


| Basic Information | |
|---|---|
| Family ID | F060124 |
| Family Type | Metagenome |
| Number of Sequences | 133 |
| Average Sequence Length | 41 residues |
| Representative Sequence | MTRKTRKYEFTNEAAADAAIAALPHDEEGNPTHGHNVVKLGYL |
| Number of Associated Samples | 80 |
| Number of Associated Scaffolds | 133 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 1.53 % |
| % of genes near scaffold ends (potentially truncated) | 98.50 % |
| % of genes from short scaffolds (< 2000 bps) | 96.24 % |
| Associated GOLD sequencing projects | 62 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.29 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (86.466 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous (46.617 % of family members) |
| Environment Ontology (ENVO) | Unclassified (88.722 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (90.977 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 12.68% β-sheet: 0.00% Coil/Unstructured: 87.32% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.29 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 133 Family Scaffolds |
|---|---|---|
| PF13385 | Laminin_G_3 | 12.03 |
| PF07460 | NUMOD3 | 8.27 |
| PF13392 | HNH_3 | 1.50 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 86.47 % |
| All Organisms | root | All Organisms | 13.53 % |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 46.62% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 12.03% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 10.53% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 7.52% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 6.02% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 4.51% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 3.01% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 2.26% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 2.26% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 1.50% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 0.75% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 0.75% |
| Sediment | Environmental → Aquatic → Marine → Subtidal Zone → Sediment → Sediment | 0.75% |
| Saline Lake | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake | 0.75% |
| Pond Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water | 0.75% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001348 | Pelagic Microbial community sample from North Sea - COGITO 998_met_04 | Environmental | Open in IMG/M |
| 3300001351 | Pelagic Microbial community sample from North Sea - COGITO 998_met_03 | Environmental | Open in IMG/M |
| 3300001352 | Pelagic Microbial community sample from North Sea - COGITO 998_met_07 | Environmental | Open in IMG/M |
| 3300006027 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006191 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG104-DNA | Environmental | Open in IMG/M |
| 3300006193 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG029-DNA | Environmental | Open in IMG/M |
| 3300006793 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 | Environmental | Open in IMG/M |
| 3300006867 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006868 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006869 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006916 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 | Environmental | Open in IMG/M |
