


| Basic Information | |
|---|---|
| Family ID | F059812 |
| Family Type | Metagenome |
| Number of Sequences | 133 |
| Average Sequence Length | 43 residues |
| Representative Sequence | VVQRVVEQNEPLRTVAAAYGVSHETIRRILLHVQKLRGQQEA |
| Number of Associated Samples | 81 |
| Number of Associated Scaffolds | 133 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 6.11 % |
| % of genes near scaffold ends (potentially truncated) | 64.66 % |
| % of genes from short scaffolds (< 2000 bps) | 81.20 % |
| Associated GOLD sequencing projects | 75 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.53 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (93.985 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (30.827 % of family members) |
| Environment Ontology (ENVO) | Unclassified (40.602 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (54.887 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 44.29% β-sheet: 0.00% Coil/Unstructured: 55.71% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.53 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 133 Family Scaffolds |
|---|---|---|
| PF05685 | Uma2 | 3.01 |
| PF13518 | HTH_28 | 2.26 |
| PF13683 | rve_3 | 2.26 |
| PF00400 | WD40 | 1.50 |
| PF01326 | PPDK_N | 1.50 |
| PF00171 | Aldedh | 1.50 |
| PF00216 | Bac_DNA_binding | 1.50 |
| PF00072 | Response_reg | 0.75 |
| PF00106 | adh_short | 0.75 |
| PF00196 | GerE | 0.75 |
| PF00491 | Arginase | 0.75 |
| PF00903 | Glyoxalase | 0.75 |
| PF00578 | AhpC-TSA | 0.75 |
| PF01738 | DLH | 0.75 |
| PF15919 | HicB_lk_antitox | 0.75 |
| PF00805 | Pentapeptide | 0.75 |
| PF03534 | SpvB | 0.75 |
| PF00665 | rve | 0.75 |
| PF07929 | PRiA4_ORF3 | 0.75 |
| PF13005 | zf-IS66 | 0.75 |
| PF06897 | DUF1269 | 0.75 |
| PF13655 | RVT_N | 0.75 |
| PF13546 | DDE_5 | 0.75 |
| PF04909 | Amidohydro_2 | 0.75 |
| PF13384 | HTH_23 | 0.75 |
| PF01610 | DDE_Tnp_ISL3 | 0.75 |
| PF12697 | Abhydrolase_6 | 0.75 |
| PF07714 | PK_Tyr_Ser-Thr | 0.75 |
| PF01047 | MarR | 0.75 |
| PF13542 | HTH_Tnp_ISL3 | 0.75 |
| PF02882 | THF_DHG_CYH_C | 0.75 |
| PF01844 | HNH | 0.75 |
| COG ID | Name | Functional Category | % Frequency in 133 Family Scaffolds |
|---|---|---|---|
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 3.01 |
| COG4636 | Endonuclease, Uma2 family (restriction endonuclease fold) | General function prediction only [R] | 3.01 |
| COG0014 | Gamma-glutamyl phosphate reductase | Amino acid transport and metabolism [E] | 1.50 |
| COG0574 | Phosphoenolpyruvate synthase/pyruvate phosphate dikinase | Carbohydrate transport and metabolism [G] | 1.50 |
| COG0776 | Bacterial nucleoid DNA-binding protein IHF-alpha | Replication, recombination and repair [L] | 1.50 |
| COG1012 | Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase | Lipid transport and metabolism [I] | 1.50 |
| COG4230 | Delta 1-pyrroline-5-carboxylate dehydrogenase | Amino acid transport and metabolism [E] | 1.50 |
| COG0010 | Arginase/agmatinase family enzyme | Amino acid transport and metabolism [E] | 0.75 |
| COG0190 | 5,10-methylene-tetrahydrofolate dehydrogenase/Methenyl tetrahydrofolate cyclohydrolase | Coenzyme transport and metabolism [H] | 0.75 |
| COG0686 | Alanine dehydrogenase (includes sporulation protein SpoVN) | Amino acid transport and metabolism [E] | 0.75 |
| COG1357 | Uncharacterized conserved protein YjbI, contains pentapeptide repeats | Function unknown [S] | 0.75 |
| COG2801 | Transposase InsO and inactivated derivatives | Mobilome: prophages, transposons [X] | 0.75 |
| COG2826 | Transposase and inactivated derivatives, IS30 family | Mobilome: prophages, transposons [X] | 0.75 |
| COG3316 | Transposase (or an inactivated derivative), DDE domain | Mobilome: prophages, transposons [X] | 0.75 |
| COG3464 | Transposase | Mobilome: prophages, transposons [X] | 0.75 |
| COG4584 | Transposase | Mobilome: prophages, transposons [X] | 0.75 |
| COG4803 | Uncharacterized membrane protein | Function unknown [S] | 0.75 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 93.98 % |
| Unclassified | root | N/A | 6.02 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002557|JGI25381J37097_1024646 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1045 | Open in IMG/M |
