


| Basic Information | |
|---|---|
| Family ID | F060228 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 133 |
| Average Sequence Length | 39 residues |
| Representative Sequence | MIAKPISIKDAKRKSGGCAWKAVELIAGDLLHVSDSGLRVE |
| Number of Associated Samples | 113 |
| Number of Associated Scaffolds | 133 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 63.64 % |
| % of genes near scaffold ends (potentially truncated) | 44.36 % |
| % of genes from short scaffolds (< 2000 bps) | 73.68 % |
| Associated GOLD sequencing projects | 107 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.24 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (74.436 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (30.075 % of family members) |
| Environment Ontology (ENVO) | Unclassified (31.579 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (45.865 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 27.54% β-sheet: 0.00% Coil/Unstructured: 72.46% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.24 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 133 Family Scaffolds |
|---|---|---|
| PF00078 | RVT_1 | 4.51 |
| PF02371 | Transposase_20 | 3.01 |
| PF08388 | GIIM | 2.26 |
| PF07238 | PilZ | 1.50 |
| PF01521 | Fe-S_biosyn | 1.50 |
| PF13484 | Fer4_16 | 1.50 |
| PF00691 | OmpA | 1.50 |
| PF04519 | Bactofilin | 1.50 |
| PF04041 | Glyco_hydro_130 | 0.75 |
| PF00756 | Esterase | 0.75 |
| PF00188 | CAP | 0.75 |
| PF05016 | ParE_toxin | 0.75 |
| PF13592 | HTH_33 | 0.75 |
| PF04879 | Molybdop_Fe4S4 | 0.75 |
| PF10101 | DUF2339 | 0.75 |
| PF00578 | AhpC-TSA | 0.75 |
| PF00137 | ATP-synt_C | 0.75 |
| PF00486 | Trans_reg_C | 0.75 |
| PF13620 | CarboxypepD_reg | 0.75 |
| PF07743 | HSCB_C | 0.75 |
| PF01435 | Peptidase_M48 | 0.75 |
| PF04264 | YceI | 0.75 |
| PF14821 | Thr_synth_N | 0.75 |
| PF00005 | ABC_tran | 0.75 |
| PF13517 | FG-GAP_3 | 0.75 |
| PF07969 | Amidohydro_3 | 0.75 |
| PF01497 | Peripla_BP_2 | 0.75 |
| PF07995 | GSDH | 0.75 |
| PF13668 | Ferritin_2 | 0.75 |
| PF06751 | EutB | 0.75 |
| PF13633 | Obsolete Pfam Family | 0.75 |
| PF01238 | PMI_typeI_C | 0.75 |
| PF01171 | ATP_bind_3 | 0.75 |
| PF00990 | GGDEF | 0.75 |
| PF01610 | DDE_Tnp_ISL3 | 0.75 |
| PF00069 | Pkinase | 0.75 |
| PF00753 | Lactamase_B | 0.75 |
| PF08241 | Methyltransf_11 | 0.75 |
| PF02738 | MoCoBD_1 | 0.75 |
| PF07690 | MFS_1 | 0.75 |
| PF00361 | Proton_antipo_M | 0.75 |
| PF04545 | Sigma70_r4 | 0.75 |
| PF00312 | Ribosomal_S15 | 0.75 |
| COG ID | Name | Functional Category | % Frequency in 133 Family Scaffolds |
|---|---|---|---|
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 3.01 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 3.01 |
| COG0316 | Fe-S cluster assembly iron-binding protein IscA | Posttranslational modification, protein turnover, chaperones [O] | 1.50 |
| COG1664 | Cytoskeletal protein CcmA, bactofilin family | Cytoskeleton [Z] | 1.50 |
| COG4841 | Uncharacterized conserved protein YneR, related to HesB/YadR/YfhF family | Function unknown [S] | 1.50 |
| COG0037 | tRNA(Ile)-lysidine synthase TilS/MesJ | Translation, ribosomal structure and biogenesis [J] | 0.75 |
| COG0184 | Ribosomal protein S15P/S13E | Translation, ribosomal structure and biogenesis [J] | 0.75 |
| COG0301 | Adenylyl- and sulfurtransferase ThiI (thiamine and tRNA 4-thiouridine biosynthesis) | Translation, ribosomal structure and biogenesis [J] | 0.75 |
| COG0482 | tRNA U34 2-thiouridine synthase MnmA/TrmU, contains the PP-loop ATPase domain | Translation, ribosomal structure and biogenesis [J] | 0.75 |
| COG0519 | GMP synthase, PP-ATPase domain/subunit | Nucleotide transport and metabolism [F] | 0.75 |
| COG0603 | 7-cyano-7-deazaguanine synthase (queuosine biosynthesis) | Translation, ribosomal structure and biogenesis [J] | 0.75 |
| COG0614 | ABC-type Fe3+-hydroxamate transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.75 |
| COG0636 | FoF1-type ATP synthase, membrane subunit c/Archaeal/vacuolar-type H+-ATPase, subunit K | Energy production and conversion [C] | 0.75 |
| COG1076 | DnaJ domain-containing protein | Posttranslational modification, protein turnover, chaperones [O] | 0.75 |
| COG1482 | Mannose-6-phosphate isomerase, class I | Carbohydrate transport and metabolism [G] | 0.75 |
| COG1606 | ATP-utilizing enzyme, PP-loop superfamily | General function prediction only [R] | 0.75 |
| COG2133 | Glucose/arabinose dehydrogenase, beta-propeller fold | Carbohydrate transport and metabolism [G] | 0.75 |
| COG2152 | Predicted glycosyl hydrolase, GH43/DUF377 family | Carbohydrate transport and metabolism [G] | 0.75 |
| COG2340 | Spore germination protein YkwD and related proteins with CAP (CSP/antigen 5/PR1) domain | Cell cycle control, cell division, chromosome partitioning [D] | 0.75 |
| COG2353 | Polyisoprenoid-binding periplasmic protein YceI | General function prediction only [R] | 0.75 |
