


| Basic Information | |
|---|---|
| Family ID | F059764 |
| Family Type | Metagenome |
| Number of Sequences | 133 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MKRLQKLLIQLNPKIAEVRVESLIDNSFMNKLESSGFIQSLYKKN |
| Number of Associated Samples | 116 |
| Number of Associated Scaffolds | 133 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 2.29 % |
| % of genes near scaffold ends (potentially truncated) | 91.73 % |
| % of genes from short scaffolds (< 2000 bps) | 88.72 % |
| Associated GOLD sequencing projects | 111 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.39 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (87.218 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere (7.519 % of family members) |
| Environment Ontology (ENVO) | Unclassified (34.586 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (39.098 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 45.21% β-sheet: 0.00% Coil/Unstructured: 54.79% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.39 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 133 Family Scaffolds |
|---|---|---|
| PF00890 | FAD_binding_2 | 56.39 |
| PF02602 | HEM4 | 5.26 |
| PF04343 | DUF488 | 2.26 |
| PF03992 | ABM | 2.26 |
| PF01244 | Peptidase_M19 | 2.26 |
| PF13020 | NOV_C | 1.50 |
| PF03401 | TctC | 0.75 |
| PF02211 | NHase_beta | 0.75 |
| PF13091 | PLDc_2 | 0.75 |
| PF13273 | DUF4064 | 0.75 |
| PF09992 | NAGPA | 0.75 |
| PF03795 | YCII | 0.75 |
| PF00491 | Arginase | 0.75 |
| PF09084 | NMT1 | 0.75 |
| PF05168 | HEPN | 0.75 |
| PF10049 | DUF2283 | 0.75 |
| PF13607 | Succ_CoA_lig | 0.75 |
| PF00498 | FHA | 0.75 |
| PF10012 | DUF2255 | 0.75 |
| PF00329 | Complex1_30kDa | 0.75 |
| PF00884 | Sulfatase | 0.75 |
| PF13343 | SBP_bac_6 | 0.75 |
| COG ID | Name | Functional Category | % Frequency in 133 Family Scaffolds |
|---|---|---|---|
| COG1587 | Uroporphyrinogen-III synthase | Coenzyme transport and metabolism [H] | 5.26 |
| COG2355 | Zn-dependent dipeptidase, microsomal dipeptidase homolog | Posttranslational modification, protein turnover, chaperones [O] | 2.26 |
| COG3189 | Uncharacterized conserved protein YeaO, DUF488 family | Function unknown [S] | 2.26 |
| COG0010 | Arginase/agmatinase family enzyme | Amino acid transport and metabolism [E] | 0.75 |
| COG0715 | ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.75 |
| COG0852 | NADH:ubiquinone oxidoreductase 27 kD subunit (chain C) | Energy production and conversion [C] | 0.75 |
| COG1895 | HEPN domain protein, predicted toxin of MNT-HEPN system | Defense mechanisms [V] | 0.75 |
| COG2250 | HEPN domain protein, predicted toxin of MNT-HEPN system | Defense mechanisms [V] | 0.75 |
| COG2350 | YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHis | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.75 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 0.75 |
| COG3262 | Ni,Fe-hydrogenase III component G | Energy production and conversion [C] | 0.75 |
| COG4521 | ABC-type taurine transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.75 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 87.22 % |
| Unclassified | root | N/A | 12.78 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000956|JGI10216J12902_100329610 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 605 | Open in IMG/M |
| 3300000956|JGI10216J12902_111751420 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1171 | Open in IMG/M |
| 3300002503|C687J35164_10129036 | Not Available | 736 | Open in IMG/M |
| 3300004633|Ga0066395_10530546 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
| 3300005205|Ga0068999_10116102 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
| 3300005331|Ga0070670_101995979 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 534 | Open in IMG/M |
| 3300005335|Ga0070666_11145838 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
| 3300005336|Ga0070680_101495970 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
| 3300005406|Ga0070703_10514863 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
| 3300005438|Ga0070701_11151820 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300005458|Ga0070681_10000542 | All Organisms → cellular organisms → Bacteria | 31061 | Open in IMG/M |
| 3300005518|Ga0070699_100891419 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 815 | Open in IMG/M |
| 3300005536|Ga0070697_100664205 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 918 | Open in IMG/M |
| 3300005553|Ga0066695_10368394 | All Organisms → cellular organisms → Bacteria | 898 | Open in IMG/M |
| 3300005559|Ga0066700_10164647 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1512 | Open in IMG/M |
| 3300005563|Ga0068855_101109861 | All Organisms → cellular organisms → Bacteria | 826 | Open in IMG/M |
| 3300005713|Ga0066905_101079262 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 712 | Open in IMG/M |
| 3300005836|Ga0074470_10050749 | All Organisms → cellular organisms → Bacteria | 2244 | Open in IMG/M |
