


| Basic Information | |
|---|---|
| Family ID | F059820 |
| Family Type | Metagenome |
| Number of Sequences | 133 |
| Average Sequence Length | 47 residues |
| Representative Sequence | NIGFSKDGKTAFIAVRGANDVAVIDIEKLALASRIKAGTEPQGLIVR |
| Number of Associated Samples | 113 |
| Number of Associated Scaffolds | 133 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 6.02 % |
| % of genes near scaffold ends (potentially truncated) | 92.48 % |
| % of genes from short scaffolds (< 2000 bps) | 88.72 % |
| Associated GOLD sequencing projects | 105 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.68 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (91.729 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (22.556 % of family members) |
| Environment Ontology (ENVO) | Unclassified (30.827 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (54.135 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 29.33% Coil/Unstructured: 70.67% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.68 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 133 Family Scaffolds |
|---|---|---|
| PF00440 | TetR_N | 7.52 |
| PF00296 | Bac_luciferase | 6.77 |
| PF08545 | ACP_syn_III | 5.26 |
| PF00496 | SBP_bac_5 | 3.01 |
| PF08497 | Radical_SAM_N | 3.01 |
| PF01654 | Cyt_bd_oxida_I | 3.01 |
| PF12833 | HTH_18 | 3.01 |
| PF07690 | MFS_1 | 2.26 |
| PF04392 | ABC_sub_bind | 1.50 |
| PF00027 | cNMP_binding | 1.50 |
| PF03739 | LptF_LptG | 1.50 |
| PF07589 | PEP-CTERM | 1.50 |
| PF00753 | Lactamase_B | 1.50 |
| PF03006 | HlyIII | 1.50 |
| PF08240 | ADH_N | 0.75 |
| PF13544 | Obsolete Pfam Family | 0.75 |
| PF07963 | N_methyl | 0.75 |
| PF13193 | AMP-binding_C | 0.75 |
| PF01527 | HTH_Tnp_1 | 0.75 |
| PF12867 | DinB_2 | 0.75 |
| PF13924 | Lipocalin_5 | 0.75 |
| PF09585 | Lin0512_fam | 0.75 |
| PF03466 | LysR_substrate | 0.75 |
| PF08334 | T2SSG | 0.75 |
| PF00034 | Cytochrom_C | 0.75 |
| PF00892 | EamA | 0.75 |
| PF01575 | MaoC_dehydratas | 0.75 |
| PF16490 | Oxidoreduct_C | 0.75 |
| PF13084 | DUF3943 | 0.75 |
| PF02806 | Alpha-amylase_C | 0.75 |
| PF00005 | ABC_tran | 0.75 |
| PF11987 | IF-2 | 0.75 |
| PF11842 | DUF3362 | 0.75 |
| PF02417 | Chromate_transp | 0.75 |
| PF09650 | PHA_gran_rgn | 0.75 |
| PF02653 | BPD_transp_2 | 0.75 |
| PF13936 | HTH_38 | 0.75 |
| PF10282 | Lactonase | 0.75 |
| PF00694 | Aconitase_C | 0.75 |
| PF07883 | Cupin_2 | 0.75 |
| COG ID | Name | Functional Category | % Frequency in 133 Family Scaffolds |
|---|---|---|---|
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 6.77 |
| COG1032 | Radical SAM superfamily enzyme YgiQ, UPF0313 family | General function prediction only [R] | 3.01 |
| COG1271 | Cytochrome bd-type quinol oxidase, subunit 1 | Energy production and conversion [C] | 3.01 |
| COG0795 | Lipopolysaccharide export LptBFGC system, permease protein LptF | Cell wall/membrane/envelope biogenesis [M] | 1.50 |
| COG1272 | Predicted membrane channel-forming protein YqfA, hemolysin III family | Intracellular trafficking, secretion, and vesicular transport [U] | 1.50 |
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 1.50 |
| COG0296 | 1,4-alpha-glucan branching enzyme | Carbohydrate transport and metabolism [G] | 0.75 |
| COG0366 | Glycosidase/amylase (phosphorylase) | Carbohydrate transport and metabolism [G] | 0.75 |
| COG1523 | Pullulanase/glycogen debranching enzyme | Carbohydrate transport and metabolism [G] | 0.75 |
| COG2059 | Chromate transport protein ChrA | Inorganic ion transport and metabolism [P] | 0.75 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 91.73 % |
| Unclassified | root | N/A | 8.27 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000363|ICChiseqgaiiFebDRAFT_14515522 | All Organisms → cellular organisms → Bacteria | 1775 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_101922014 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
| 3300000956|JGI10216J12902_112470263 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 502 | Open in IMG/M |
| 3300002560|JGI25383J37093_10094846 | All Organisms → cellular organisms → Bacteria | 881 | Open in IMG/M |
| 3300004268|Ga0066398_10103963 | All Organisms → cellular organisms → Bacteria | 662 | Open in IMG/M |
| 3300004633|Ga0066395_10828724 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