| 3300002915|JGI25387J43893_1012788 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1153 | Open in IMG/M |
| 3300002915|JGI25387J43893_1045113 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 612 | Open in IMG/M |
| 3300005167|Ga0066672_10336807 | All Organisms → cellular organisms → Bacteria | 984 | Open in IMG/M |
| 3300005177|Ga0066690_10877475 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 575 | Open in IMG/M |
| 3300005177|Ga0066690_11020607 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 519 | Open in IMG/M |
| 3300005178|Ga0066688_10622884 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 693 | Open in IMG/M |
| 3300005179|Ga0066684_10285825 | Not Available | 1092 | Open in IMG/M |
| 3300005180|Ga0066685_10795184 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 641 | Open in IMG/M |
| 3300005180|Ga0066685_11161080 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 502 | Open in IMG/M |
| 3300005184|Ga0066671_10190873 | All Organisms → cellular organisms → Bacteria | 1225 | Open in IMG/M |
| 3300005187|Ga0066675_10090856 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1992 | Open in IMG/M |
| 3300005187|Ga0066675_10107162 | All Organisms → cellular organisms → Bacteria | 1855 | Open in IMG/M |
| 3300005187|Ga0066675_10160631 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1550 | Open in IMG/M |
| 3300005187|Ga0066675_10748527 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 736 | Open in IMG/M |
| 3300005434|Ga0070709_11194107 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 611 | Open in IMG/M |
| 3300005446|Ga0066686_10916068 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 575 | Open in IMG/M |
| 3300005467|Ga0070706_100025403 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → Ktedonobacter racemifer | 5451 | Open in IMG/M |
| 3300005468|Ga0070707_101510259 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 638 | Open in IMG/M |
| 3300005471|Ga0070698_100021534 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → Ktedonobacter racemifer | 6752 | Open in IMG/M |
| 3300005471|Ga0070698_100151211 | All Organisms → cellular organisms → Bacteria | 2269 | Open in IMG/M |
| 3300005536|Ga0070697_100979248 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 751 | Open in IMG/M |
| 3300005554|Ga0066661_10406208 | All Organisms → cellular organisms → Bacteria | 834 | Open in IMG/M |
| 3300005554|Ga0066661_10422028 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. 13_2_20CM_2_56_8 | 817 | Open in IMG/M |
| 3300005556|Ga0066707_10149493 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1479 | Open in IMG/M |
| 3300005560|Ga0066670_10589700 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 677 | Open in IMG/M |
| 3300005566|Ga0066693_10415408 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 548 | Open in IMG/M |
| 3300005569|Ga0066705_10493196 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 767 | Open in IMG/M |
| 3300005575|Ga0066702_10071532 | All Organisms → cellular organisms → Bacteria | 1919 | Open in IMG/M |
| 3300005575|Ga0066702_10277625 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_20CM_54_36 | 1022 | Open in IMG/M |
| 3300005575|Ga0066702_10989230 | Not Available | 503 | Open in IMG/M |
| 3300005576|Ga0066708_10568091 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 729 | Open in IMG/M |
| 3300005587|Ga0066654_10275452 | All Organisms → cellular organisms → Bacteria | 894 | Open in IMG/M |
| 3300006032|Ga0066696_10062070 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 2137 | Open in IMG/M |
| 3300006032|Ga0066696_10336028 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 984 | Open in IMG/M |
| 3300006032|Ga0066696_10483042 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 813 | Open in IMG/M |
| 3300006032|Ga0066696_10787629 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_20CM_54_36 | 607 | Open in IMG/M |
| 3300006034|Ga0066656_10347133 | Not Available | 959 | Open in IMG/M |