| 3300006919 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 | Environmental | Open in IMG/M |
| 3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
| 3300007229 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007234 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007344 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 | Environmental | Open in IMG/M |
| 3300007346 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 | Environmental | Open in IMG/M |
| 3300007540 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007640 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 | Environmental | Open in IMG/M |
| 3300008012 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300009074 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100430 | Environmental | Open in IMG/M |
| 3300009423 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100423 | Environmental | Open in IMG/M |
| 3300009435 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100413 | Environmental | Open in IMG/M |
| 3300009507 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607 | Environmental | Open in IMG/M |
| 3300010316 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.8_DNA | Environmental | Open in IMG/M |
| 3300010368 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNA | Environmental | Open in IMG/M |
| 3300013010 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.8_DNA | Environmental | Open in IMG/M |
| 3300017697 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_DNA (version 2) | Environmental | Open in IMG/M |
| 3300017950 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041413US metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017951 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101413BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017986 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101405AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300020169 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160419_1 | Environmental | Open in IMG/M |
| 3300020182 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160502_2 | Environmental | Open in IMG/M |
| 3300020185 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160517_1 | Environmental | Open in IMG/M |
| 3300020187 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160512_1 | Environmental | Open in IMG/M |
| 3300020595 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160412_1 | Environmental | Open in IMG/M |
| 3300022065 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (v2) | Environmental | Open in IMG/M |
| 3300022068 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (v2) | Environmental | Open in IMG/M |
| 3300022072 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (v3) | Environmental | Open in IMG/M |
| 3300022159 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 (v3) | Environmental | Open in IMG/M |
| 3300022168 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v2) | Environmental | Open in IMG/M |
| 3300022198 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022200 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300023105 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101408AT metaG | Environmental | Open in IMG/M |