| 3300005981|Ga0081538_10189449 | All Organisms → cellular organisms → Bacteria | 866 | Open in IMG/M |
| 3300006049|Ga0075417_10042358 | All Organisms → cellular organisms → Bacteria | 1935 | Open in IMG/M |
| 3300006804|Ga0079221_11754227 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300006852|Ga0075433_11254594 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 643 | Open in IMG/M |
| 3300006854|Ga0075425_101286212 | All Organisms → cellular organisms → Bacteria | 830 | Open in IMG/M |
| 3300009094|Ga0111539_12502912 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 599 | Open in IMG/M |
| 3300009100|Ga0075418_10207470 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae | 2086 | Open in IMG/M |
| 3300009100|Ga0075418_11125603 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 850 | Open in IMG/M |
| 3300009101|Ga0105247_10408980 | All Organisms → cellular organisms → Bacteria | 969 | Open in IMG/M |
| 3300009147|Ga0114129_11264515 | Not Available | 916 | Open in IMG/M |
| 3300009147|Ga0114129_11691178 | All Organisms → cellular organisms → Bacteria | 772 | Open in IMG/M |
| 3300009147|Ga0114129_13126743 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 540 | Open in IMG/M |
| 3300009168|Ga0105104_10289075 | All Organisms → cellular organisms → Bacteria | 900 | Open in IMG/M |
| 3300009177|Ga0105248_11323881 | All Organisms → cellular organisms → Bacteria | 815 | Open in IMG/M |
| 3300009551|Ga0105238_11684148 | Not Available | 665 | Open in IMG/M |
| 3300010043|Ga0126380_11236997 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 646 | Open in IMG/M |
| 3300010371|Ga0134125_12746236 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 535 | Open in IMG/M |
| 3300010373|Ga0134128_10516518 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1331 | Open in IMG/M |
| 3300010375|Ga0105239_10116615 | All Organisms → cellular organisms → Bacteria | 2963 | Open in IMG/M |
| 3300010399|Ga0134127_12461966 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
| 3300010401|Ga0134121_12166338 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 592 | Open in IMG/M |
| 3300010403|Ga0134123_10366822 | All Organisms → cellular organisms → Bacteria | 1307 | Open in IMG/M |
| 3300010403|Ga0134123_11375903 | Not Available | 745 | Open in IMG/M |
| 3300011403|Ga0137313_1110558 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300011432|Ga0137428_1255684 | Not Available | 517 | Open in IMG/M |
| 3300011435|Ga0137426_1137642 | All Organisms → cellular organisms → Bacteria | 710 | Open in IMG/M |
| 3300011440|Ga0137433_1246625 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
| 3300011441|Ga0137452_1149667 | All Organisms → cellular organisms → Bacteria | 785 | Open in IMG/M |
| 3300012157|Ga0137353_1041583 | All Organisms → cellular organisms → Bacteria | 821 | Open in IMG/M |
| 3300012172|Ga0137320_1062385 | All Organisms → cellular organisms → Bacteria | 780 | Open in IMG/M |
| 3300012210|Ga0137378_10650075 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 965 | Open in IMG/M |
| 3300012285|Ga0137370_10129319 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1446 | Open in IMG/M |
| 3300012355|Ga0137369_11057083 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 534 | Open in IMG/M |
| 3300012474|Ga0157356_1024917 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 516 | Open in IMG/M |
| 3300012532|Ga0137373_10881069 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 658 | Open in IMG/M |
| 3300012922|Ga0137394_10424559 | All Organisms → cellular organisms → Bacteria | 1132 | Open in IMG/M |
| 3300012944|Ga0137410_10527890 | All Organisms → cellular organisms → Bacteria | 968 | Open in IMG/M |
| 3300012944|Ga0137410_11469204 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
| 3300012948|Ga0126375_10258655 | All Organisms → cellular organisms → Bacteria | 1184 | Open in IMG/M |
| 3300012955|Ga0164298_10006273 | All Organisms → cellular organisms → Bacteria | 4326 | Open in IMG/M |
| 3300012971|Ga0126369_11873812 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 688 | Open in IMG/M |
| 3300012989|Ga0164305_10000115 | All Organisms → cellular organisms → Bacteria | 25579 | Open in IMG/M |
| 3300013306|Ga0163162_10284963 | All Organisms → cellular organisms → Bacteria | 1784 | Open in IMG/M |
| 3300013306|Ga0163162_12038287 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 658 | Open in IMG/M |
| 3300013308|Ga0157375_13184687 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 547 | Open in IMG/M |
| 3300015245|Ga0137409_11079545 | All Organisms → cellular organisms → Bacteria | 641 | Open in IMG/M |
| 3300015371|Ga0132258_13960658 | All Organisms → cellular organisms → Bacteria | 1006 | Open in IMG/M |
| 3300015372|Ga0132256_100069333 | All Organisms → cellular organisms → Bacteria | 3336 | Open in IMG/M |
| 3300015372|Ga0132256_103713501 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 513 | Open in IMG/M |