| 3300005172|Ga0066683_10179659 | All Organisms → cellular organisms → Bacteria | 1304 | Open in IMG/M |
| 3300005178|Ga0066688_10175214 | All Organisms → cellular organisms → Bacteria | 1353 | Open in IMG/M |
| 3300005180|Ga0066685_10907092 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 588 | Open in IMG/M |
| 3300005180|Ga0066685_11119094 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300005332|Ga0066388_103201787 | All Organisms → cellular organisms → Bacteria | 836 | Open in IMG/M |
| 3300005332|Ga0066388_104280812 | All Organisms → cellular organisms → Bacteria | 727 | Open in IMG/M |
| 3300005332|Ga0066388_104857637 | All Organisms → cellular organisms → Bacteria | 683 | Open in IMG/M |
| 3300005445|Ga0070708_102260156 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300005446|Ga0066686_10560870 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 776 | Open in IMG/M |
| 3300005467|Ga0070706_102077886 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300005526|Ga0073909_10491036 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 592 | Open in IMG/M |
| 3300005546|Ga0070696_100833497 | All Organisms → cellular organisms → Bacteria | 761 | Open in IMG/M |
| 3300005552|Ga0066701_10107040 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1640 | Open in IMG/M |
| 3300005555|Ga0066692_10104148 | All Organisms → cellular organisms → Bacteria | 1687 | Open in IMG/M |
| 3300005559|Ga0066700_10794178 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 638 | Open in IMG/M |
| 3300005559|Ga0066700_10959627 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
| 3300005560|Ga0066670_10835879 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 559 | Open in IMG/M |
| 3300005561|Ga0066699_10841428 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
| 3300005561|Ga0066699_10885504 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. NBAIM32 | 624 | Open in IMG/M |
| 3300005586|Ga0066691_10033804 | All Organisms → cellular organisms → Bacteria | 2661 | Open in IMG/M |
| 3300005598|Ga0066706_10214412 | All Organisms → cellular organisms → Bacteria | 1485 | Open in IMG/M |
| 3300005713|Ga0066905_102016849 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300005718|Ga0068866_10654270 | All Organisms → cellular organisms → Bacteria | 716 | Open in IMG/M |
| 3300005764|Ga0066903_109157939 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300006049|Ga0075417_10118722 | All Organisms → cellular organisms → Bacteria | 1212 | Open in IMG/M |
| 3300006058|Ga0075432_10215452 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 766 | Open in IMG/M |
| 3300006794|Ga0066658_10589822 | All Organisms → cellular organisms → Bacteria | 605 | Open in IMG/M |
| 3300006796|Ga0066665_11663775 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 504 | Open in IMG/M |
| 3300006797|Ga0066659_10360837 | All Organisms → cellular organisms → Bacteria | 1130 | Open in IMG/M |
| 3300006797|Ga0066659_10747250 | All Organisms → cellular organisms → Bacteria | 804 | Open in IMG/M |
| 3300006844|Ga0075428_100896023 | All Organisms → cellular organisms → Bacteria | 941 | Open in IMG/M |
| 3300006846|Ga0075430_100293521 | All Organisms → cellular organisms → Bacteria | 1345 | Open in IMG/M |
| 3300006852|Ga0075433_11151685 | All Organisms → cellular organisms → Bacteria | 674 | Open in IMG/M |
| 3300006854|Ga0075425_102573843 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300006871|Ga0075434_100367122 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1460 | Open in IMG/M |
| 3300006880|Ga0075429_100016952 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 6302 | Open in IMG/M |
| 3300006904|Ga0075424_102048521 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
| 3300006904|Ga0075424_102218655 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
| 3300007076|Ga0075435_100805986 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 818 | Open in IMG/M |
| 3300007076|Ga0075435_101817033 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 535 | Open in IMG/M |
| 3300009012|Ga0066710_100149255 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 3247 | Open in IMG/M |
| 3300009100|Ga0075418_11408965 | All Organisms → cellular organisms → Bacteria | 756 | Open in IMG/M |
| 3300009156|Ga0111538_13346516 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 557 | Open in IMG/M |