| COG3464 | Transposase | Mobilome: prophages, transposons [X] | 0.75 |
| COG4303 | Ethanolamine ammonia-lyase, large subunit | Amino acid transport and metabolism [E] | 0.75 |
| COG4558 | ABC-type hemin transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.75 |
| COG4592 | ABC-type Fe2+-enterobactin transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.75 |
| COG4594 | ABC-type Fe3+-citrate transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.75 |
| COG4607 | ABC-type enterochelin transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.75 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 74.44 % |
| Unclassified | root | N/A | 25.56 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459024|GZTSFBX01DQIMN | Not Available | 507 | Open in IMG/M |
| 3300000733|JGI12408J11912_1011149 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 685 | Open in IMG/M |
| 3300000955|JGI1027J12803_105397734 | Not Available | 1062 | Open in IMG/M |
| 3300000955|JGI1027J12803_106542664 | Not Available | 897 | Open in IMG/M |
| 3300001182|JGI12668J13544_1007344 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia | 596 | Open in IMG/M |
| 3300001565|A35518A_1062449 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia | 814 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101121257 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 674 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101246216 | Not Available | 634 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101650126 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia | 539 | Open in IMG/M |
| 3300002562|JGI25382J37095_10080832 | All Organisms → cellular organisms → Bacteria | 1194 | Open in IMG/M |
| 3300002681|Ga0005471J37259_106409 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia | 545 | Open in IMG/M |
| 3300002907|JGI25613J43889_10057460 | All Organisms → cellular organisms → Bacteria | 1076 | Open in IMG/M |
| 3300003368|JGI26340J50214_10023763 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1871 | Open in IMG/M |
| 3300004104|Ga0058891_1032216 | All Organisms → cellular organisms → Bacteria | 974 | Open in IMG/M |
| 3300005174|Ga0066680_10146174 | All Organisms → cellular organisms → Bacteria | 1476 | Open in IMG/M |
| 3300005177|Ga0066690_10678514 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 684 | Open in IMG/M |
| 3300005332|Ga0066388_104046833 | Not Available | 747 | Open in IMG/M |
| 3300005518|Ga0070699_100186213 | All Organisms → cellular organisms → Bacteria | 1843 | Open in IMG/M |
| 3300005542|Ga0070732_10042575 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2612 | Open in IMG/M |
| 3300005553|Ga0066695_10569951 | Not Available | 685 | Open in IMG/M |
| 3300005557|Ga0066704_10186406 | All Organisms → cellular organisms → Bacteria | 1400 | Open in IMG/M |
| 3300005559|Ga0066700_10088892 | Not Available | 2000 | Open in IMG/M |
| 3300005574|Ga0066694_10609988 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Nitrosococcus → Nitrosococcus halophilus → Nitrosococcus halophilus Nc 4 | 509 | Open in IMG/M |
| 3300005575|Ga0066702_10649531 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → unclassified Verrucomicrobia subdivision 3 → Verrucomicrobia subdivision 3 bacterium | 631 | Open in IMG/M |
| 3300005602|Ga0070762_10798225 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 638 | Open in IMG/M |
| 3300005610|Ga0070763_10568421 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
| 3300005617|Ga0068859_100351338 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1569 | Open in IMG/M |
| 3300005712|Ga0070764_10104366 | All Organisms → cellular organisms → Bacteria | 1518 | Open in IMG/M |
| 3300006052|Ga0075029_100980582 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Nitrosococcus → Nitrosococcus halophilus → Nitrosococcus halophilus Nc 4 | 583 | Open in IMG/M |
| 3300006175|Ga0070712_100089971 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2247 | Open in IMG/M |
| 3300007255|Ga0099791_10452321 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 621 | Open in IMG/M |
| 3300007258|Ga0099793_10005587 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 4564 | Open in IMG/M |
| 3300007265|Ga0099794_10031044 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2498 | Open in IMG/M |
| 3300007265|Ga0099794_10066279 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4 | 1762 | Open in IMG/M |
| 3300007265|Ga0099794_10802946 | Not Available | 503 | Open in IMG/M |
| 3300008785|Ga0103638_1000614 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 832 | Open in IMG/M |
| 3300009038|Ga0099829_10079667 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2504 | Open in IMG/M |
| 3300009038|Ga0099829_10811203 | Not Available | 777 | Open in IMG/M |
| 3300009038|Ga0099829_11053965 | All Organisms → cellular organisms → Bacteria | 674 | Open in IMG/M |