| 3300024293 | Seawater microbial communities from Monterey Bay, California, United States - 63D | Environmental | Open in IMG/M |
| 3300024518 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_2 | Environmental | Open in IMG/M |
| 3300025085 | Marine viral communities from the Subarctic Pacific Ocean - 14_ETSP_OMZ_AT15311 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025425 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UK8 (SPAdes) | Environmental | Open in IMG/M |
| 3300025543 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025577 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100423 (SPAdes) | Environmental | Open in IMG/M |
| 3300025590 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100420 (SPAdes) | Environmental | Open in IMG/M |
| 3300025594 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100430 (SPAdes) | Environmental | Open in IMG/M |
| 3300025621 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100511 (SPAdes) | Environmental | Open in IMG/M |
| 3300025632 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100413 (SPAdes) | Environmental | Open in IMG/M |
| 3300025637 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110512 (SPAdes) | Environmental | Open in IMG/M |
| 3300025647 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025652 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (SPAdes) | Environmental | Open in IMG/M |
| 3300025687 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025751 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025759 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (SPAdes) | Environmental | Open in IMG/M |
| 3300025769 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (SPAdes) | Environmental | Open in IMG/M |
| 3300025809 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110523 (SPAdes) | Environmental | Open in IMG/M |
| 3300025810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025840 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025853 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (SPAdes) | Environmental | Open in IMG/M |
| 3300025860 | Pelagic Microbial community sample from North Sea - COGITO 998_met_03 (SPAdes) | Environmental | Open in IMG/M |
| 3300025874 | Pelagic Microbial community sample from North Sea - COGITO 998_met_04 (SPAdes) | Environmental | Open in IMG/M |
| 3300025889 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes) | Environmental | Open in IMG/M |
| 3300026187 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MG (SPAdes) | Environmental | Open in IMG/M |
| 3300027704 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG017-DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300028008 | Seawater microbial communities from Monterey Bay, California, United States - 1D_r | Environmental | Open in IMG/M |
| 3300028599 | Marine sediment microbial communities from subtidal zone of North Sea - Hel_20160524 (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300031578 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-2 | Environmental | Open in IMG/M |
| 3300031658 | Marine microbial communities from Ellis Fjord, Antarctic Ocean - #78 | Environmental | Open in IMG/M |
| 3300031669 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-1 | Environmental | Open in IMG/M |