| 3300010046|Ga0126384_10020581 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4254 | Open in IMG/M |
| 3300010320|Ga0134109_10074264 | Not Available | 1156 | Open in IMG/M |
| 3300010358|Ga0126370_11722244 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
| 3300010362|Ga0126377_12312874 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 613 | Open in IMG/M |
| 3300010366|Ga0126379_10363827 | All Organisms → cellular organisms → Bacteria | 1482 | Open in IMG/M |
| 3300010366|Ga0126379_13623905 | Not Available | 517 | Open in IMG/M |
| 3300010376|Ga0126381_104169464 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
| 3300010398|Ga0126383_11126013 | All Organisms → cellular organisms → Bacteria | 874 | Open in IMG/M |
| 3300010868|Ga0124844_1162464 | All Organisms → cellular organisms → Bacteria | 838 | Open in IMG/M |
| 3300010868|Ga0124844_1162465 | All Organisms → cellular organisms → Bacteria | 838 | Open in IMG/M |
| 3300010868|Ga0124844_1164015 | All Organisms → cellular organisms → Bacteria | 833 | Open in IMG/M |
| 3300010868|Ga0124844_1164017 | All Organisms → cellular organisms → Bacteria | 833 | Open in IMG/M |
| 3300012096|Ga0137389_11258990 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
| 3300012200|Ga0137382_10576760 | Not Available | 802 | Open in IMG/M |
| 3300012203|Ga0137399_11485739 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 565 | Open in IMG/M |
| 3300012205|Ga0137362_11121057 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 668 | Open in IMG/M |
| 3300012206|Ga0137380_10782213 | All Organisms → cellular organisms → Bacteria | 825 | Open in IMG/M |
| 3300012206|Ga0137380_11295210 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
| 3300012209|Ga0137379_10525139 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1091 | Open in IMG/M |
| 3300012209|Ga0137379_10791320 | Not Available | 853 | Open in IMG/M |
| 3300012209|Ga0137379_11243755 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
| 3300012349|Ga0137387_10205258 | All Organisms → cellular organisms → Bacteria | 1416 | Open in IMG/M |
| 3300012349|Ga0137387_10600571 | Not Available | 798 | Open in IMG/M |
| 3300012351|Ga0137386_10505642 | All Organisms → cellular organisms → Bacteria | 870 | Open in IMG/M |
| 3300012353|Ga0137367_10158234 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1651 | Open in IMG/M |
| 3300012362|Ga0137361_10762026 | All Organisms → cellular organisms → Bacteria | 882 | Open in IMG/M |
| 3300012582|Ga0137358_10650698 | All Organisms → cellular organisms → Bacteria | 705 | Open in IMG/M |
| 3300012917|Ga0137395_10861049 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 656 | Open in IMG/M |
| 3300012922|Ga0137394_10808009 | Not Available | 786 | Open in IMG/M |
| 3300012923|Ga0137359_11072453 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 690 | Open in IMG/M |
| 3300012929|Ga0137404_10013103 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 5800 | Open in IMG/M |
| 3300012948|Ga0126375_11590380 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 562 | Open in IMG/M |
| 3300012972|Ga0134077_10555788 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 515 | Open in IMG/M |
| 3300012977|Ga0134087_10795709 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 511 | Open in IMG/M |
| 3300014154|Ga0134075_10015846 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2956 | Open in IMG/M |
| 3300015053|Ga0137405_1373066 | All Organisms → cellular organisms → Bacteria | 2259 | Open in IMG/M |
| 3300015264|Ga0137403_10869900 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 752 | Open in IMG/M |
| 3300015372|Ga0132256_101199880 | All Organisms → cellular organisms → Bacteria | 872 | Open in IMG/M |
| 3300018431|Ga0066655_10073378 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1841 | Open in IMG/M |
| 3300018431|Ga0066655_11140316 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 548 | Open in IMG/M |
| 3300018433|Ga0066667_11120532 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
| 3300018468|Ga0066662_10017524 | All Organisms → cellular organisms → Bacteria | 3924 | Open in IMG/M |
| 3300018482|Ga0066669_10072239 | All Organisms → cellular organisms → Bacteria | 2285 | Open in IMG/M |