| 3300009089|Ga0099828_10129857 | Not Available | 2211 | Open in IMG/M |
| 3300009624|Ga0116105_1021090 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1370 | Open in IMG/M |
| 3300009635|Ga0116117_1011775 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2253 | Open in IMG/M |
| 3300009638|Ga0116113_1057957 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 900 | Open in IMG/M |
| 3300010339|Ga0074046_10000781 | All Organisms → cellular organisms → Bacteria | 29258 | Open in IMG/M |
| 3300010366|Ga0126379_10741965 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1078 | Open in IMG/M |
| 3300010376|Ga0126381_100223855 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2531 | Open in IMG/M |
| 3300010379|Ga0136449_101980051 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 861 | Open in IMG/M |
| 3300010379|Ga0136449_103511876 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium huanghuaihaiense | 597 | Open in IMG/M |
| 3300010861|Ga0126349_1068668 | Not Available | 671 | Open in IMG/M |
| 3300011082|Ga0138526_1136930 | Not Available | 548 | Open in IMG/M |
| 3300011270|Ga0137391_10139252 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2111 | Open in IMG/M |
| 3300011270|Ga0137391_10209093 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1696 | Open in IMG/M |
| 3300012096|Ga0137389_10124793 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2079 | Open in IMG/M |
| 3300012189|Ga0137388_10041385 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3674 | Open in IMG/M |
| 3300012199|Ga0137383_10012738 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5678 | Open in IMG/M |
| 3300012205|Ga0137362_10575371 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 972 | Open in IMG/M |
| 3300012210|Ga0137378_10818087 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 844 | Open in IMG/M |
| 3300012359|Ga0137385_10790455 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 789 | Open in IMG/M |
| 3300012582|Ga0137358_10011852 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5448 | Open in IMG/M |
| 3300012582|Ga0137358_10909530 | Not Available | 576 | Open in IMG/M |
| 3300012918|Ga0137396_11090287 | Not Available | 572 | Open in IMG/M |
| 3300012924|Ga0137413_10019109 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia | 3564 | Open in IMG/M |
| 3300012925|Ga0137419_11868965 | Not Available | 515 | Open in IMG/M |
| 3300012929|Ga0137404_10581069 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1006 | Open in IMG/M |
| 3300012929|Ga0137404_12330871 | Not Available | 501 | Open in IMG/M |
| 3300012944|Ga0137410_10270685 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1337 | Open in IMG/M |
| 3300012960|Ga0164301_11775420 | Not Available | 518 | Open in IMG/M |
| 3300012975|Ga0134110_10332508 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 662 | Open in IMG/M |
| 3300014498|Ga0182019_10565116 | Not Available | 795 | Open in IMG/M |
| 3300014501|Ga0182024_10119834 | All Organisms → cellular organisms → Bacteria | 3768 | Open in IMG/M |
| 3300015053|Ga0137405_1112200 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 829 | Open in IMG/M |
| 3300015053|Ga0137405_1314464 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1867 | Open in IMG/M |
| 3300015054|Ga0137420_1110219 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1974 | Open in IMG/M |
| 3300015054|Ga0137420_1120758 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 926 | Open in IMG/M |
| 3300015054|Ga0137420_1124635 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1202 | Open in IMG/M |
| 3300015054|Ga0137420_1462524 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → Acidobacterium capsulatum | 1716 | Open in IMG/M |
| 3300015193|Ga0167668_1088514 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Archangiaceae → Cystobacter → Cystobacter fuscus | 589 | Open in IMG/M |
| 3300017934|Ga0187803_10109348 | All Organisms → cellular organisms → Bacteria | 1086 | Open in IMG/M |
| 3300017970|Ga0187783_10021374 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4780 | Open in IMG/M |
| 3300018034|Ga0187863_10788502 | Not Available | 538 | Open in IMG/M |
| 3300018088|Ga0187771_11614098 | Not Available | 550 | Open in IMG/M |
| 3300019887|Ga0193729_1013324 | All Organisms → cellular organisms → Bacteria | 3671 | Open in IMG/M |
| 3300019890|Ga0193728_1097364 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1364 | Open in IMG/M |
| 3300020170|Ga0179594_10015049 | All Organisms → cellular organisms → Bacteria | 2245 | Open in IMG/M |
| 3300020581|Ga0210399_10025362 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4710 | Open in IMG/M |
| 3300021307|Ga0179585_1073147 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia | 599 | Open in IMG/M |
| 3300021432|Ga0210384_10000418 | All Organisms → cellular organisms → Bacteria | 65230 | Open in IMG/M |