| 3300031673 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-3 | Environmental | Open in IMG/M |
| 3300034374 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v4) | Environmental | Open in IMG/M |
| 3300034418 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 (v4) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI20154J14316_100789562 | 3300001348 | Pelagic Marine | MIKKTRKYNFTNEAAADAAIAALPHDEEGNPSHGHNVVKLGYLTIEP |
| JGI20153J14318_100413092 | 3300001351 | Pelagic Marine | MIKKTRKYNFTNEAAADAAIAALPHDEEGVVAHNHNVVKLGYL |
| JGI20153J14318_100663652 | 3300001351 | Pelagic Marine | MKKTRKYEFTNEAAADAAIAALPHDEEGVVAHNHNVVKLGY |
| JGI20153J14318_101304162 | 3300001351 | Pelagic Marine | MKYTRKYEFTNEAAADAAIAALPHDEEGNPSHGHNVVKLGYL |
| JGI20157J14317_100537842 | 3300001352 | Pelagic Marine | MKKTRKYEFTNEAAADAAIAALPHDEEGNPSHGHNVVKLG |
| Ga0075462_100946221 | 3300006027 | Aqueous | MRYTRKYNFTNEAAADAAIAALPHDEEGNPTYSHAIVKLG |
| Ga0075447_100351122 | 3300006191 | Marine | MTRLTRKYEFVDEAAADAAIALLPTDDEGNPTHEHLVTKLGHL |
| Ga0075445_100920292 | 3300006193 | Marine | MTRLTRKYAFTDEAAADAAIALLPTDDEGNPSHGHLVTKLGYLV |
| Ga0098055_11088612 | 3300006793 | Marine | MKKTRKYEFTNEAAADKAIAALPHDEEGNPTHGHNVVKLGYLTI |
| Ga0098055_13532532 | 3300006793 | Marine | MKKTRKYEFTNEAAADAAIAALPHDDEGNPTHNNGIVKLGYLVV |
| Ga0070749_100938171 | 3300006802 | Aqueous | MRKFRKYSFTNEAAFDAAIAALPHDEEGNPTHSHSI |
| Ga0070749_104157233 | 3300006802 | Aqueous | MITRKYEFTNEAAADAAIAALPHDEEGNPSHGHNVVKLGYLT |
| Ga0070749_104818451 | 3300006802 | Aqueous | MTRKTRKYEFTNEAAADAAIAALPHDEEGNPSHGHNVVKLGYLTIEP |
| Ga0070754_104455991 | 3300006810 | Aqueous | MRLTRKYEFDNEAAVDALIAALPHDEEGNPTYKHAI |
| Ga0075476_101433122 | 3300006867 | Aqueous | MRYTRKYNFTNEAAADAAIAALPHDEEGNVNHSHAIVKLGYLV |
| Ga0075481_101496441 | 3300006868 | Aqueous | MRYTRKYNFTNEAAADAAIAALPHDEEGNPTHGHNVV |
| Ga0075481_103191822 | 3300006868 | Aqueous | MTRKTRKYEFTNEAAADAAIAALPHDEEGNPTHGHN |
| Ga0075477_100757333 | 3300006869 | Aqueous | MRYTRKYNFTNEAAADAAIAALPHDEEGNPTYSHAIVKLGYL |
| Ga0075477_102692781 | 3300006869 | Aqueous | MIRYTRKYAFTNEAAADAAIAALPHDEEGNPTYSHAIV |
| Ga0070750_101478922 | 3300006916 | Aqueous | MTRKTRKYEFTNEAAADAAIAALPHDEEGNPSHGHNVVNLVYLTIEPA |
| Ga0070750_103048661 | 3300006916 | Aqueous | MITRKYEFTNEAAADAAIAALPHDEEGNPSHGHNVVKLGYLTI |
| Ga0070746_102594712 | 3300006919 | Aqueous | MIKKTRKYNFTNEAAADAAIAALPHDEEGNVNHNHAI |
| Ga0070746_103689441 | 3300006919 | Aqueous | MIRYTRKYAFTNEAAADAAIAALPHDEEGNPTYSHAIVKLGYLTV |
| Ga0070748_11503603 | 3300006920 | Aqueous | MKYTRKYCFTNEAAADAAIAALPHDEEGNPTYSHA |
| Ga0075468_102524531 | 3300007229 | Aqueous | MTRLTRKYEFTNEAAADAAIAALPHDEEGNPTYSHA |
| Ga0075460_100734811 | 3300007234 | Aqueous | MTRKTRKYEFTNEAAADAAIAALPHDEEGNPTYSHAIVKL |
| Ga0070745_13045701 | 3300007344 | Aqueous | MKKTRKYEFTNEAAADAAIAALPHDEEGNPTHGHNV |
| Ga0070753_12690612 | 3300007346 | Aqueous | MTRKTRKYEFTNEAAADAAIAALPHDEEGNPTHGHNVVKLGYL |
| Ga0099847_10562022 | 3300007540 | Aqueous | MIRYTRKYAFTNEAAADAAIAALPHDEEGNPTYSHAIVKLGYLTVTPAT |
| Ga0099847_10611701 | 3300007540 | Aqueous | MTRLTRKYEFTNEAAADAAIAALPHDEEGNPTHGHNVVKLGYLTI |
| Ga0099847_10702822 | 3300007540 | Aqueous | MKKTRKYEFTNEAAADAAIDLLRDEEGNLTEAVVKLGY |
| Ga0099847_10991171 | 3300007540 | Aqueous | MTRLTRKYEFTNEAAADAAIAALPHDEEGNPTYSHAIVKLGYLTV |