| 3300015373|Ga0132257_102845342 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
| 3300015374|Ga0132255_101773366 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 937 | Open in IMG/M |
| 3300016319|Ga0182033_11747951 | Not Available | 564 | Open in IMG/M |
| 3300017927|Ga0187824_10039650 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1435 | Open in IMG/M |
| 3300018053|Ga0184626_10267321 | All Organisms → cellular organisms → Bacteria | 715 | Open in IMG/M |
| 3300018056|Ga0184623_10039284 | All Organisms → cellular organisms → Bacteria | 2147 | Open in IMG/M |
| 3300018056|Ga0184623_10126828 | All Organisms → cellular organisms → Bacteria | 1180 | Open in IMG/M |
| 3300018056|Ga0184623_10205507 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 905 | Open in IMG/M |
| 3300018076|Ga0184609_10060071 | All Organisms → cellular organisms → Bacteria | 1641 | Open in IMG/M |
| 3300018082|Ga0184639_10308787 | All Organisms → cellular organisms → Bacteria | 830 | Open in IMG/M |
| 3300018084|Ga0184629_10103171 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1397 | Open in IMG/M |
| 3300018422|Ga0190265_10651318 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1174 | Open in IMG/M |
| 3300018469|Ga0190270_12244885 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 606 | Open in IMG/M |
| 3300018469|Ga0190270_13345771 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300019879|Ga0193723_1122742 | All Organisms → cellular organisms → Bacteria | 719 | Open in IMG/M |
| 3300019881|Ga0193707_1184669 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 548 | Open in IMG/M |
| 3300020195|Ga0163150_10383642 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 654 | Open in IMG/M |
| 3300021073|Ga0210378_10065410 | All Organisms → cellular organisms → Bacteria | 1427 | Open in IMG/M |
| 3300021080|Ga0210382_10105574 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1177 | Open in IMG/M |
| 3300021082|Ga0210380_10453676 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 587 | Open in IMG/M |
| 3300021432|Ga0210384_10448417 | Not Available | 1162 | Open in IMG/M |
| 3300022534|Ga0224452_1140759 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 743 | Open in IMG/M |
| 3300022563|Ga0212128_10537160 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 712 | Open in IMG/M |
| 3300022694|Ga0222623_10426907 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 503 | Open in IMG/M |
| 3300025146|Ga0209322_10080517 | Not Available | 1522 | Open in IMG/M |
| 3300025289|Ga0209002_10193294 | Not Available | 1262 | Open in IMG/M |
| 3300025289|Ga0209002_10343412 | All Organisms → cellular organisms → Bacteria | 865 | Open in IMG/M |
| 3300025289|Ga0209002_10553817 | Not Available | 627 | Open in IMG/M |
| 3300025289|Ga0209002_10672878 | Not Available | 545 | Open in IMG/M |
| 3300025313|Ga0209431_10503747 | All Organisms → cellular organisms → Bacteria | 921 | Open in IMG/M |
| 3300025313|Ga0209431_10583071 | Not Available | 841 | Open in IMG/M |
| 3300025326|Ga0209342_10078456 | Not Available | 3073 | Open in IMG/M |
| 3300025796|Ga0210113_1017064 | All Organisms → cellular organisms → Bacteria | 1499 | Open in IMG/M |
| 3300025903|Ga0207680_10422177 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 944 | Open in IMG/M |
| 3300025925|Ga0207650_11705626 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 534 | Open in IMG/M |
| 3300025931|Ga0207644_10906086 | All Organisms → cellular organisms → Bacteria | 739 | Open in IMG/M |
| 3300025936|Ga0207670_10458314 | All Organisms → cellular organisms → Bacteria | 1029 | Open in IMG/M |
| 3300025936|Ga0207670_10998372 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 704 | Open in IMG/M |
| 3300025953|Ga0210068_1075140 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300025971|Ga0210102_1005974 | All Organisms → cellular organisms → Bacteria | 2553 | Open in IMG/M |
| 3300025981|Ga0207640_10549401 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 970 | Open in IMG/M |
| 3300026078|Ga0207702_10736014 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 973 | Open in IMG/M |
| 3300026323|Ga0209472_1064294 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1531 | Open in IMG/M |
| 3300027252|Ga0209973_1029094 | All Organisms → cellular organisms → Bacteria | 771 | Open in IMG/M |
| 3300027765|Ga0209073_10524054 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300027778|Ga0209464_10079222 | All Organisms → cellular organisms → Bacteria | 1109 | Open in IMG/M |
| 3300027909|Ga0209382_10052439 | All Organisms → cellular organisms → Bacteria | 4854 | Open in IMG/M |
| 3300028145|Ga0247663_1114004 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300031720|Ga0307469_12455042 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300031858|Ga0310892_10069884 | All Organisms → cellular organisms → Bacteria | 1819 | Open in IMG/M |