| 3300021860|Ga0213851_1217454 | Not Available | 517 | Open in IMG/M |
| 3300022531|Ga0242660_1137327 | Not Available | 630 | Open in IMG/M |
| 3300022557|Ga0212123_10226111 | Not Available | 1363 | Open in IMG/M |
| 3300022557|Ga0212123_10850648 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 543 | Open in IMG/M |
| 3300022724|Ga0242665_10214123 | Not Available | 641 | Open in IMG/M |
| 3300024182|Ga0247669_1000890 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 10292 | Open in IMG/M |
| 3300024330|Ga0137417_1274572 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia | 659 | Open in IMG/M |
| 3300024347|Ga0179591_1016438 | All Organisms → cellular organisms → Bacteria | 6580 | Open in IMG/M |
| 3300025406|Ga0208035_1039971 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 737 | Open in IMG/M |
| 3300025527|Ga0208714_1006316 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3186 | Open in IMG/M |
| 3300026305|Ga0209688_1107699 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 523 | Open in IMG/M |
| 3300026356|Ga0257150_1016087 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Nitrosococcus → Nitrosococcus halophilus → Nitrosococcus halophilus Nc 4 | 1036 | Open in IMG/M |
| 3300026551|Ga0209648_10031028 | All Organisms → cellular organisms → Bacteria | 4663 | Open in IMG/M |
| 3300026551|Ga0209648_10038544 | All Organisms → cellular organisms → Bacteria | 4140 | Open in IMG/M |
| 3300026551|Ga0209648_10576644 | Not Available | 623 | Open in IMG/M |
| 3300026555|Ga0179593_1098612 | All Organisms → cellular organisms → Bacteria | 1874 | Open in IMG/M |
| 3300026555|Ga0179593_1135441 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2048 | Open in IMG/M |
| 3300026557|Ga0179587_10007758 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5488 | Open in IMG/M |
| 3300026880|Ga0209623_1003870 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia → unclassified Paraburkholderia → Paraburkholderia sp. BL23I1N1 | 850 | Open in IMG/M |
| 3300027583|Ga0209527_1089768 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia | 690 | Open in IMG/M |
| 3300027591|Ga0209733_1040749 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1241 | Open in IMG/M |
| 3300027667|Ga0209009_1005032 | Not Available | 3169 | Open in IMG/M |
| 3300027674|Ga0209118_1055245 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1166 | Open in IMG/M |
| 3300027703|Ga0207862_1032543 | Not Available | 1568 | Open in IMG/M |
| 3300027727|Ga0209328_10036053 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1522 | Open in IMG/M |
| 3300027812|Ga0209656_10000423 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 27960 | Open in IMG/M |
| 3300027846|Ga0209180_10000241 | All Organisms → cellular organisms → Bacteria | 24358 | Open in IMG/M |
| 3300027894|Ga0209068_10624722 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 628 | Open in IMG/M |
| 3300028577|Ga0265318_10226944 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 682 | Open in IMG/M |
| 3300030854|Ga0075385_11828268 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Nitrosococcus → Nitrosococcus halophilus → Nitrosococcus halophilus Nc 4 | 965 | Open in IMG/M |
| 3300030923|Ga0138296_1166729 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 539 | Open in IMG/M |
| 3300031057|Ga0170834_111006389 | Not Available | 506 | Open in IMG/M |
| 3300031249|Ga0265339_10118949 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1360 | Open in IMG/M |
| 3300031670|Ga0307374_10000058 | All Organisms → cellular organisms → Bacteria | 173222 | Open in IMG/M |
| 3300031792|Ga0318529_10177143 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 986 | Open in IMG/M |
| 3300031823|Ga0307478_10371405 | Not Available | 1181 | Open in IMG/M |
| 3300031890|Ga0306925_10115940 | All Organisms → cellular organisms → Bacteria | 2862 | Open in IMG/M |
| 3300031893|Ga0318536_10397903 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 695 | Open in IMG/M |
| 3300031910|Ga0306923_11528275 | Not Available | 697 | Open in IMG/M |
| 3300031962|Ga0307479_11021910 | All Organisms → cellular organisms → Bacteria | 795 | Open in IMG/M |
| 3300031962|Ga0307479_11318780 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 682 | Open in IMG/M |
| 3300032070|Ga0315279_10616959 | Not Available | 678 | Open in IMG/M |
| 3300032089|Ga0318525_10460253 | Not Available | 651 | Open in IMG/M |
| 3300032205|Ga0307472_101264680 | Not Available | 708 | Open in IMG/M |