| 3300006034|Ga0066656_10420333 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 867 | Open in IMG/M |
| 3300006046|Ga0066652_100917024 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 835 | Open in IMG/M |
| 3300006046|Ga0066652_101434617 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 644 | Open in IMG/M |
| 3300006059|Ga0075017_100577479 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_20CM_54_36 | 858 | Open in IMG/M |
| 3300006059|Ga0075017_100844927 | Not Available | 709 | Open in IMG/M |
| 3300006102|Ga0075015_100049593 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1982 | Open in IMG/M |
| 3300006102|Ga0075015_100412795 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 764 | Open in IMG/M |
| 3300006796|Ga0066665_10084730 | All Organisms → cellular organisms → Bacteria | 2287 | Open in IMG/M |
| 3300006800|Ga0066660_10399445 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1134 | Open in IMG/M |
| 3300006804|Ga0079221_11682374 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 516 | Open in IMG/M |
| 3300006854|Ga0075425_101973800 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 653 | Open in IMG/M |
| 3300009012|Ga0066710_100079988 | All Organisms → cellular organisms → Bacteria | 4255 | Open in IMG/M |
| 3300009012|Ga0066710_103583477 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 586 | Open in IMG/M |
| 3300009698|Ga0116216_10789522 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 569 | Open in IMG/M |
| 3300010360|Ga0126372_11970867 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 630 | Open in IMG/M |
| 3300010379|Ga0136449_101462302 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1049 | Open in IMG/M |
| 3300010379|Ga0136449_101852031 | All Organisms → cellular organisms → Bacteria | 900 | Open in IMG/M |
| 3300010398|Ga0126383_12708192 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
| 3300011003|Ga0138514_100139383 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 537 | Open in IMG/M |
| 3300011270|Ga0137391_10856496 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 746 | Open in IMG/M |
| 3300012198|Ga0137364_10253515 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1301 | Open in IMG/M |
| 3300012198|Ga0137364_11238834 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 557 | Open in IMG/M |
| 3300012199|Ga0137383_10003253 | All Organisms → cellular organisms → Bacteria | 10168 | Open in IMG/M |
| 3300012199|Ga0137383_10051011 | All Organisms → cellular organisms → Bacteria | 2957 | Open in IMG/M |
| 3300012199|Ga0137383_10056112 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 2821 | Open in IMG/M |
| 3300012199|Ga0137383_10078299 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 2388 | Open in IMG/M |
| 3300012199|Ga0137383_10086682 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 2266 | Open in IMG/M |
| 3300012199|Ga0137383_10176332 | All Organisms → cellular organisms → Bacteria | 1567 | Open in IMG/M |
| 3300012199|Ga0137383_10317682 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1140 | Open in IMG/M |
| 3300012199|Ga0137383_10416990 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 984 | Open in IMG/M |
| 3300012199|Ga0137383_10474126 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 917 | Open in IMG/M |
| 3300012199|Ga0137383_10569699 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 829 | Open in IMG/M |
| 3300012201|Ga0137365_10023515 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 4774 | Open in IMG/M |
| 3300012201|Ga0137365_10062558 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → Ktedonobacter racemifer | 2810 | Open in IMG/M |
| 3300012201|Ga0137365_10074901 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 2554 | Open in IMG/M |
| 3300012201|Ga0137365_10355836 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1082 | Open in IMG/M |
| 3300012201|Ga0137365_10444961 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 954 | Open in IMG/M |
| 3300012201|Ga0137365_10788134 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 694 | Open in IMG/M |
| 3300012201|Ga0137365_10920096 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 637 | Open in IMG/M |