| 3300018482|Ga0066669_10377456 | All Organisms → cellular organisms → Bacteria | 1190 | Open in IMG/M |
| 3300024330|Ga0137417_1392033 | All Organisms → cellular organisms → Bacteria | 1359 | Open in IMG/M |
| 3300025911|Ga0207654_10847381 | All Organisms → cellular organisms → Bacteria | 661 | Open in IMG/M |
| 3300025934|Ga0207686_10139630 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1673 | Open in IMG/M |
| 3300025981|Ga0207640_12160115 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300026295|Ga0209234_1029715 | All Organisms → cellular organisms → Bacteria | 2073 | Open in IMG/M |
| 3300026296|Ga0209235_1138056 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 994 | Open in IMG/M |
| 3300026306|Ga0209468_1093024 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 986 | Open in IMG/M |
| 3300026315|Ga0209686_1085076 | All Organisms → cellular organisms → Bacteria | 1114 | Open in IMG/M |
| 3300026318|Ga0209471_1050702 | All Organisms → cellular organisms → Bacteria | 1929 | Open in IMG/M |
| 3300026326|Ga0209801_1032336 | All Organisms → cellular organisms → Bacteria | 2470 | Open in IMG/M |
| 3300026330|Ga0209473_1154086 | Not Available | 927 | Open in IMG/M |
| 3300026332|Ga0209803_1240051 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 630 | Open in IMG/M |
| 3300026529|Ga0209806_1088348 | All Organisms → cellular organisms → Bacteria | 1352 | Open in IMG/M |
| 3300026537|Ga0209157_1016275 | All Organisms → cellular organisms → Bacteria | 4751 | Open in IMG/M |
| 3300026538|Ga0209056_10003565 | All Organisms → cellular organisms → Bacteria | 16538 | Open in IMG/M |
| 3300026538|Ga0209056_10156831 | All Organisms → cellular organisms → Bacteria | 1732 | Open in IMG/M |
| 3300027654|Ga0209799_1076685 | Not Available | 753 | Open in IMG/M |
| 3300027765|Ga0209073_10202333 | All Organisms → cellular organisms → Bacteria | 755 | Open in IMG/M |
| 3300027862|Ga0209701_10579774 | Not Available | 598 | Open in IMG/M |
| 3300027874|Ga0209465_10011308 | All Organisms → cellular organisms → Bacteria | 3964 | Open in IMG/M |
| 3300028828|Ga0307312_10459374 | All Organisms → cellular organisms → Bacteria | 839 | Open in IMG/M |
| 3300028878|Ga0307278_10230115 | All Organisms → cellular organisms → Bacteria | 824 | Open in IMG/M |
| 3300031170|Ga0307498_10439458 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 521 | Open in IMG/M |
| 3300031562|Ga0310886_10797135 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
| 3300031720|Ga0307469_12534345 | Not Available | 501 | Open in IMG/M |
| 3300031736|Ga0318501_10278990 | All Organisms → cellular organisms → Bacteria | 889 | Open in IMG/M |
| 3300031740|Ga0307468_100033533 | All Organisms → cellular organisms → Bacteria | 2483 | Open in IMG/M |
| 3300031794|Ga0318503_10153059 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 744 | Open in IMG/M |
| 3300031820|Ga0307473_10193260 | All Organisms → cellular organisms → Bacteria | 1201 | Open in IMG/M |
| 3300031820|Ga0307473_10259944 | All Organisms → cellular organisms → Bacteria | 1070 | Open in IMG/M |
| 3300031913|Ga0310891_10247428 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 615 | Open in IMG/M |
| 3300032001|Ga0306922_11215835 | All Organisms → cellular organisms → Bacteria | 766 | Open in IMG/M |
| 3300032013|Ga0310906_10899272 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 631 | Open in IMG/M |
| 3300032067|Ga0318524_10358283 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 758 | Open in IMG/M |
| 3300032122|Ga0310895_10592908 | Not Available | 567 | Open in IMG/M |
| 3300032174|Ga0307470_10550484 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 853 | Open in IMG/M |
| 3300032180|Ga0307471_101190293 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 926 | Open in IMG/M |
| 3300032205|Ga0307472_102633885 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 513 | Open in IMG/M |
| 3300032211|Ga0310896_10279134 | All Organisms → cellular organisms → Bacteria | 856 | Open in IMG/M |