| Ga0099847_11066271 | 3300007540 | Aqueous | MTRLTRKYEFTNEAAADAAIAALPHDEEGNPTYSHAIVKPGYLTV |
| Ga0099847_11704931 | 3300007540 | Aqueous | MKKVRYTRKYEFTNEAAADAAIAALPHDEEGNPTHGHN |
| Ga0099847_11789422 | 3300007540 | Aqueous | MTRLTRKYEFTNEAAADAAIAALPHDEEGNPTYSHAIVK |
| Ga0099847_12264161 | 3300007540 | Aqueous | MKKTRKYEFTNEAAADAAIAALPHDEEGNPTHGHNVVKLGYLTIEP |
| Ga0070751_12633761 | 3300007640 | Aqueous | MIRYTRKYAFTNEAAADAAIAALPHDEEGNPTHGHN |
| Ga0075480_101673403 | 3300008012 | Aqueous | MRYTRKYNFTNEAAADAAIAALPHDEEGNVNHSHAIVKLGYLVDTPAT |
| Ga0115549_12636431 | 3300009074 | Pelagic Marine | MTRKTRKYEFTNEAAADAAIAALPHDEEGNPSHGHNVVKLGYLTI |
| Ga0115548_12606671 | 3300009423 | Pelagic Marine | MKKVRYTRKYEFTNEAAADAAIAALPHDEEGNPSHGHNVVK |
| Ga0115546_11881912 | 3300009435 | Pelagic Marine | MIKKTRKYNFTNEAAADAAIAALPHDEEGNVNHNHAIVKLGYLV |
| Ga0115546_12189792 | 3300009435 | Pelagic Marine | MKYTRKYEFTNEAAADAAIAALPHYEEGNPTHGHNVVKLG |
| Ga0115572_100932642 | 3300009507 | Pelagic Marine | MIKKTRKYEFTNEAAADAAIAALPHDEDGNPSHGHNVVKLGYLTIEPA |
| Ga0136655_10502721 | 3300010316 | Freshwater To Marine Saline Gradient | MTRLTRKYEFTNEAAADAAIAALPHDDEGNPSHGHNVVKLGYLTIEPA |
| Ga0129324_100597333 | 3300010368 | Freshwater To Marine Saline Gradient | MTRKTRKYEFTNEAAADAAIAALPHDEEGNPTHGHNVVKL |
| Ga0129324_101089871 | 3300010368 | Freshwater To Marine Saline Gradient | MTRKTRKYEFTNEAAADAAIAALPHDEEGNPSHGHN |
| Ga0129324_101179242 | 3300010368 | Freshwater To Marine Saline Gradient | MTRLTRKYEFTNEAAADAAIAALPHDDEGNPSHGHNVVK |
| Ga0129324_102540101 | 3300010368 | Freshwater To Marine Saline Gradient | MKYTRKYEFTNEAAADAAIAALPHDEEGNPTHGHNVVKLGYL |
| Ga0129327_100738061 | 3300013010 | Freshwater To Marine Saline Gradient | MKYTRKYNFTNEAAADAAIAALPHDDEGNPTHGHNVVKL |
| Ga0129327_100787711 | 3300013010 | Freshwater To Marine Saline Gradient | MKYTRKYEFTNEAAADAAIAALPHDEEGNPSHGHNV |
| Ga0129327_105019242 | 3300013010 | Freshwater To Marine Saline Gradient | MTRKTRKYEFTNEAAADAAIAALPHDEEGNPTYSH |
| Ga0129327_105290921 | 3300013010 | Freshwater To Marine Saline Gradient | MIRYTRKYEFTNEAAADAAIAALPHDEEGNPTYSHAIVKLGYLTVT |
| Ga0180120_100491691 | 3300017697 | Freshwater To Marine Saline Gradient | MIKKTRKYNFTNEAAADAAIAALPHDDEGNPSHGHNVVKLG |
| Ga0180120_100535622 | 3300017697 | Freshwater To Marine Saline Gradient | MTRKTRKYAFTNEAAADAAIAALPHDEEGNPTHGHNVVKLGYL |
| Ga0180120_101172901 | 3300017697 | Freshwater To Marine Saline Gradient | MTRKTRKYEFTNEAAADAAIAALPHDEEGNPTHGHNV |
| Ga0180120_101443741 | 3300017697 | Freshwater To Marine Saline Gradient | MTRLTRKYEFTNEAAADAAIAALPHDEEGNPTYSHAIVKLGYLTVT |
| Ga0180120_104485802 | 3300017697 | Freshwater To Marine Saline Gradient | MKKTRKYEFTNEAAADAAIAALPHDEEGNPTYSHAIVKLGYL |
| Ga0181607_102987091 | 3300017950 | Salt Marsh | MKYTRKYEFTNEAAADAAIAALPHDEEGNPTHGHN |
| Ga0181577_101091793 | 3300017951 | Salt Marsh | MRLTRKYEFDNEAAVDALIAALPHDEEGNPTYKHAISKLGYIVK |
| Ga0181577_104828542 | 3300017951 | Salt Marsh | MKYTRKYAFTNEAAADAAIAALPHDEEGNPTYSHAIVKLGYLT |
| Ga0181569_108278002 | 3300017986 | Salt Marsh | MKYTRKYEFTNEAAADAAIAALPHDEEGNPTYSHAIVKLGY |
| Ga0181569_108333121 | 3300017986 | Salt Marsh | MKYTRKYEFTKEAAADAAIAALPHDEEGNPTYSHAIVK |
| Ga0206127_11110332 | 3300020169 | Seawater | MIKKTRKYNFTNEAAADAAIAALPHDEEGVVAHNHNVVK |