| 3300012206|Ga0137380_10148434 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 2138 | Open in IMG/M |
| 3300012206|Ga0137380_10806655 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 810 | Open in IMG/M |
| 3300012206|Ga0137380_11396724 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 585 | Open in IMG/M |
| 3300012207|Ga0137381_10460304 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1110 | Open in IMG/M |
| 3300012207|Ga0137381_11127483 | All Organisms → cellular organisms → Bacteria | 675 | Open in IMG/M |
| 3300012208|Ga0137376_10071675 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 2885 | Open in IMG/M |
| 3300012208|Ga0137376_10246063 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1550 | Open in IMG/M |
| 3300012209|Ga0137379_11035828 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 726 | Open in IMG/M |
| 3300012209|Ga0137379_11425837 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
| 3300012209|Ga0137379_11577703 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 556 | Open in IMG/M |
| 3300012210|Ga0137378_10286596 | All Organisms → cellular organisms → Bacteria | 1532 | Open in IMG/M |
| 3300012210|Ga0137378_10359517 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1352 | Open in IMG/M |
| 3300012210|Ga0137378_11108065 | All Organisms → cellular organisms → Bacteria | 706 | Open in IMG/M |
| 3300012211|Ga0137377_10398497 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1314 | Open in IMG/M |
| 3300012354|Ga0137366_10037449 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 3757 | Open in IMG/M |
| 3300012356|Ga0137371_10180926 | Not Available | 1652 | Open in IMG/M |
| 3300012356|Ga0137371_10296441 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1260 | Open in IMG/M |
| 3300012359|Ga0137385_10054068 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 3585 | Open in IMG/M |
| 3300012359|Ga0137385_10098951 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 2586 | Open in IMG/M |
| 3300012359|Ga0137385_11602769 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 515 | Open in IMG/M |
| 3300012971|Ga0126369_11144610 | All Organisms → cellular organisms → Bacteria | 867 | Open in IMG/M |
| 3300012977|Ga0134087_10183479 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 928 | Open in IMG/M |
| 3300012977|Ga0134087_10360683 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 697 | Open in IMG/M |
| 3300012977|Ga0134087_10530388 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 598 | Open in IMG/M |
| 3300015356|Ga0134073_10337862 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 549 | Open in IMG/M |
| 3300017654|Ga0134069_1229217 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 641 | Open in IMG/M |
| 3300017943|Ga0187819_10755474 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 547 | Open in IMG/M |
| 3300017959|Ga0187779_10259061 | All Organisms → cellular organisms → Bacteria | 1103 | Open in IMG/M |
| 3300017959|Ga0187779_10394954 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 901 | Open in IMG/M |
| 3300017961|Ga0187778_10886503 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
| 3300017966|Ga0187776_11147038 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 580 | Open in IMG/M |
| 3300017973|Ga0187780_10555456 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 823 | Open in IMG/M |
| 3300017974|Ga0187777_10073174 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 2224 | Open in IMG/M |
| 3300017974|Ga0187777_10098461 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1919 | Open in IMG/M |
| 3300017995|Ga0187816_10331343 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 671 | Open in IMG/M |
| 3300018058|Ga0187766_10345318 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 973 | Open in IMG/M |
| 3300018433|Ga0066667_10381731 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1132 | Open in IMG/M |
| 3300018468|Ga0066662_10104729 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_20CM_54_36 | 2015 | Open in IMG/M |