| 3300033405|Ga0326727_11286718 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 500 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 30.08% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 9.02% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 8.27% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 7.52% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.76% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 3.01% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.01% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.26% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.26% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.26% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.26% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.50% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 1.50% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.50% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.50% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.50% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.50% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.50% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 1.50% |
| Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 0.75% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.75% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.75% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.75% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.75% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.75% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.75% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.75% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.75% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.75% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.75% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.75% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.75% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.75% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.75% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.75% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.75% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.75% |
| Wetland Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Wetland Soil | 0.75% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459024 | Grass soil microbial communities from Rothamsted Park, UK - FD1 (NaCl 300g/L 5ml) | Environmental | Open in IMG/M |
| 3300000733 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 80 | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001182 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M2 | Environmental | Open in IMG/M |
| 3300001565 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A35-5cm-18A)- 1 week illumina new | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300002562 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002681 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF120 (Metagenome Metatranscriptome, Counting Only) | Environmental | Open in IMG/M |
| 3300002907 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm | Environmental | Open in IMG/M |
| 3300003368 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 | Environmental | Open in IMG/M |
| 3300004104 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF218 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300008785 | Microbial communities from wetland soil in Czech Republic - R1_cDNA | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009624 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 | Environmental | Open in IMG/M |
| 3300009635 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_10 | Environmental | Open in IMG/M |
| 3300009638 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_10 | Environmental | Open in IMG/M |
| 3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010861 | Boreal forest soil eukaryotic communities from Alaska, USA - C4-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011082 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 4 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
| 3300014498 | Permafrost microbial communities from Stordalen Mire, Sweden - 812E2M metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015193 | Arctic soil microbial communities from a glacier forefield, Rabots glacier, Tarfala, Sweden (Sample Rb6, proglacial stream) | Environmental | Open in IMG/M |
| 3300017934 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3 | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300019887 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2 | Environmental | Open in IMG/M |
| 3300019890 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1 | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021307 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_06_16RNAfungal (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021860 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2014 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022531 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-28-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300022724 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300024182 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK10 | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300024347 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025406 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025527 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-1 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300026305 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 (SPAdes) | Environmental | Open in IMG/M |
