | 3300031962 | Hardwood Forest Soil | MKVEKEKFDAALAKLLKAKPEPRKKIKTKGRRGPKTTTPHV |
| Ga0307479_110012182 | 3300031962 | Hardwood Forest Soil | MKVEKEKFDAALAKLLRAKPQPRKKIKTQGKRTSRPILPKP |
| Ga0311301_104369794 | 3300032160 | Peatlands Soil | MVNVVVEKNKFDNVLGRLLQTSPKPLKKIKTGGKRGPKTPILAKS |
| Ga0307472_1014994803 | 3300032205 | Hardwood Forest Soil | MKVEKRKFDTILLKVLRAKPVPREKIKSGGKRGSKT |
| Ga0335081_107207412 | 3300032892 | Soil | CYHRTMKVEKKKFDGLLGKLLAAKPEPREKIRAGKKSSPKTPILAKQ |
| Ga0335072_113514851 | 3300032898 | Soil | EKEKFDSLLGKLLKAKPEPRKKIKTQGRRGPKKPILNQP |
| Ga0314861_0002878_15793_15936 | 3300033977 | Peatland | MAKANLVVEKKKFDGILGHLLHAKPVPRNSIKAIGKRGPKTPILAKP |
| ⦗Top⦘ |