| 3300018468|Ga0066662_10836587 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 897 | Open in IMG/M |
| 3300021088|Ga0210404_10208677 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1050 | Open in IMG/M |
| 3300021432|Ga0210384_11438267 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 595 | Open in IMG/M |
| 3300025922|Ga0207646_11276657 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 642 | Open in IMG/M |
| 3300026300|Ga0209027_1100797 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1034 | Open in IMG/M |
| 3300026310|Ga0209239_1023640 | All Organisms → cellular organisms → Bacteria | 3002 | Open in IMG/M |
| 3300026317|Ga0209154_1068150 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1551 | Open in IMG/M |
| 3300026547|Ga0209156_10365831 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 615 | Open in IMG/M |
| 3300026551|Ga0209648_10001040 | All Organisms → cellular organisms → Bacteria | 22216 | Open in IMG/M |
| 3300026552|Ga0209577_10538827 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 752 | Open in IMG/M |
| 3300027875|Ga0209283_10515233 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. | 768 | Open in IMG/M |
| 3300031573|Ga0310915_11196344 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales | 526 | Open in IMG/M |
| 3300031910|Ga0306923_12108393 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 569 | Open in IMG/M |
| 3300032059|Ga0318533_10999257 | Not Available | 614 | Open in IMG/M |
| 3300032160|Ga0311301_11199400 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 973 | Open in IMG/M |
| 3300033289|Ga0310914_10672857 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_20CM_54_36 | 930 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 30.83% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 28.57% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 8.27% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 6.02% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 6.02% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 3.76% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.76% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 3.01% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 3.01% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.26% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.50% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.75% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.75% |
| Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.75% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.75% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm | Environmental | Open in IMG/M |
| 3300002915 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011003 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t9i015 | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015356 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300017654 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026300 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026317 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes) | Environmental | Open in IMG/M |
| 3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI25381J37097_10246462 | 3300002557 | Grasslands Soil | MVLHRVVETNEPLHRVAQESGVWPETIRRLLLHAKPPGEQDA* |
| JGI25387J43893_10127881 | 3300002915 | Grasslands Soil | MVVQRVVEQKEPLRTVAAASGVSHETIRRLLLHLQKPRGQPEA* |
| JGI25387J43893_10451131 | 3300002915 | Grasslands Soil | MIIHRVVENNEPLRAVAQEYGVSPETIRRLMLHVQKQRGRPEA* |
| Ga0066672_103368071 | 3300005167 | Soil | MPRVVENKESLRTVAQEYGVSHETIRRNMLHVQMQRGQQEA* |
| Ga0066690_108774752 | 3300005177 | Soil | MVAQRVVEQKEPLRTVAAAYGVSHETIRRLLLHIHQQHGHQEA* |
| Ga0066690_110206071 | 3300005177 | Soil | MVLHRVMEKKEPLRTVAAAYGVSQETIRRLMLHVQKPRGRQEA* |
| Ga0066688_106228842 | 3300005178 | Soil | YGIPAEHWPMVIHRVVENNEPLRTVAQEYGVSHETIRRLLRHTHQQRGQQEA* |
| Ga0066684_102858252 | 3300005179 | Soil | DQWPAIVHRVVEQKEPFRDVAIADGVSHETIRRMLLQIHQQYGQQEV* |
| Ga0066685_107951841 | 3300005180 | Soil | VQRVVEQNEPLPTVAEASGVSHETIRGIMLAVQKPRGQPEA* |
| Ga0066685_111610801 | 3300005180 | Soil | PTVLRRVVEQKKPLRRVAAASGVSHETIRRILLHVQKQHGQQEA* |