| 3300026356 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-13-A | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026555 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300026880 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027583 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027591 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027667 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027674 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027703 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 81 (SPAdes) | Environmental | Open in IMG/M |
| 3300027727 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Host-Associated | Open in IMG/M |
| 3300030854 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OB2 SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030923 | Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A3_MS_autumn Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Host-Associated | Open in IMG/M |
| 3300031670 | Soil microbial communities from Risofladan, Vaasa, Finland - OX-3 | Environmental | Open in IMG/M |
| 3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032070 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_20 | Environmental | Open in IMG/M |
| 3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300033405 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB29MY | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FD1_07946300 | 2170459024 | Grass Soil | RTSEQVTAKSVSIKDAGGKSGGRVSKAVELIAGDLWHVSDS |
| JGI12408J11912_10111492 | 3300000733 | Tropical Forest Soil | MIAKPISIKDAKRKFGGCVQKAVELISGDLLHVSDS* |
| JGI1027J12803_1053977342 | 3300000955 | Soil | MIAKPISIKDAERKFGGCAWKAIELISGDLLQVTDS* |
| JGI1027J12803_1065426642 | 3300000955 | Soil | IKDAGGKSGGRVSKAVELIAGDLLHVSNSRLRVE* |
| JGI12668J13544_10073441 | 3300001182 | Forest Soil | MIAKPISIKDAERKFGGCAWKAIELISGDLLHVSDSRLRVE* |
| A35518A_10624491 | 3300001565 | Permafrost | MIAKPISIKDAKRKFGGCARKAIELISGDLLHVSDSRLRVE* |
| JGIcombinedJ26739_1011212571 | 3300002245 | Forest Soil | RWASGQMVAKPISIKDAKRKFGGCAWKAVELIAGDLLHVTDS* |
| JGIcombinedJ26739_1012462162 | 3300002245 | Forest Soil | MIAKPISIKDAKRKFGGCAQKAVELISGDLLHVSNSRLRVE* |
| JGIcombinedJ26739_1016501261 | 3300002245 | Forest Soil | MIAKPISIKDAKRKFGGCAWKAIELISGELLHVTDS* |
| JGI25382J37095_100808322 | 3300002562 | Grasslands Soil | MIAKPISITDARRKFGGCAQKAVELTSGDPMQVAETRLGME* |
| Ga0005471J37259_1064091 | 3300002681 | Forest Soil | MVAKPISIKDAKRKSGGCAWKAVELIAGDLLHVSDSGLRVE* |
| JGI25613J43889_100574602 | 3300002907 | Grasslands Soil | MVAKPISIKDAKRKFGGCAWKAIELISGDLLHVSDSGLSVE* |
| JGI26340J50214_100237633 | 3300003368 | Bog Forest Soil | MIAKSVSIKDAGGKSGGPVSKAVVAGDLLHVSDSGLSVK* |
| Ga0058891_10322162 | 3300004104 | Forest Soil | VIAKSVSIKDAGGKSGGRVSKAVELIAGDLLHVSDSRLGVE* |
| Ga0066680_101461742 | 3300005174 | Soil | MIAKPISIKDARRKFGGCAQKAVELTSGDPMQVAETRLGRE* |
| Ga0066690_106785142 | 3300005177 | Soil | IAKPISIKDARRKFGGCAQKAVELTSGDPMQVAETRLGRE* |
| Ga0066388_1040468332 | 3300005332 | Tropical Forest Soil | MIAKPISIKDAKRKFGGCAQKAVELISGDLLHVSESGLRVK* |
| Ga0070699_1001862131 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | RERRASGPMIAKPISIKDAKRKSGGCAQKAVELISGDLLQVTDS* |
| Ga0070732_100425754 | 3300005542 | Surface Soil | MIAKPISIKDAERKFGGCAQKAVELTSGDPLQVTET* |
| Ga0066695_105699512 | 3300005553 | Soil | VIAKSVSIKDAGGKSGGRVSKAVELIAGDLLHVSDS* |
| Ga0066704_101864062 | 3300005557 | Soil | MIAKPISITDARRKFGGCAQKAVELTSGDPMQVAETRLGRE* |
| Ga0066700_100888922 | 3300005559 | Soil | MIAKPISIKDAKRKFGGCAWKAIELISGDLMQVTDS* |
| Ga0066694_106099882 | 3300005574 | Soil | MIAKSASIKDAGGKSGGRVSKAVELIAGDLLHVTDS* |
| Ga0066702_106495311 | 3300005575 | Soil | IAKPISIKGTERKFGGCAWKAVELTSGDLLLVTES* |
| Ga0070762_107982251 | 3300005602 | Soil | GQLIAKSVSIKDAGGKSGGRVSKAVELIAGDLLHVSDS* |
| Ga0070763_105684211 | 3300005610 | Soil | RTSEQVIAKSVSIKDAGGKSGGRVSKAVELIAGDLLHVSDS* |
| Ga0068859_1003513382 | 3300005617 | Switchgrass Rhizosphere | RTSWQLTTKSVSIKDAGGKSGGRVSKAVELIVGDLLHVSDS* |
| Ga0070764_101043663 | 3300005712 | Soil | MVAKPISIKDAKRKFGGCAWKAVELIAGDLRHVTDA* |
| Ga0075029_1009805822 | 3300006052 | Watersheds | MVAKPISIKDAKRKFGGCAWKAVELIAGGLLHVTDS* |
| Ga0070712_1000899711 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MIAKPISIKDAKRKSGGCAQKAVELISGDLLHVSDS* |
| Ga0099791_104523211 | 3300007255 | Vadose Zone Soil | MIAKPISINDAKRKFGGCALKAVELISGDLLHVSDS |