| 3300031890|Ga0306925_11027839 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 838 | Open in IMG/M |
| 3300031908|Ga0310900_11315561 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 605 | Open in IMG/M |
| 3300031949|Ga0214473_12410373 | Not Available | 501 | Open in IMG/M |
| 3300031965|Ga0326597_10429513 | All Organisms → cellular organisms → Bacteria | 1460 | Open in IMG/M |
| 3300032000|Ga0310903_10629908 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 574 | Open in IMG/M |
| 3300032174|Ga0307470_10912914 | All Organisms → cellular organisms → Bacteria | 691 | Open in IMG/M |
| 3300032829|Ga0335070_10074158 | All Organisms → cellular organisms → Bacteria | 3644 | Open in IMG/M |
| 3300033419|Ga0316601_101429827 | All Organisms → cellular organisms → Bacteria | 696 | Open in IMG/M |
| 3300033475|Ga0310811_10726460 | All Organisms → cellular organisms → Bacteria | 952 | Open in IMG/M |
| 3300033814|Ga0364930_0227309 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 633 | Open in IMG/M |
| 3300034147|Ga0364925_0330956 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 572 | Open in IMG/M |
| 3300034176|Ga0364931_0246316 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 587 | Open in IMG/M |
| 3300034177|Ga0364932_0010682 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Bacillaceae → Bacillus → Bacillus tuaregi | 3456 | Open in IMG/M |
| 3300034177|Ga0364932_0081861 | Not Available | 1224 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 7.52% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 6.77% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.02% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 5.26% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 5.26% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 4.51% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.76% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.76% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 3.76% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 3.76% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 3.01% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 3.01% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.01% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 3.01% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 2.26% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.26% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.26% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.26% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.50% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.50% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.50% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.50% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.50% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.50% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.50% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.50% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.50% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.50% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.50% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.50% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 1.50% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.75% |
| Freshwater Microbial Mat | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Microbial Mat | 0.75% |
| Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 0.75% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.75% |
| Thermal Springs | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Thermal Springs | 0.75% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 0.75% |
| Unplanted Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil | 0.75% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.75% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.75% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.75% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.75% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.75% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002503 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_3 | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005205 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleC_D2 | Environmental | Open in IMG/M |
| 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
| 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Environmental | Open in IMG/M |
| 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
| 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005836 | Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBB | Environmental | Open in IMG/M |
| 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Host-Associated | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009168 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011403 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT166_2 | Environmental | Open in IMG/M |