| Ga0066671_101908731 | 3300005184 | Soil | WPTVVQRVVEQKEPLRKVAAAYGISPETIRRLLLPTQKPHGQQEA* |
| Ga0066675_100908561 | 3300005187 | Soil | EHWPLIIHRVVEQKEPLCTVAAAYSVSHETIRRILLHTHQQRGQQEA* |
| Ga0066675_101071621 | 3300005187 | Soil | MHRVVEQKEPLRTVAAAYGVSPETIRRLLLHAQKPHGQQEA* |
| Ga0066675_101606311 | 3300005187 | Soil | MHRVVEKNEPLRRVAAAYGVSHETIRRILLHVQKPRGQQEA* |
| Ga0066675_107485271 | 3300005187 | Soil | PAYSLPTGQWPTVVHRVVEQNEPLPTVAQAYGVSHETIRRLILHAQKPRG* |
| Ga0070709_111941072 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | IPAEHWPMVVHRVLEQKESLRTGAAAYGVSHETIRRIMLHVQKQRGQQEA* |
| Ga0066686_109160681 | 3300005446 | Soil | HRVVEQKEPLRTVAAAYGVSHETIRRLLHTHQQQGQQEA* |
| Ga0070706_1000254034 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MHRVVEQKEPLRTVAAAYGVSHETIRRLLLHMHQQSGQQEA* |
| Ga0070707_1002715853 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MTESRTRCASRGKYDVPTEHWPMVIHRVVENDEPLRKVADEYGLSHETIRRLILHAHQQRGQQEA* |
| Ga0070707_1015102591 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | RVVEQKEPLRTVAAAYGVSHETIRRILLHTHQQCGQQEA* |
| Ga0070698_1000215341 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | TVVHRVMEQKEPLRTVAAAYGVSHETIRRILLHVQQQLGQQEA* |
| Ga0070698_1001512115 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | VVQRVVEQKEPLRTVAAGYGVSHETIRRILLHVQQQRGQQEA* |
| Ga0070697_1009792482 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | IPAEHWPMVIHRVVENNEPLRTVAQEYGVSHETIRRIMLHVQKQRGQPEA* |
| Ga0066695_102498691 | 3300005553 | Soil | MYGIPTSEWPNVVQRVLEQQESLRTVAAAYGVSHETIRRTMLHVRKQAGHQEM* |
| Ga0066661_104062082 | 3300005554 | Soil | PTVVQRVVEQKEPLRKVAAAYGISPETIRRLLLQTQKPHGQQEA* |
| Ga0066661_104220282 | 3300005554 | Soil | SQWPTVVQRVVEQNEPLRRVAAAYGVSHETIRRILLHVQKPRGQQDT* |
| Ga0066707_101494931 | 3300005556 | Soil | VVQRVVEQKEPLRRVAAAYGVSHETIRRILLHVQKRRGQQE |
| Ga0066670_105897001 | 3300005560 | Soil | SEYWPMVIHRVVDQKEPLRTVATAYGVSHETIRRIMLHIQK* |
| Ga0066693_104154082 | 3300005566 | Soil | VVQRVVEQKEPLRRVAAAYGVSHETIRRILLHVQKPRGQQEA |
| Ga0066705_104931961 | 3300005569 | Soil | HRVVEQKEPLRTVAAAYGVSSETIRRILLHVQKPCGQQEG* |
| Ga0066702_100715321 | 3300005575 | Soil | QWPIIMHRVVEQNEPLRTVAADYDVFHEMIRRIVLHVQKQGGQQEA* |
| Ga0066702_102776251 | 3300005575 | Soil | IHRVVENNEPLHAVTQEYGVSHETIRRIMLHVQKQGGQQEA* |
| Ga0066702_109892301 | 3300005575 | Soil | VVQRVVEQKEPLRKVAEEYGVSHETIRRLILHAQKQRGQQEA* |
| Ga0066708_105680912 | 3300005576 | Soil | LHRVVEKKEPLRTVAAAYGVSPETIRRIMLHIQKQGGQKEA* |
| Ga0066654_102754521 | 3300005587 | Soil | VVRRVVEQKEPLHTVAAAYGVSHETIRRLLLHLEKPLGQPEA* |
| Ga0066696_100620704 | 3300006032 | Soil | VLHRVVEQKESLRTVAATYGVSPETIRRLLLQTQKPHGQQE |
| Ga0066696_103360282 | 3300006032 | Soil | VVQRVVEQKEPLRRVAAAYGVSHETIRRILLHVQKRRGQQEV* |
| Ga0066696_104830422 | 3300006032 | Soil | MIMHRVVENNEPLRQVEDTHGVSHKTIRRIILHDQKQRGQQEV* |
| Ga0066696_107876291 | 3300006032 | Soil | PTERWPMIIHRVVENNEPLRAVAQEYGVSPETIRGLILHVQKQRGRPDA* |
| Ga0066656_103471332 | 3300006034 | Soil | VVKNNEPLRAVAAAYGFSHETIRRLLLHAQPRGQPDA* |
| Ga0066656_104203331 | 3300006034 | Soil | VEQKEPLRIVAAAYGVSHETIRRIMLHAHQQRRQQEA* |
| Ga0066652_1009170242 | 3300006046 | Soil | PTVVHRVVEKKEPLRTVAAAYGVSHESIRRILLHAHKQRGL* |
| Ga0066652_1014346171 | 3300006046 | Soil | VVQRVVEQKEPLRRVAAAYGVSHETIRRILLHVQKRRGQQEA* |
| Ga0075017_1005774791 | 3300006059 | Watersheds | EQKEPLRTVAAAYGVSHETIRRILLQAQKQRGQQEA* |
| Ga0075017_1008449271 | 3300006059 | Watersheds | YGIPTSEWSTIVRRVVEQKESLRTVATEYDVSHETIRRIMLHVHKQHRQQKA* |
| Ga0075015_1000495934 | 3300006102 | Watersheds | LEFWPLIMHRVLEDNEPLRKVADEYGVSHETIRRIMLHVRNQDGPQEM* |
| Ga0075015_1004127952 | 3300006102 | Watersheds | MYRVVENNEPLRQVADDCGVSHETIRRIILHVQKQRDQQKA* |
| Ga0066665_100847303 | 3300006796 | Soil | MQRVVEQKEPLRTVAYGVSHETIRRIVLHVQQQRGQKEA* |
| Ga0066660_103994451 | 3300006800 | Soil | MVLHRVVENNEPLRQVADEYDVSHETIRRLILHAQKPRGQQEA* |
| Ga0079221_116823741 | 3300006804 | Agricultural Soil | EWPTVVQCVVEQQESLRTVAAAYGVSHETIRRIVLHVQEQREQQEA* |
| Ga0075425_1019738001 | 3300006854 | Populus Rhizosphere | MHRVVENTESLRKVAEEYGVSHETIRRILLHVQKQYGQQEA* |
| Ga0066710_1000799881 | 3300009012 | Grasslands Soil | KNEPLRRVAAAYGVSHETIRRILLHVQKPRGQQEA |