| 3300032261|Ga0306920_102843909 | All Organisms → cellular organisms → Bacteria | 658 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 22.56% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 17.29% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 10.53% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 9.77% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 7.52% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 6.02% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 5.26% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 3.76% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 3.01% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.26% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.26% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.26% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.50% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.75% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.75% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.75% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.75% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.75% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.75% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.75% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.75% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000363 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm | Environmental | Open in IMG/M |
| 3300004268 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006058 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Host-Associated | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010868 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (PacBio error correction) | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
| 3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026295 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026296 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026306 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 (SPAdes) | Environmental | Open in IMG/M |
| 3300026315 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 (SPAdes) | Environmental | Open in IMG/M |
| 3300026318 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes) | Environmental | Open in IMG/M |
| 3300026326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes) | Environmental | Open in IMG/M |
| 3300026330 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes) | Environmental | Open in IMG/M |
| 3300026332 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes) | Environmental | Open in IMG/M |
| 3300026529 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes) | Environmental | Open in IMG/M |
| 3300026537 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 (SPAdes) | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300027654 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
| 3300031170 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_S | Environmental | Open in IMG/M |
| 3300031562 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031794 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f23 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031913 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D4 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032013 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3 | Environmental | Open in IMG/M |
| 3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
| 3300032122 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D4 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032211 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| ICChiseqgaiiFebDRAFT_145155224 | 3300000363 | Soil | DQGGTNIGFSKDGKTAFIAVTGANSVAVVDVQKLALESQIKAGKEPQGLIVR* |
| INPhiseqgaiiFebDRAFT_1019220142 | 3300000364 | Soil | IGFSKDGKTAFIAVTGANSVAVVDVQKLALESQIKAGKEPQGLIVR* |
| JGI10216J12902_1124702632 | 3300000956 | Soil | VKRLTIGQGGSNIGFSQDGRTAFIAVRGANEVAVIDIAKLALASRITAGTEPQGLIVR* |
| JGI25383J37093_100948462 | 3300002560 | Grasslands Soil | VRFIYGQSNKRVNIGEGGANIGFSKDGKTAFIALTGANAVAVIDVDKLTLISQIKAGKQPQGLIVW* |
| Ga0066398_101039632 | 3300004268 | Tropical Forest Soil | GANIGFSKDGKTAFIAVRGTNEVAVIDIARLALESRIRAGTEPQGLIVR* |
| Ga0066395_108287242 | 3300004633 | Tropical Forest Soil | GKTAFIAVTGANTVAVVDVAKLALETHITAGKEPQGLIVR* |
| Ga0066683_101796591 | 3300005172 | Soil | GQGGTNIGFSKDGKTAFIAVTGANSVAVIDVQKLALESQIKAGKEPQGLIVR* |
| Ga0066688_101752142 | 3300005178 | Soil | VRFIYGQSNKRVNIGEGGANIGFSKDGKTAFIALTGANAVAVIDVDKLTLISQIKAGKQPQGLIVR* |
| Ga0066685_109070921 | 3300005180 | Soil | TIGQGGSNIGFSKDGKTAFIAVRGANDVAVIDIEKLALASRIKAGTEPQGLIVR* |