| Ga0099793_100055871 | 3300007258 | Vadose Zone Soil | VIAKSVSIKDAGGKSGGRVSKAVELIAGDLLHVSD |
| Ga0099794_100310442 | 3300007265 | Vadose Zone Soil | IAKSVSIKDAGGKSGGRVSKAVELIAGDLLHVSDSRLRVE* |
| Ga0099794_100662791 | 3300007265 | Vadose Zone Soil | RERRASGPMIAKPISIKDAKRKFGGCAWKAIELISGELLQVTDS* |
| Ga0099794_108029461 | 3300007265 | Vadose Zone Soil | MAAKPISIKDAKRKFGGCAWKAVELIAGDLLHVTDS* |
| Ga0103638_10006142 | 3300008785 | Wetland Soil | MIAKSVSIKDAGGKSGGRVSKAVELIAGDLLHVSDSGLRVE* |
| Ga0099829_100796673 | 3300009038 | Vadose Zone Soil | MIAKSVSIKDAGGKSGGRVSKADELIAGDLLHVSDS* |
| Ga0099829_108112032 | 3300009038 | Vadose Zone Soil | RRTSWQLTTKSVSIKDAGGKSGGRVSQAVELITGDLLHVSDS* |
| Ga0099829_110539651 | 3300009038 | Vadose Zone Soil | GPMVAKPISIKDAKRKFGGCAWKAVELIAGDLLHVSDSGLRVE* |
| Ga0099828_101298571 | 3300009089 | Vadose Zone Soil | MIAKPISIKDAGGKFGGRVSKAVELIAGDLLHVSDSGLRVE* |
| Ga0116105_10210902 | 3300009624 | Peatland | MIAKSVAIKDAGGKSSGRVSKAVELIAGDLLHVSDSGLRVK* |
| Ga0116117_10117751 | 3300009635 | Peatland | MTAKSVAIKDAGGKSGGRVSKAAELIAGDVLHVSDSGLRVK* |
| Ga0116113_10579572 | 3300009638 | Peatland | MIAKSVAIKDAGGKSGGRVSKAAELIAGDLLHVSDSGLRVK* |
| Ga0074046_1000078113 | 3300010339 | Bog Forest Soil | MIAKSVSIKDAGGKSGGRVSKAVVAGDLLHVSDSGLSVK* |
| Ga0126379_107419651 | 3300010366 | Tropical Forest Soil | VIAKPISIKDAKRKFGGGAQKAVELISGDLLHVSDS |
| Ga0126381_1002238552 | 3300010376 | Tropical Forest Soil | MTTKSVSLKDAAGKSGGRVSKAAELIAGDLGTLSDSWLRAE* |
| Ga0136449_1019800511 | 3300010379 | Peatlands Soil | MVAKPISIKDAKRKFGGCAWNAVELIAGDLLHVSDSGLRVE* |
| Ga0136449_1035118762 | 3300010379 | Peatlands Soil | MAKPISIKDAKRRFGGVARTAVEVTSGGLLAVTDW* |
| Ga0126349_10686681 | 3300010861 | Boreal Forest Soil | MIAKPISIKDAKRKFGGCARKAIELISGDLLHVSDSGLRVE* |
| Ga0138526_11369301 | 3300011082 | Peatlands Soil | MVAKPISIKDAKRKSGGCAWKAIELIAGDLLHVSDSGLRVE* |
| Ga0137391_101392521 | 3300011270 | Vadose Zone Soil | QLTTKSVSIKDAGGKSGGRVSKAVELIAGDLLHVTDS* |
| Ga0137391_102090932 | 3300011270 | Vadose Zone Soil | MVAKPISIKDAKRKFGGGAWKAIELISGELLHVSDSGLRVE* |
| Ga0137389_101247932 | 3300012096 | Vadose Zone Soil | IAKSVSIKDAGGKSGGRVSKAVELIAGDLLHVSDS* |
| Ga0137388_100413851 | 3300012189 | Vadose Zone Soil | MIAKSVSIKDAGGKSGGRVSKADELISGDLLHVSDS* |
| Ga0137383_100127381 | 3300012199 | Vadose Zone Soil | MVAKPISIKDAKRKSGGCAWKAVELIAGDLLYVSDSGLRVE* |
| Ga0137362_105753711 | 3300012205 | Vadose Zone Soil | MVAMPISIKDAKRKSGGCAWKAVELIAGDLLHVSDSGLRVE* |
| Ga0137378_108180872 | 3300012210 | Vadose Zone Soil | MAAKLLASKDAKRKFGGCAWKAVELIAGDLLQVTDSGLRVE* |
| Ga0137366_111374431 | 3300012354 | Vadose Zone Soil | GLRCRASKQLIAKPISIKDTGGKSGGGAWKAIELIAGDLLCGTDS* |
| Ga0137385_107904552 | 3300012359 | Vadose Zone Soil | MAAKPLAASKDAKRKFGGCAWKAVELIAGDLLQVTDSGLRVE* |
| Ga0137358_100118526 | 3300012582 | Vadose Zone Soil | MVAKPISIKDAKRKFGGCAWKAVELIAGDLLHIMDSGLRVE* |
| Ga0137358_109095302 | 3300012582 | Vadose Zone Soil | SGQVIAKSVSIKDAGGKSGGRVSKATELIAGDLLHVSNSGLRVE* |
| Ga0137396_110902871 | 3300012918 | Vadose Zone Soil | IAKSVSIKDAGGKSGGCVSKAVELIAGDLLHVSDS* |
| Ga0137413_100191093 | 3300012924 | Vadose Zone Soil | MIAKPISIKDAKRKFGGCAWKAIELISGDLLHVSDSGLSVE* |
| Ga0137419_118689651 | 3300012925 | Vadose Zone Soil | ERRASGPMVAKPISIKDAKRKSGGCAWKAVELIAGDLLHVSLGLRVE* |
| Ga0137404_105810691 | 3300012929 | Vadose Zone Soil | MIAKSVSIKDAGGKSGGRVSKAVELIAGDLLHVSDSGLRVE |
| Ga0137404_123308711 | 3300012929 | Vadose Zone Soil | AKSVSIKDAGGKSGGRVSKAVELIAGDLLHVSDSGLRVE* |
| Ga0137410_102706851 | 3300012944 | Vadose Zone Soil | LATDNASVSIKDAGAKSGGRVSKVGELIAGDLLHVSDS |
| Ga0164301_117754201 | 3300012960 | Soil | IAKPISIKGAGSKFGGRAWKTVELIAGDLLCVTES* |
| Ga0134110_103325081 | 3300012975 | Grasslands Soil | MIAEPISIKGAKRKFGCCARKAVELISGDLLHVSDSRLRAKQ |
| Ga0182019_105651161 | 3300014498 | Fen | KSVSIKDAGGKSGGRVSKAVELIAGDLLHVSDSGLRVE* |
| Ga0182024_101198342 | 3300014501 | Permafrost | MIAKSISIKDAGGKSGGRVSKAVELIAGDLLHVSES* |
| Ga0137405_11122002 | 3300015053 | Vadose Zone Soil | MVAKPISIKDAKRKSGGCAWKAVELIAGDLLHVSDT |
| Ga0137405_13144642 | 3300015053 | Vadose Zone Soil | VSIKDAGGKSGGRVSKAVELIAGDLLHVSDSGLSVE* |
| Ga0137420_11102192 | 3300015054 | Vadose Zone Soil | MAAKPISIKDAKRKSGGCAWKAVELIAGDLLHVSDSGLRVE* |
| Ga0137420_11207581 | 3300015054 | Vadose Zone Soil | RTSGQWTAKSVSIKDAGGKSGGRASKAVELIAGDLLHVSDSGLSVE* |
| Ga0137420_11246352 | 3300015054 | Vadose Zone Soil | MVAKPISIKDAKRKSGGCAWKAVELIAGDLLHVTDS* |
| Ga0137420_14625243 | 3300015054 | Vadose Zone Soil | MVAKPISIKDAKRKFGGCAWKAVELIAGDLLHVTDSGLRVE* |
| Ga0167668_10885141 | 3300015193 | Glacier Forefield Soil | MIAKPISIKDAKRKFGGCAWKAVELIAGDLLHVTDS* |
| Ga0187803_101093481 | 3300017934 | Freshwater Sediment | RASGPMIAKPIFIKDTGGKSDGCAWKAIELISGELLHVAASRLRVE |
| Ga0187783_100213744 | 3300017970 | Tropical Peatland | MIAKPISIKDAKRKFGGCAQKAVELISGDLLHVSHS |
| Ga0187863_107885021 | 3300018034 | Peatland | QVTTKSVSIKDAGRESGGRVSKAVEVIAGDRLRVTDSRQRAGRFTMTVQ |