| Ga0066710_1035834771 | 3300009012 | Grasslands Soil | EKKEPLRTVAAAYGVSHETIRRIMLHVQKQREQQEA |
| Ga0116216_107895221 | 3300009698 | Peatlands Soil | WPTVVHRVVELKEPLRTVAAAYGVSHETIRRIMLHVHKQLGQ* |
| Ga0126372_119708671 | 3300010360 | Tropical Forest Soil | WPTVVQRVVEQKESLRTVAAAFGVSHETIRRIVLHVQKQHRQ* |
| Ga0136449_1014623022 | 3300010379 | Peatlands Soil | MQRVVESKKSLRAIAQEYGVSHETIRRIMLYAQKQHGQQES* |
| Ga0136449_1018520311 | 3300010379 | Peatlands Soil | IPASEWPTVVKRLVEQKESLRTVAAAYGVSHETVRRIMLHVQKQRGQQQA* |
| Ga0126383_127081921 | 3300010398 | Tropical Forest Soil | VVHRVVEQKEPLRTVAVAYGISHETIRRILLQVQKQRGQQES* |
| Ga0138514_1001393831 | 3300011003 | Soil | MIMHRVVENNEPLRAVAHEYGASHVTIRRIMLHVQKQRQQQDA* |
| Ga0137391_108564961 | 3300011270 | Vadose Zone Soil | VQRVVEQKEPLLSVAAAYGVSHETIRRIMLHVQKQRGQLEV* |
| Ga0137364_102535152 | 3300012198 | Vadose Zone Soil | VVQRVVEQNEPLRAVAAAYGVSPETIRRILLHVQKRRGQQEA* |
| Ga0137364_112388341 | 3300012198 | Vadose Zone Soil | DALPTSEWPTVLHRVVEKKEPLRKVAAAYGVSPETIRRLLLHPQQQHGQPEVYG* |
| Ga0137383_1000325313 | 3300012199 | Vadose Zone Soil | MIIHRVVENNEPLRQVANEYGVSHETIRRLILHAHQERGQQEA* |
| Ga0137383_100510112 | 3300012199 | Vadose Zone Soil | VVQRVVEQNEPLRTVAAAYGVSHETIRRILLHVQKLRGQQEA* |
| Ga0137383_100561121 | 3300012199 | Vadose Zone Soil | MIIHRVVEQKEPLRTVAAAYGISHETIRRIMLHVQKQRG* |
| Ga0137383_100782991 | 3300012199 | Vadose Zone Soil | WPTVVQRVVEQNEPLRAVAAAYGVSPETIRRILLHVQKRRGQQEA* |
| Ga0137383_100866821 | 3300012199 | Vadose Zone Soil | VHRVVDQKEPLRTVAAGYGVSQETIRRILLHAQKQFGQQEA* |
| Ga0137383_101763321 | 3300012199 | Vadose Zone Soil | LPASEWPTVVQRVVEQNEPLPTVAEAYGVSHETIRGILLAVQKPRGQQEA* |
| Ga0137383_103176821 | 3300012199 | Vadose Zone Soil | VLHRVVEQKESLRTVAATYGVSPETIRRLLLHMQK |
| Ga0137383_104169901 | 3300012199 | Vadose Zone Soil | IVQQVVEQKKPLRTIATEYSVSHETIRRIMLYVQKQRGQQEA* |
| Ga0137383_104741261 | 3300012199 | Vadose Zone Soil | MQRVVEQKEPLRTVAAAYGISPETIRRILFHAQKPCGQPEA* |
| Ga0137383_105696991 | 3300012199 | Vadose Zone Soil | MIIHRVVEQNEPLRTVAAAFGVSHETIRRILLHVQKPRGQPEA* |
| Ga0137365_100235151 | 3300012201 | Vadose Zone Soil | VVQRVVEQNEPLRTVAAAYGVSHETIRRILLHVQKLRGQQE |
| Ga0137365_100625581 | 3300012201 | Vadose Zone Soil | TVVQRVVEQNEPLRTVAAAYGISHETIRRILLHVQKLRGQQEA* |
| Ga0137365_100749012 | 3300012201 | Vadose Zone Soil | MVIHRVVENNEPLRAVAQEYGVSHETIRRIMLHVQKQRGQQEA* |
| Ga0137365_103558362 | 3300012201 | Vadose Zone Soil | MVIHRVVENNEPLRTVAQEYGVSHETIRRLLLHTHQQHGQQEA* |
| Ga0137365_104449612 | 3300012201 | Vadose Zone Soil | PASQWPTVMQRVVEQKEPLRTVAAAYDVSHETIRRIVLHVQQQRGQKEA* |
| Ga0137365_107881341 | 3300012201 | Vadose Zone Soil | GIPTDQWPIIMPRVVENKESLRTVAQEYGVSHETIRRNMLHFQMQRGQQEA* |
| Ga0137365_109200961 | 3300012201 | Vadose Zone Soil | VHRVVDQKEPLRTVAAAYSVSHETIRRILLHAQKPHGQPEA* |
| Ga0137380_101484343 | 3300012206 | Vadose Zone Soil | MQRVVEQKEPLRTVAAAYGVSHETIRRIVLHVQQQRGQKEA* |
| Ga0137380_108066551 | 3300012206 | Vadose Zone Soil | HRVVENNEPLRAVAQEYGVSHETIRRIMLHVQKQGGQQEA* |
| Ga0137380_113967242 | 3300012206 | Vadose Zone Soil | HRVVENNEPLRAVAQEYGVSHETIRRIMLHVQKQRGQQEA* |
| Ga0137381_104603041 | 3300012207 | Vadose Zone Soil | MHRVVEKKEPLRTVAAAYGVSHETIRRIMLHVHQQ |
| Ga0137381_111274831 | 3300012207 | Vadose Zone Soil | MVVQRVVEQKEPLRTVAAAYGVSHETIRRLLHIHQQLGQQEA* |
| Ga0137376_100716751 | 3300012208 | Vadose Zone Soil | NEPLRAVAAAYGVSPETIRRILLHVQKRRGQQEA* |
| Ga0137376_102460631 | 3300012208 | Vadose Zone Soil | ASEWPTVVQRVVEQNEPLRPVAAAYGVSPETIRRLLLHPQQQHGQPEVYG* |
| Ga0137379_110358281 | 3300012209 | Vadose Zone Soil | KESLRTVAAAYDVSHETIRRIMLHVQQQRGQQDA* |
| Ga0137379_114258371 | 3300012209 | Vadose Zone Soil | STVMQRMMIQKEPLRSVAAAYGVSHETIRRLLLRVQKQRGQQVT* |
| Ga0137379_115777031 | 3300012209 | Vadose Zone Soil | MIIHRVVENNEPLRQVANEYGVSHETIRRLILHAHQ |
| Ga0137378_102865962 | 3300012210 | Vadose Zone Soil | MQRVVEQKEPLRTVAAAYDVSHETIRRIVLHVQQQRGQKEA* |
| Ga0137378_103595171 | 3300012210 | Vadose Zone Soil | HRVVENNEPLRAIAQEFAVSHETIRRILLHVHKQSGQ* |
| Ga0137378_111080652 | 3300012210 | Vadose Zone Soil | WPTVVHRVVEQKEPLRTVAAYYGVSHETIRRIMRHVKNQRGQQEA* |