| Ga0066685_111190941 | 3300005180 | Soil | QGGANIGFSKDGKTAFIAVRGANDVAVIDIATLALATRIRAGTEPQGLIVR* |
| Ga0066388_1032017872 | 3300005332 | Tropical Forest Soil | NIGFSKDGKTAFIAVRGANDVAVIDIEKLALASRIKAGTEPQGLIVR* |
| Ga0066388_1042808122 | 3300005332 | Tropical Forest Soil | GKTAFIAVTGANSVAVIDTEVAFERRIEAGQEPQGLIVR* |
| Ga0066388_1048576372 | 3300005332 | Tropical Forest Soil | NIGFSKDGRTAFIAVRGANDVAVIDIEKLALAGRIRAGTEPQGLIVR* |
| Ga0070708_1022601561 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | QGGSNIGFSKDGKTAFIAVRGANDVAVIDMEKLALASRIKAGTEPQGLIVR* |
| Ga0066686_105608702 | 3300005446 | Soil | TIGQGGTNIGFSKDGKTAFIAVTGANSVAVVDVQKLALESQIRAGREPQGLIVR* |
| Ga0070706_1020778861 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | IGPGGSNIGFSKDGRTGFIAVTGANAVAVIDVAKLALAGLVQAGAAPQGLIVR* |
| Ga0073909_104910362 | 3300005526 | Surface Soil | TNIGFSKDGKTAFIAVTGANSVAVVDVQKLALESQIKAGKEPQGLIVR* |
| Ga0070696_1008334972 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | GKTAFIAVRGTNEVAVIDIAKLALESRIRAGTEPQGLIVR* |
| Ga0066701_101070404 | 3300005552 | Soil | FIAVRGANDVAVIDIEKLVLAGRIRAGTEPQGLIVR* |
| Ga0066692_101041481 | 3300005555 | Soil | LPFWTERLVRFIYGQSNKRVNIGEGGANIGFSKDGKTAFIALTGANAVAVIDVDKLTLISQIKAGKQPQGLIVW* |
| Ga0066700_107941781 | 3300005559 | Soil | IGFSKDGKTAFIAVTGANSVAVVDVQKLALESQIRAGREPQGLIVR* |
| Ga0066700_109596272 | 3300005559 | Soil | DGKTAFIAVRGANDVAVIDIEKLALATRIKAGTEPQGLIVR* |
| Ga0066670_108358792 | 3300005560 | Soil | RTFKEVKRLTIGEGGANIGFSRDGRTAFIAVRGANDVAVIDVGKLALASRIRAGTEPQGLIVR* |
| Ga0066699_108414282 | 3300005561 | Soil | QGGANIGFSKDGKTAFIAVRGTNDVAVIDIATLALATRIKAGTEPQGLIVR* |
| Ga0066699_108855042 | 3300005561 | Soil | GFSRDGKTAFIAVRGANDVAVIDIENLALATRIRAGTEPQGLIVR* |
| Ga0066691_100338045 | 3300005586 | Soil | VRFIYGQSNKRVNIGEGGANIGFSKDGKTAFIALTGANAVAVIDVDKLTLISQIKAGKQPPGLIVR* |
| Ga0066706_102144121 | 3300005598 | Soil | FSKDGKTAFIAVRGANEVAVIDLDKLTLASRITAGTEPQGLIVR* |
| Ga0066905_1020168491 | 3300005713 | Tropical Forest Soil | AFVAVTGANRVAVIDVAKLAIESQIRAGTEPQGLIVR* |
| Ga0068866_106542701 | 3300005718 | Miscanthus Rhizosphere | LTIGQGGTNIGFSRDGRTAFIAVRGANEVAVIDVAKLALASRIKAGTEPQGLIVR* |
| Ga0066903_1091579391 | 3300005764 | Tropical Forest Soil | VKRVNIGQGGSNLGFSKDGKTAFIALTGADAVAVIDVAKLTLISQIKAGQQPQGLIVR* |
| Ga0075417_101187222 | 3300006049 | Populus Rhizosphere | GKTAFIAVRGANEVAVIDMENLALVSRIRAGKEPQGLIVR* |
| Ga0075432_102154522 | 3300006058 | Populus Rhizosphere | GGTNIGFSKDGKTAFIAVRGTNEVAVIDIATLALESRLRAGTEPQGLIVR* |
| Ga0066658_105898221 | 3300006794 | Soil | GTNIGFSKDGKTAFIAVTGANSVAVVDVQKLALESQIRAGREPQGLIVR* |
| Ga0066665_116637752 | 3300006796 | Soil | KDGKTAFIAVTGADTVAVVDVEKLALESQIKAGKEPQGLIVR* |
| Ga0066659_103608373 | 3300006797 | Soil | FIYGQSNKRVNIGEGGANIGFSKDGKTAFIALTGANAVAVIDVDKLTLISQIKAGKQPQGLIVW* |
| Ga0066659_107472503 | 3300006797 | Soil | DGKTAFIAVRGANDVAVIDIEKLVLASRIRAGTEPQGLIVR* |
| Ga0075428_1008960232 | 3300006844 | Populus Rhizosphere | NIGFSKDGKTAFIAVRGANDVAVIDMEKLALASRIKAGTEPQGLIVR* |
| Ga0075430_1002935211 | 3300006846 | Populus Rhizosphere | TFKEVKRLTIGLGGTNIGFGKDGRTAFIAVRGTNEVAVIDIDRLALESRIRAGTEPQGLIVR* |
| Ga0075433_111516851 | 3300006852 | Populus Rhizosphere | NIGFSKDGKTAFIAVRGTNDVAVIDLARLALESRIRAGTEPQGLIVR* |
| Ga0075425_1025738431 | 3300006854 | Populus Rhizosphere | VKRLTIGLGGTNIGFSKDGKTAFIAVRGTNEVAVIDIATLALESRLRAGTEPQGLIVR* |
| Ga0075434_1003671223 | 3300006871 | Populus Rhizosphere | IAVRGANEVAVIDLVKLTLESRIRAGTEPQGLIVR* |
| Ga0075429_1000169521 | 3300006880 | Populus Rhizosphere | GSNIGFSKDGKTAFIAVRGANEVAVIDMETLALVSRIRAGKEPQGLIVR* |
| Ga0075424_1020485211 | 3300006904 | Populus Rhizosphere | AVRGTNEVAVIDIATLALESRLRAGTEPQGLIVR* |
| Ga0075424_1022186552 | 3300006904 | Populus Rhizosphere | RLTIGLGGTNIGFSKDGKTAFIAVRGANEVAVIDIATLALESRLRAGMEPQGLIVR* |
| Ga0075435_1008059861 | 3300007076 | Populus Rhizosphere | FIAVRGANEVAVIDLVKLTLESRIRAGTEPQGLIVR* |
| Ga0075435_1018170332 | 3300007076 | Populus Rhizosphere | AVRGANDVAVIDIEKLTLTSRIKAGTEPQGLIVR* |
| Ga0066710_1001492555 | 3300009012 | Grasslands Soil | DGKTAFIAVRGANDVAVIDIEKLALASRIKAGTEPQGLIVR |
| Ga0075418_114089651 | 3300009100 | Populus Rhizosphere | RTYKEVKRLAIGPGGTNIGFSKDGHTAFIAVTGANRVAVVDMRKLALESSIRAGKDPQGLIVR* |
| Ga0111538_133465162 | 3300009156 | Populus Rhizosphere | GFSKDGKTAFIAVTGANSVAVVDVQKLALESRIKAGNEPQGLIVR* |