| Ga0187771_116140981 | 3300018088 | Tropical Peatland | RRASGQVIAKPISIKDAKRKFGGGARKAVGLTSGDLLPVTET |
| Ga0193729_10133242 | 3300019887 | Soil | MIAKPISIKDAKRKFGGCAWKAIELISGDLLHVSDSGLRVE |
| Ga0193728_10973642 | 3300019890 | Soil | RRTSWQRAGEVRTGGKSGGRVSKAVELITGDLLHVSDS |
| Ga0179594_100150491 | 3300020170 | Vadose Zone Soil | MAAKPISIKDAKRKFGGCGWKAVELIAGDLLHVTDS |
| Ga0210399_100253625 | 3300020581 | Soil | MVAKPISIKDAKRKFGGCAWKAIELIAGELLHVTDS |
| Ga0179585_10731471 | 3300021307 | Vadose Zone Soil | MAAKPISIKDAKRKSGGCAWKAVELIAGDLLHVSDSGLRVE |
| Ga0210384_1000041810 | 3300021432 | Soil | MSEQLTAKSVSIKDAGGKSGGRVSRVVELIAGDLLHVSDL |
| Ga0213851_12174541 | 3300021860 | Watersheds | MIAKPISIKDAKRKFGGCAWNAVELIAGDLLHVSDSGLRVE |
| Ga0242660_11373271 | 3300022531 | Soil | MIAKSVSIKDARGKSGGRVSTADELIAGDLRHVADS |
| Ga0212123_102261112 | 3300022557 | Iron-Sulfur Acid Spring | RERWASGQMIAKPISIKDAKRKSGGGAWKAVELTSGDLLGVTES |
| Ga0212123_108506481 | 3300022557 | Iron-Sulfur Acid Spring | QLITKSVSIKDAGGKSGGRVLKAVELIAGDLLHVSDSRLRVE |
| Ga0242665_102141231 | 3300022724 | Soil | MVAKPISIKDAKGKFGGCAWKAVELIAGDLLHVSDSGLRVE |
| Ga0247669_10008902 | 3300024182 | Soil | MIAKPISIKDAKRKFGGCAQKAIELISGGLLHVSDS |
| Ga0137417_12745721 | 3300024330 | Vadose Zone Soil | MVAKPISIKDAKRKSGGCAWKAVELIAGDLLHVSLGLRVE |
| Ga0179591_101643813 | 3300024347 | Vadose Zone Soil | MAAKPISIKDAKRKFGGCAWKAVELIAGDLLHVTDS |
| Ga0208035_10399712 | 3300025406 | Peatland | MTAKSVAIKDAGGKSSGRVSKAAELIAGDLLHVSDSGLRVK |
| Ga0208714_10063162 | 3300025527 | Arctic Peat Soil | MIAKPIFIKDTGGKSDGCAWKAIELISGDLLHVSDS |
| Ga0209688_11076991 | 3300026305 | Soil | GLRRRTSGPMIAKSASIKDAGGKSGGRVSKAVELIAGDLLHVTDS |
| Ga0257150_10160872 | 3300026356 | Soil | RWASGPMAAKPISIKDAKRKFGGCAWKAVELIAGDLLHVTDS |
| Ga0209648_100310285 | 3300026551 | Grasslands Soil | MVAKPISIKDAKRKFGGCAWKAIELISGELLQVTDS |
| Ga0209648_100385442 | 3300026551 | Grasslands Soil | MIAKPISIKDAKRKSGGCAWKAVELIAGDLLHVSDSGLRVE |
| Ga0209648_105766441 | 3300026551 | Grasslands Soil | MVAKPISIKDAKRKFGGCAWKAIELISGDLLHVSDSGLSVE |
| Ga0179593_10986123 | 3300026555 | Vadose Zone Soil | MAAKPISIKDAKRKSGGCAWKAVELIAGDLLHVTDSGLRVE |
| Ga0179593_11354412 | 3300026555 | Vadose Zone Soil | MVAKPISIKDAKRKFGGCAWKAVELIAGDLLHVTDSGLRVE |
| Ga0179587_100077581 | 3300026557 | Vadose Zone Soil | VSIKDAGGKSGGRVSKAVELITGDLLHVSDSGLSVE |
| Ga0209623_10038701 | 3300026880 | Forest Soil | MIAKPISIKDAERKFGGCAWKAIELISGDLLHVSDSRLRVE |
| Ga0209527_10897681 | 3300027583 | Forest Soil | MIAKPISIKDAKRKFGGCARKAIELISGDLLHVSDSR |
| Ga0209733_10407491 | 3300027591 | Forest Soil | MIAKSVSIKDAGGKSGGRVSKAVELIAGDLLHVSDS |
| Ga0209009_10050321 | 3300027667 | Forest Soil | SEQLIAKSVSIKGAGGKSGGRVSKAVELIAGDLLHVSDSRLRVK |
| Ga0209118_10552451 | 3300027674 | Forest Soil | RTSWQLTTKSVSIKDAGGKSGGRVSKAVELISGDLLHVSEM |
| Ga0207862_10325432 | 3300027703 | Tropical Forest Soil | TTKSVSIKDAGGKSGGRVSKAVELIAGDLLRVTES |
| Ga0209328_100360532 | 3300027727 | Forest Soil | MIAKSVSSKDAGGKSGGRVSKAVELIAGDLWHVSDLGMGG |
| Ga0209656_1000042311 | 3300027812 | Bog Forest Soil | MIAKSVSIKDAGGKSGGPVSKAVVAGDLLHVSDSGLSVK |
| Ga0209180_100002416 | 3300027846 | Vadose Zone Soil | MIAKSVSIKDAGGKSGGRVSKADELIAGDLLHVSDS |
| Ga0209068_106247221 | 3300027894 | Watersheds | EQLIAKSVSIKDAGGKSGGRVSKAVELIAGDLLHVSDS |
| Ga0265318_102269442 | 3300028577 | Rhizosphere | RTSEPVIAKSVSIKDASGKSGGRVSKAVELIVGDLLHVSDSGLRVE |
| Ga0075385_118282681 | 3300030854 | Soil | PMIAKPISIKDAKRKFGGCAWKAVELIAGDLLHVSDSGLSVE |
| Ga0138296_11667291 | 3300030923 | Soil | MIAKPISIKDAKRKFGGCAWKAIELISGELLHVADSRLRVE |
| Ga0170834_1110063891 | 3300031057 | Forest Soil | IAKSVSIKDAGGKSGGRVSKAVELIAGDLLHVSDS |
| Ga0265339_101189491 | 3300031249 | Rhizosphere | SVSIKDAGGKSGGRVSKAVELIVGDLLHVSDSGLRVE |
| Ga0307374_1000005870 | 3300031670 | Soil | MIAKSVSIKDAGGKCGGRVSKGVELVAGDLLHVSDSGLRVE |
| Ga0318529_101771432 | 3300031792 | Soil | SVSIKDVGGKSGGRASKAAELIAGDLRHVADSRLRVK |
| Ga0307478_103714051 | 3300031823 | Hardwood Forest Soil | LSEQLTAKAVSIKDAGGKSGGRVSKMVELSEGDLLHVSDS |
| Ga0306925_101159406 | 3300031890 | Soil | MTTKSVSIKDAGSKSGGRVLKAAELITGDLRHVSDS |
| Ga0318536_103979031 | 3300031893 | Soil | SWQLTTKSVSIKDVGGKSGGRASKAAELIAGDLRHVADSRLRVK |
| Ga0306923_115282751 | 3300031910 | Soil | ASIKETGGKCGGRVSKAFELIAGDLRHVSDSRLGVK |
| Ga0307479_110219102 | 3300031962 | Hardwood Forest Soil | RERGASGQMIAKPLSIKDAKRKFGGCAQKAVEPTWGDPL |
| Ga0307479_113187801 | 3300031962 | Hardwood Forest Soil | MIAKPISIKDAKRKFGGCAQKAVELTSGDPLQVAETRLGVER |
| Ga0315279_106169591 | 3300032070 | Sediment | TSGQATTKSISIKHRGCKSGGRASKAAKLTSGDLPHVTAS |
| Ga0318525_104602531 | 3300032089 | Soil | TTKSVSIKDVGGKSGGRASKAAELIAGDLRHVADSRLRVK |
| Ga0307472_1012646801 | 3300032205 | Hardwood Forest Soil | MVAKPISIKDAKRKFGGCAWKAIELISGDLLHVSDSGLRVE |
| Ga0326727_112867181 | 3300033405 | Peat Soil | TSEQLIAKSVSIKDAGGKSGGRVSKAVELITGDLLHVSDS |
| ⦗Top⦘ |