| Ga0206129_102820912 | 3300020182 | Seawater | MKKTRKYEFTNEAAADAAIAALPHDEEGNPTYSHAIVK |
| Ga0206131_101509491 | 3300020185 | Seawater | MIKKTRKYNFTNEAAADAAIAALPHDEEGNPTHSHAIVKLGYL |
| Ga0206131_102678451 | 3300020185 | Seawater | MKYTRKYEFTNEAAADAAIAALPHDEEGNPTHGHNVVKL |
| Ga0206130_100831573 | 3300020187 | Seawater | MKYTRKYEFTNEAAADAAIAALPHDEEGNEAHGHNV |
| Ga0206130_100939232 | 3300020187 | Seawater | MTRKTRKYEFTNEAAADAAIAALPHDEEGNPTYSHAIVKLGY |
| Ga0206130_102235102 | 3300020187 | Seawater | MKKTRKYEFTNEAAADAAIAALPHDEEGNPTYSHAIVKLG |
| Ga0206126_101469891 | 3300020595 | Seawater | MKRYTRKYEFTNEAAADAAIAALPHDEEGVVAHNH |
| Ga0212024_10141861 | 3300022065 | Aqueous | MTRLTRKYEFTNEAAADAAIAALPHDEEGNPTYSHAIVKLGYLTVTP |
| Ga0212024_10226761 | 3300022065 | Aqueous | MTRKTRKYEFTNEAAADAAIDLLRDEEGNLTEAVVKLGYLTTT |
| Ga0212021_10104733 | 3300022068 | Aqueous | MRYTRKYNFTNEAAADAAIAALPHDEEGNPTYSHAIVKLGY |
| Ga0196889_10320372 | 3300022072 | Aqueous | MKYTRKYEFTNEAAADAAIAALPHDEEGNPSHGHNVVKLGYLTIE |
| Ga0196893_10102532 | 3300022159 | Aqueous | MRKFRKYSFTNEAAFDAAIAALPHDEEGNPTHSHSIVRL |
| Ga0212027_10526531 | 3300022168 | Aqueous | MRYTRKYNFTNEAAADAAIAALPHDEEANPTYSHAIVKL |
| Ga0196905_11056211 | 3300022198 | Aqueous | MRKFRKYSFTNEAAFDAAIAALPHDEEGNPTHSHSIVRLGNIVI |
| Ga0196901_10417361 | 3300022200 | Aqueous | MIKKTRKYNFTNEAAADAAIAALPHDDEGNPSHGHNVVKLGYLTIEPA |
| Ga0196901_11764282 | 3300022200 | Aqueous | MTRLTRKYEFTNEAAADAAIAALPHDEEGNPTHGHNVVKLGYL |
| Ga0255782_101515471 | 3300023105 | Salt Marsh | MRLTRKYEFDNEAAVDALIAALPHDEEGNPTYKHAISKLG |
| Ga0228651_10576132 | 3300024293 | Seawater | MKVTRKYEFTNEAAANAAIAALPHDEEGNPTHNNGIV |
| (restricted) Ga0255048_104875861 | 3300024518 | Seawater | MIKKTRKYEYPNEAAADTAIAALPHDDEGNEAHGHS |
| Ga0208792_10571951 | 3300025085 | Marine | MKLTRKYEFTNEAAADAAIAALPHDDEGNPTHNNGIVKLGYLVVTPA |
| Ga0208646_10280731 | 3300025425 | Saline Lake | MTRLTRKYAFTDEAAADAAIALLPTDDEGNASHNHLVTKL |
| Ga0208303_10056901 | 3300025543 | Aqueous | MTRLTRKYEFTNEAAADAAIAALPHDEEGNPTYSHAIVKLGYL |
| Ga0208303_10403811 | 3300025543 | Aqueous | MRYTRKYEFTNEAAADAAIAALPHDEEDNPTYSHAIVKLGYLTVT |
| Ga0208303_10592891 | 3300025543 | Aqueous | MTRLTRKYEFTNEAAADAAIAALPHDEEGNPTYSHAIVKLGYLT |
| Ga0208303_10850172 | 3300025543 | Aqueous | MTRYTRKYNFTNEAAADAAIAALPHDEEGNPTYSHAIV |
| Ga0209304_11321352 | 3300025577 | Pelagic Marine | MKKVRYTRKYEFTNEAAADAAIAALPHDEEGNPSHGHNVVKLGYLTI |
| Ga0209195_10821592 | 3300025590 | Pelagic Marine | MKKTRKYEFTNEAAADAAIAALPHDEEGVVAHNHNVVKLGYL |
| Ga0209094_10417022 | 3300025594 | Pelagic Marine | MIKYTRKYNFTNEAAADAAIAALPHDEEGNPTHGHNVVKLGYLTI |
| Ga0209094_10470671 | 3300025594 | Pelagic Marine | MIKKTRKYNFTNEAAADAAIAALPHDEEGNPSHGHNV |
| Ga0209094_10858351 | 3300025594 | Pelagic Marine | MKYTRKYEFTNEAAADAAIAALPHDEEGNVTHGHNVVKLGYLTIEPA |
| Ga0209504_11291471 | 3300025621 | Pelagic Marine | MIKYTRKYNFTNEAAADAAIAALPHDEEGNPTHGHNVVKLGY |
| Ga0209504_11340792 | 3300025621 | Pelagic Marine | MKRLTRKYEFTNEAAADAAIAALPHDDEGNPTHGHNVVKL |
| Ga0209194_10692513 | 3300025632 | Pelagic Marine | MKRYTRKYNFTNEAAADAAIAALPHDEEGNPSHGHNVVKLGY |
| Ga0209197_10702652 | 3300025637 | Pelagic Marine | MKYTRKYEFTNEAAADAAIAALPHDEEGNPTHGHNVVKLGY |
| Ga0208160_10415341 | 3300025647 | Aqueous | MIKKTRKYNFTNEAAADAAIAALPHDDEGNPSHGHNVVKL |