| Ga0126384_100205817 | 3300010046 | Tropical Forest Soil | LTIGQGGANIGFSKDGRTAFIAVRGANEVAVIDVDRLALGQRIRAGKEPQGLIVR* |
| Ga0134109_100742641 | 3300010320 | Grasslands Soil | KTAFIAVRGANDVAVIDIEKLVLAGRIRAGTEPQGLIVR* |
| Ga0126370_117222441 | 3300010358 | Tropical Forest Soil | RTAFIAVRGANDVAVIDVQKLALVGRIRAGTEPQGLIVR* |
| Ga0126377_123128742 | 3300010362 | Tropical Forest Soil | LGGSNIGFTKDGKTAFIAVRGTNSVAVIDVEKFAVVGHVKAGQEPQGLIVR* |
| Ga0126379_103638271 | 3300010366 | Tropical Forest Soil | QGGANIGFSKDGRTAFIAVRGANEVAVIDVDRLALGQRIRAGKEPQGLIVR* |
| Ga0126379_136239051 | 3300010366 | Tropical Forest Soil | AFIAVRGANEVAVIDVDRLALAQRIRAGKEPQGLIVR* |
| Ga0126381_1041694641 | 3300010376 | Tropical Forest Soil | IAVRGANDVAVIDVQKLALVGRIRAGTEPQGLIVR* |
| Ga0126383_111260131 | 3300010398 | Tropical Forest Soil | KDGKTAFIAVRGANDVAVIDMEKLAVPSRIKAGTEPQGLIVR* |
| Ga0124844_11624641 | 3300010868 | Tropical Forest Soil | GTTAFIAVRGANEVAVIDLATLTLASRIRAGTEPQGLIVR* |
| Ga0124844_11624651 | 3300010868 | Tropical Forest Soil | SKDGTTAFIAVRGANEVAVIDLATLTLASRIRAGTEPQGLIVR* |
| Ga0124844_11640152 | 3300010868 | Tropical Forest Soil | FSKDGTTAFIAVRGANEVAVIDLATLTLASRIRAGTEPQGLIVR* |
| Ga0124844_11640171 | 3300010868 | Tropical Forest Soil | KDGTTAFIAVRGANEVAVIDLATLTLASRIRAGTEPQGLIVR* |
| Ga0137389_112589901 | 3300012096 | Vadose Zone Soil | KTGFVALTGANAVAVIDVQKLALVSQMKAGKEPQGLIVR* |
| Ga0137382_105767601 | 3300012200 | Vadose Zone Soil | DGRTAFIAVRGANDVAVIDVGTLALASRIRAGTEPQGLIVR* |
| Ga0137399_114857392 | 3300012203 | Vadose Zone Soil | TNIGFSKDGKTAFIAVTGANSVAVVDVQKLALESHIKAGKEPQGLIVR* |
| Ga0137362_111210571 | 3300012205 | Vadose Zone Soil | QGGTNIGFSKDGKVAFIAVTGANSVAVVDVQTLALESRIKAGKEPQGLIVR* |
| Ga0137380_107822131 | 3300012206 | Vadose Zone Soil | IGFSRDGKTAFIAVRGTNDVAVIDIEKLALASRIRAGTEPQGLIVR* |
| Ga0137380_112952102 | 3300012206 | Vadose Zone Soil | LARAGPNIGFSKDGKTAFIAVTGANAVAVIDIEKLALASQIQAGAAPQGLIVR* |
| Ga0137379_105251391 | 3300012209 | Vadose Zone Soil | KDGKTAFIAVTGANTVAVIDVQQLALASRIKAGKEPQGLIVR* |
| Ga0137379_107913201 | 3300012209 | Vadose Zone Soil | NVGFSKDGKTAFIAVTGANAVAVIDVEKLALARQIQAGAAPQGLIVR* |
| Ga0137379_112437551 | 3300012209 | Vadose Zone Soil | AFIAVRGANDVAVIDVEKLALASRISAGTEPQGLIVR* |
| Ga0137387_102052582 | 3300012349 | Vadose Zone Soil | KTAFIAVRGTNDVAVIDIEKLALASRIRAGTEPQGLIVR* |
| Ga0137387_106005711 | 3300012349 | Vadose Zone Soil | TAFIAVTGANAVAVIDIEKLALASQIQAGAAPQGLIVR* |
| Ga0137386_105056422 | 3300012351 | Vadose Zone Soil | DGKTAFIAVRGANDVAVIDIEKLVLAGRIRAGTEPQGLIVR* |
| Ga0137367_101582341 | 3300012353 | Vadose Zone Soil | TAFIAMTRADAVVVIDVEKLALASQITAGKAPQGLIVR* |
| Ga0137361_107620263 | 3300012362 | Vadose Zone Soil | AFIAVTGANSVAVIDVQKLALESQIKAGKEPQGLIVR* |
| Ga0137358_106506981 | 3300012582 | Vadose Zone Soil | VNIGEGGANIGFSKDGKTAFIALTGANAVAAIDVDKLTLISQIKAGKQPPGLIVR* |
| Ga0137395_108610491 | 3300012917 | Vadose Zone Soil | SRDGRTAFIAVRGANDVAVIDVGKLALASRIRAGTEPQGLIVR* |
| Ga0137394_108080092 | 3300012922 | Vadose Zone Soil | QGGANIGFSRDGKTAFIAVRGTNEVAVVDIENFALESRIRAGTEPQGLIVR* |
| Ga0137359_110724533 | 3300012923 | Vadose Zone Soil | IAVTGANSVAVVDVQKLALESHIKAGKEPQGLIVR* |
| Ga0137404_100131031 | 3300012929 | Vadose Zone Soil | AFIAVTGANAVAVIDVEKLALARQIQAGAAPQGLIVR* |
| Ga0126375_115903802 | 3300012948 | Tropical Forest Soil | TIGPGGTNIGFSKDGKTAFVAVTGANRVAVIDVAKLAIESQIRAGTEPQGLIVR* |
| Ga0134077_105557881 | 3300012972 | Grasslands Soil | SKDGKTAFIAVRGANDVAVIDIEKLALASRIKAGTEPQGLIVR* |
| Ga0134087_107957091 | 3300012977 | Grasslands Soil | VKRLTIGEGGSNIGFSRDGRTAFIAVRGANDVAVIDVGKLALASRIRAGTEPQGLIVR* |
| Ga0134075_100158466 | 3300014154 | Grasslands Soil | IGQGGANIGFSRDGKTAFIAVRGANDVAVIDIEKLVLASRIRAGTEPQGLIVR* |
| Ga0137405_13730665 | 3300015053 | Vadose Zone Soil | KTAFIAVRGTNEVAVVDIENFALESRIRAGTEPQGLIVR* |
| Ga0137403_108699002 | 3300015264 | Vadose Zone Soil | GGSNIGFSRDGRTAFIAVRGANDVAVIDVGKLALASRIRAGTEPQGLIVR* |
| Ga0132256_1011998802 | 3300015372 | Arabidopsis Rhizosphere | GFSRDGRTAFIAVRGMNEVAVIDVATLALAGRIKAGTEPQGLIVR* |
| Ga0066655_100733781 | 3300018431 | Grasslands Soil | CQSINAGKFKEGKRLTIVQGGTNIGFRKDGKTAFIAVTGADTVAVVDVEKLALESQIKAGKEPQGLIVR |
| Ga0066655_111403161 | 3300018431 | Grasslands Soil | RDGRTAFIAVRGANDVAVIDVGKLALASRIRAGTEPQGLIVR |
| Ga0066667_111205321 | 3300018433 | Grasslands Soil | TAFIAVRGANDVAVIDIEKLVLAGRIRAGTEPQGLIVR |