| Ga0137377_103984973 | 3300012211 | Vadose Zone Soil | VPAEHWPLVIHRVVEQKEPLRTVAAAYGVSHETIRRILLHTHQQRGQQEA* |
| Ga0137366_100374491 | 3300012354 | Vadose Zone Soil | HWPTVMHRVVEKKEPLRTVAAAYGVSHETIRRIMLHVH* |
| Ga0137371_101809263 | 3300012356 | Vadose Zone Soil | IHRVVEQKEPLRTVAAAYGVSHETIRRIMLHVHQQLGQQEA* |
| Ga0137371_102964413 | 3300012356 | Vadose Zone Soil | MHRVVEKKEPLRTVAAAYGVSHETIRRIMLHVHQQRGQQEA* |
| Ga0137385_100540685 | 3300012359 | Vadose Zone Soil | QRVVEQNEPLRTVAAAYGVSHETIRRLLLHVQKRRGQQEASRDRFCSCDPGTMTS* |
| Ga0137385_100989511 | 3300012359 | Vadose Zone Soil | MVIHRVVENHEPLRAVAQEYGVSHETIRRIMLHVQKQRGQQEA* |
| Ga0137385_116027691 | 3300012359 | Vadose Zone Soil | NNEPLRAVAQEYGVSHETIRRIMLHVQKQGGQQEA* |
| Ga0126369_111446101 | 3300012971 | Tropical Forest Soil | DLWPTVVQRVVEQKEPLRTVAAAYGVSHETIRRIMRHVQKQQRQ* |
| Ga0134087_101834792 | 3300012977 | Grasslands Soil | MVVQRVVEQKEPLRTVAAASGVSHETIRRLLLHLEKPLGQPEA* |
| Ga0134087_103606831 | 3300012977 | Grasslands Soil | VLHRVVEKKEPLRKVAAAYGVSPETIRRLLYTQKPHGQQEA* |
| Ga0134087_105303882 | 3300012977 | Grasslands Soil | LIIHRVVEQKEPLCTVAAAYSVSHETIRRILLHTHQQRGQQEA* |
| Ga0134073_103378621 | 3300015356 | Grasslands Soil | QRVVEQNEPLQRVAAAYGVSHETICLITLHGQKQRGQQEA* |
| Ga0134069_12292172 | 3300017654 | Grasslands Soil | VVQRVVEQKEPLRRVAAAYGVSHETIRRILLHVQKRRGQQEV |
| Ga0187819_107554742 | 3300017943 | Freshwater Sediment | WPTVVHRVVEQKEPLRTVAAVYGVSHETIRRIMLHVQKQRGQQDV |
| Ga0187779_102590612 | 3300017959 | Tropical Peatland | VVEQKEALRTVVAAYGVSHETIRRIMIHVQEQREQQEA |
| Ga0187779_103949541 | 3300017959 | Tropical Peatland | MIVHRVVENNEPLRKVADEYGVSHETIRRITLYFKKQFGQQEA |
| Ga0187778_108865031 | 3300017961 | Tropical Peatland | SEWPTVVQCVVEQNESLRTVAAAYGVSHETIRRILLHVKKPGGQ |
| Ga0187776_111470381 | 3300017966 | Tropical Peatland | VVEQKEPLRTVAAAYGVSHETIRRIILHAHKQRGQQEV |
| Ga0187780_105554561 | 3300017973 | Tropical Peatland | VHRVVEQKEPLRTVAAAYDVSHETIRRIVRHILKQRGQQEA |
| Ga0187777_100731742 | 3300017974 | Tropical Peatland | MHRLVEQKEPLRTVAAAYGVSHETIRRIMHHVRKQRGQQET |
| Ga0187777_100984612 | 3300017974 | Tropical Peatland | MIMQRVLGNKERLRTVAQEYGVSREMIRRIILRIQKQGGQQET |
| Ga0187816_103313431 | 3300017995 | Freshwater Sediment | HRVVEQKEPLRTVAAAYGVSYETIRRIVLHVQKQRGQQKA |
| Ga0187766_103453182 | 3300018058 | Tropical Peatland | HWPMIMQRVLGNKERLRTVAQEYGVSREMIRRIILRIQKQGGQQET |
| Ga0066667_103817311 | 3300018433 | Grasslands Soil | MVVQRVVEQKEPLRTVAAASGVSHETIRRLLLHIHQQLGQQEA |
| Ga0066662_101047293 | 3300018468 | Grasslands Soil | PSEHWPMVIHRVVENNEPLHAVTQEYGVSHETIRRIMLHVQKQGGQQEA |
| Ga0066662_108365872 | 3300018468 | Grasslands Soil | MVVQRVVEQKEPLRTVAAASGVSHETIRRLLLHLQKPRGQPEA |
| Ga0210404_102086771 | 3300021088 | Soil | WPTVVDRVVEQKEPLRSVAAAYGVSHETIRRLLLRVLRLRGQQEY |
| Ga0210384_114382671 | 3300021432 | Soil | ELWPTSVHRVVDQKEPLRTVAAAYGVSHETIRRILLQVQKQRGQQEA |
| Ga0207646_112766571 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | WPLIICRVVEQKEPLRTVAAAYGVSHETIRRILLHTHQQCGQQEA |
| Ga0209027_11007972 | 3300026300 | Grasslands Soil | MVIHRVVENNEPLHAVTQEYGVSHETIRRIMLHVQKQGGQQEA |
| Ga0209239_10236401 | 3300026310 | Grasslands Soil | GSHTEQKEPLRTVAAAYGVSPETIRRLLLHAQKPHGQQEA |
| Ga0209154_10681504 | 3300026317 | Soil | VVQRVVEQKEPLRTVAAAYGVSHETIRRILLHVQKLRGQQEASRDRFCSCD |
| Ga0209156_103658311 | 3300026547 | Soil | EHWPLIIHRVVEQKEPLCTVAAAYSVSHETIRRILLHTHQQRGQQEA |
| Ga0209648_100010403 | 3300026551 | Grasslands Soil | MVIHRVVENNEPLRTVAQDYGVSHETIRRIMLHVQKQRGQKEA |
| Ga0209577_105388271 | 3300026552 | Soil | MVIHRVVENNEPLRTVAQEYGVSHETIRRLLRHTHQQRGQQEA |
| Ga0209283_105152332 | 3300027875 | Vadose Zone Soil | VVHRVVEQKEPLRTVAAAYSVSHETIRRIILHTHQQSI |
| Ga0310915_111963442 | 3300031573 | Soil | MIMHRMVENNKPLRTVAQEYSVSHETIRRIKFHVQRQ |
| Ga0306923_121083931 | 3300031910 | Soil | ADLWPAVVQRVVEQKESLRTVAAAFGVSHETIRRIMRHVQKHRGQEGA |
| Ga0318533_109992572 | 3300032059 | Soil | ASEWPTVLQRVVEQKESLRTVAAAFCVSHETIRRIVLHVQKQHRQEGA |
| Ga0311301_111994001 | 3300032160 | Peatlands Soil | MQRVVESKKSLRAIAQEYGVSHETIRRIMLYAQKQHGQQES |
| Ga0310914_106728571 | 3300033289 | Soil | LWSTVVHRVVEQKEPLRTVAAAYGVSHETIRRIIRHILKQRGQQEA |
| ⦗Top⦘ |