| Ga0208134_11430572 | 3300025652 | Aqueous | MIKKTRKYNFTNEAAADAAIAALPHDEEGNPTHGHN |
| Ga0208019_11375262 | 3300025687 | Aqueous | MRKFRKYSFTNEAAFDAAIAALPHDEEGNPTHSHSIVRLGHIV |
| Ga0208150_10516101 | 3300025751 | Aqueous | MTRKTRKYEFTNEAAADAAIAALPHDEEGNPTHGHNVVKLG |
| Ga0208150_11930051 | 3300025751 | Aqueous | MTRLTRKYEFSNEAAADTAIAALPHDKDRNLTHGH |
| Ga0208899_11315883 | 3300025759 | Aqueous | MTRKTRKYNFTNEAAADAAIAALPHDEEGNPTHNNAIVKLGYLVDTPA |
| Ga0208899_11596141 | 3300025759 | Aqueous | MTRKTRKYQFTNEAAADAAIAALPHDEEGNPTHGHNVVKLGYLTIE |
| Ga0208767_12111771 | 3300025769 | Aqueous | MKYTRKYEFTNEVAADAAIAALPHDEEGNPTYSHAIVKLGYLTVTPA |
| Ga0208767_12681902 | 3300025769 | Aqueous | MKYTRKYNFTNEAAADAAIAALPHDEEGNVNHSHAIVKLGYLVDTPA |
| Ga0209199_10987792 | 3300025809 | Pelagic Marine | MKYTRKYEFTNEAAADAAIAALPHDEEGNPTHGHNVVKLGYLTIE |
| Ga0209199_12047291 | 3300025809 | Pelagic Marine | MIKKTRKYNFTNESAADAAIAALPHDEEGNPSHGHNVVKLGYLTIEPAV |
| Ga0208543_11213962 | 3300025810 | Aqueous | MIKKTRKYNFTNEAAADAAIAALPHDEEGNPTHNNAIVKLGYLVDT |
| Ga0208917_12233262 | 3300025840 | Aqueous | MTRKTRKYEFTNEAAADAAIAALPHDEEGNPTHGHNVVK |
| Ga0208917_12709601 | 3300025840 | Aqueous | MIRYTRKYAFTNEAAADAAIAALPHDEEGNVNHSHAIVKLGYLTVT |
| Ga0208645_10911651 | 3300025853 | Aqueous | MIRYTRKYAFTNEAAADAAIAALPHDEEGNVNHSHAIVKLGYLT |
| Ga0209119_10915081 | 3300025860 | Pelagic Marine | MIKKTRKYNFTNEAAADAAIAALPHDEEGVVAHNHNVVKLGYLTI |
| Ga0209119_10962271 | 3300025860 | Pelagic Marine | MIKYTRKYNFTNEAAADAAIAALPHDEEGNPTHGHNVVKLG |
| Ga0209119_11152222 | 3300025860 | Pelagic Marine | MKYTRKYEFTNEAAADAAIAALPHDEEGVVAHNHNVVKLG |
| Ga0209119_12491562 | 3300025860 | Pelagic Marine | MKKTRKYEFTNEAAADAAIAALPHDEEGVVAHNHNVV |
| Ga0209533_11346241 | 3300025874 | Pelagic Marine | MIKKTRKYNFTNEAAADAAIAALPHDEEGNPSHGHNVVKLGYLTIE |
| Ga0208644_10433821 | 3300025889 | Aqueous | MIRYTRKYAFTNEAAADAAIAALPHDEEGNPTYSHAIVKLGYLTVT |
| Ga0208644_10638601 | 3300025889 | Aqueous | MTRKTRKYEFTNEAAADAAIAALPHDEEGNPTYSHAIVKLGYLT |
| Ga0208644_11237601 | 3300025889 | Aqueous | MKYTRKYEFTNEVAADAAIAALPHDEEGNPTYSHAIVK |
| Ga0209929_11443541 | 3300026187 | Pond Water | MKLTRKYEFTNEAAADTAIAALPHDDEGNPTHGHLIVKL |
| Ga0209816_11108051 | 3300027704 | Marine | MTRLTRKYEFVDEAAADAAIALLPTDDEGNPSHGHLVTKLGY |
| Ga0228674_10831922 | 3300028008 | Seawater | MKLTRKYEFTNEAAADTAIAALPHDDEGNPTHGHN |
| Ga0265309_105566771 | 3300028599 | Sediment | MKKTRKYEFTNEAAADAAIAALPRDEEGNPTHGHNVVKLG |
| Ga0307376_104615683 | 3300031578 | Soil | MTRYTRKYEFTNEAAADAAIAALPHDEEGNPTHNNGIVK |
| Ga0307984_11284643 | 3300031658 | Marine | MTRLTRKYEFANEEAAEAAIALLGVDIEGNPTHGHLVTKLGHLVL |
| Ga0307375_101938382 | 3300031669 | Soil | MKRLTRKYEFTNEAAADAAIAALPHDEEGNPSHGHN |
| Ga0307375_105944581 | 3300031669 | Soil | MKYTRKYEFTNEAAADAAIAALPHDEEGNPSHGHNVVKLGY |
| Ga0307377_111454902 | 3300031673 | Soil | MKKTRKYEFTNEAAADAAIAALPHDEEGNPTHNNGIVKLGY |
| Ga0348335_107648_3_119 | 3300034374 | Aqueous | MRLTRKYEFDNEAAVDALIAALPHDEEGNPTYKHAISKL |
| Ga0348337_035245_1_144 | 3300034418 | Aqueous | MIRYTRKYAFTNEAAADAAIAALPHDEEGNPTYSHAIVKLGYLTVTPA |
| Ga0348337_113949_1_141 | 3300034418 | Aqueous | MTRYTRKYNFTNEAAADAAIAALPHDEEGNPTYSHAIVKLGYLTVTP |
| Ga0348337_113997_1_114 | 3300034418 | Aqueous | MKKTRKYEFTNEAAADAAIAALPHDEEGNPSHGHNVVK |
| ⦗Top⦘ |