| Ga0066662_100175244 | 3300018468 | Grasslands Soil | VRFIYGQSNKRVNIGEGGANIGFSKDGKTAFIALTGANAVAVIDVDKLTLISQIKAGKQPQGLIVR |
| Ga0066669_100722394 | 3300018482 | Grasslands Soil | TIGQGGTNIGFSKDGKTAFIAVTGANSVAVIDVQKLALESQIKAGKEPQGLIVR |
| Ga0066669_103774561 | 3300018482 | Grasslands Soil | DGKTAFIAVRGANEVAVIDLDKLTLASRITAGTEPQGLIVR |
| Ga0137417_13920332 | 3300024330 | Vadose Zone Soil | MVQQDGKTAFIAVRGANDVVVIDIEKLVLAGRIRAGTEPQGLIVR |
| Ga0207654_108473811 | 3300025911 | Corn Rhizosphere | FSQDGRTAFIAVRGANEVAVIDVDRLALAKRIKAGKEPQGLIVR |
| Ga0207686_101396302 | 3300025934 | Miscanthus Rhizosphere | RTFTEVKRLTIGPGGTNIGFSRDGRTAFIAVRGANEVAVIDVAKLALAGRIKAGTEPQGLIVR |
| Ga0207640_121601151 | 3300025981 | Corn Rhizosphere | GFSRDGRTAFIAVRGANDVAVIDVAKLALAGRIKAGTEPQGLIVR |
| Ga0209234_10297151 | 3300026295 | Grasslands Soil | NIGFSRDGRTAFIAVRGANDVAVIDVGTLALASRIRAGTEPQGLIVR |
| Ga0209235_11380562 | 3300026296 | Grasslands Soil | VRFIYGQSNKRVNIGEGGANIGFSKDGKTAFIALTGANAVAVIDVDKLTLISQIKAGKQPQGLIVW |
| Ga0209468_10930241 | 3300026306 | Soil | KDGKTAFIAVRGANDVAVIDIEKLALATRIKAGTEPQGLIVR |
| Ga0209686_10850761 | 3300026315 | Soil | GEGGANIGFSRDGRTAFIAVRGANDVAVIDVGKLALASRIRAGTEPQGLIIR |
| Ga0209471_10507023 | 3300026318 | Soil | LTIGEGGANIGFSRDGRTAFIAVRGANDVAVIDVGTLALASRIRAGTEPQGLIVR |
| Ga0209801_10323363 | 3300026326 | Soil | TVGQGGSNIGFSKDGKTAFIAVRGANDVAVIDIEKLALATRIKAGTEPQGLIVR |
| Ga0209473_11540861 | 3300026330 | Soil | RLTIGEGGANIGFSRDGRTAFIAVRGANDVAVIDVGTLALASRIRAGTEPQGLIVR |
| Ga0209803_12400512 | 3300026332 | Soil | KTAFIAVTGANTVAVIDVQQLALASRIKAGKEPQGLIVR |
| Ga0209806_10883482 | 3300026529 | Soil | GEGGSNIGFSRDGRTAFIAVRGANDVAVIDVGTLALASRIRAGTEPQGLIVR |
| Ga0209157_10162751 | 3300026537 | Soil | IAVRGANDVAVIDIEKLALATRIKAGTEPQGLIVR |
| Ga0209056_1000356519 | 3300026538 | Soil | VRFIYGLSNKRVNIGEGGANIGFSKDGKTAFIALTGANAVAVIDVDKLTLISQIKAGKQPQGLIVW |
| Ga0209056_101568311 | 3300026538 | Soil | KTAFIAVRGANDVAVIDIEKLALANRIKAGTEPQGLIVR |
| Ga0209799_10766852 | 3300027654 | Tropical Forest Soil | IAVRGANEVAVIDLATLALASRIRAGTEPQGLIVR |
| Ga0209073_102023332 | 3300027765 | Agricultural Soil | AIGPGGSNIGFSKDGRTAFIALSGANAVAVIDVKKLAPAGQIRTGVAPQGLIVR |
| Ga0209701_105797741 | 3300027862 | Vadose Zone Soil | IGSGGSNIGFSKDGKTAFIAVREADAVAVIDVEKLALASQITAGKAPQGLIVR |
| Ga0209465_100113081 | 3300027874 | Tropical Forest Soil | GPGGTNIGFSKDGKTAFIAVTGANTVAVIDLPKWALEMQIKAGKEPQGLIVR |
| Ga0307312_104593741 | 3300028828 | Soil | GKTAFIAVRGANAVAVIDIEKLALASRIRAGTEPQGLIVR |
| Ga0307278_102301152 | 3300028878 | Soil | KTAFIAVRGANDVAVIDIEKLRLASRIRAGTEPQGLIVR |
| Ga0307498_104394581 | 3300031170 | Soil | DGKTAFIAVTGANSVAVVDVQKLALEGQIKAGKEPQGLIVG |
| Ga0310886_107971352 | 3300031562 | Soil | RLTIGQGGTNIGFSQDGRTAFIAVRGANEVAVIDVDRLALAKRIKAGKEPQGLIVR |
| Ga0307469_125343451 | 3300031720 | Hardwood Forest Soil | GFSKDGKTAFVAVRGANDVAVIDVEKLTLASRIKAGREPQGLIVR |
| Ga0318501_102789901 | 3300031736 | Soil | LTIGLGGTNIGFSKDGKTAFIAVTGANAVAVVDVAKLALETHITAGKEPQGLIVR |
| Ga0307468_1000335331 | 3300031740 | Hardwood Forest Soil | TAFIALRDANAVAVVDMQKLAFEGRIAAGKEPQGLIVR |
| Ga0318503_101530591 | 3300031794 | Soil | GKTAFVAVTGANRVAVIDVAKLALESQIRAGTEPQGLIVR |
| Ga0307473_101932601 | 3300031820 | Hardwood Forest Soil | IGFSKDGKTAFIAVRGANDVAVIDIEKLALATRIKAGTEPQGLIVR |
| Ga0307473_102599442 | 3300031820 | Hardwood Forest Soil | AFIALTGANAVAVIDMETLAPAGQIRAGAAPQGLIVR |
| Ga0310891_102474282 | 3300031913 | Soil | TIGQGGTNIGFSKDGKTAFIAVTGANSVAVVDVQKLTLESRIQAGKEPQGLIVR |
| Ga0306922_112158352 | 3300032001 | Soil | SKDGKTAFIAVTGANTVAVVDVAKLALETHITAGKEPQGLIVR |
| Ga0310906_108992721 | 3300032013 | Soil | QGGTNIGFSKDGKTAFIAVTGANSVAVVDVQKLTLESRIQAGKEPQGLIVR |
| Ga0318524_103582831 | 3300032067 | Soil | TAFVAVTGANRVAVIDVAKLALESQIRAGTEPQGLIVR |
| Ga0310895_105929082 | 3300032122 | Soil | FIAVRGANEVVVIDVDRLALAKRIKAGKEPQGLIVR |
| Ga0307470_105504842 | 3300032174 | Hardwood Forest Soil | FIAVRGANDVAVIDMEKLALASRIKAGTEPQGLIVR |
| Ga0307471_1011902931 | 3300032180 | Hardwood Forest Soil | GKTAFIAVRGANDVAVIDIEKLALTSRIKAGTEPQGLIVR |
| Ga0307472_1026338851 | 3300032205 | Hardwood Forest Soil | AFIAVRGANDVAVIDVDKLALASRIRAGTEPQGLIVR |
| Ga0310896_102791341 | 3300032211 | Soil | TIGQGGTNIGFSQDGRTAFIAVRGANEVAVIDVDRLALAKRIKAGKEPQGLIVR |
| Ga0306920_1028439091 | 3300032261 | Soil | FSKDGKTAFIAVRGANDVAVIDMEKLALASRIKAGTEPQGLIVR |
| ⦗Top⦘ |