| 3300011432 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT718_2 | Environmental | Open in IMG/M |
| 3300011435 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT660_2 | Environmental | Open in IMG/M |
| 3300011440 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT840_2 | Environmental | Open in IMG/M |
| 3300011441 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT513_2 | Environmental | Open in IMG/M |
| 3300012157 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT760_2 | Environmental | Open in IMG/M |
| 3300012172 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT366_2 | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012474 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.3.yng.040610 | Environmental | Open in IMG/M |
| 3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300017927 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4 | Environmental | Open in IMG/M |
| 3300018053 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1 | Environmental | Open in IMG/M |
| 3300018056 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1 | Environmental | Open in IMG/M |
| 3300018064 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
| 3300018082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2 | Environmental | Open in IMG/M |
| 3300018084 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1 | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300019879 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2 | Environmental | Open in IMG/M |
| 3300019881 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3c2 | Environmental | Open in IMG/M |
| 3300020195 | Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.P2.IB | Environmental | Open in IMG/M |
| 3300021073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redo | Environmental | Open in IMG/M |
| 3300021080 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo | Environmental | Open in IMG/M |
| 3300021082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_coex redo | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300022534 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_b1 | Environmental | Open in IMG/M |
| 3300022563 | OV2_combined assembly | Environmental | Open in IMG/M |
| 3300022694 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coex | Environmental | Open in IMG/M |
| 3300025146 | Soil microbial communities from Rifle, Colorado, USA - sediment 19ft 1 | Environmental | Open in IMG/M |
| 3300025289 | Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 2 | Environmental | Open in IMG/M |
| 3300025313 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_3 (SPAdes) | Environmental | Open in IMG/M |
| 3300025326 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 16_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025796 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025953 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqA_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025971 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqC_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes) | Environmental | Open in IMG/M |
| 3300027252 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
| 3300027778 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare1Fresh (SPAdes) | Environmental | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028145 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK04 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031858 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
| 3300031944 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1 | Environmental | Open in IMG/M |
| 3300031949 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197 | Environmental | Open in IMG/M |
| 3300031965 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185 | Environmental | Open in IMG/M |
| 3300032000 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D3 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300033419 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_noCT | Environmental | Open in IMG/M |
| 3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
| 3300033814 | Sediment microbial communities from East River floodplain, Colorado, United States - 55_j17 | Environmental | Open in IMG/M |
| 3300034147 | Sediment microbial communities from East River floodplain, Colorado, United States - 44_j17 | Environmental | Open in IMG/M |
| 3300034176 | Sediment microbial communities from East River floodplain, Colorado, United States - 21_j17 | Environmental | Open in IMG/M |
| 3300034177 | Sediment microbial communities from East River floodplain, Colorado, United States - 17_j17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI10216J12902_1003296101 | 3300000956 | Soil | TSVEGMKRLQKLLIQLNPKIADVRVETLIDNSFMNRLESSGFIQNLYKKNL* |
| JGI10216J12902_1117514202 | 3300000956 | Soil | VEGMKRLQKLMAQITPKIADARVETVVDNSFMNKLESSGYIQSLYKKNEVPR* |
| C687J35164_101290361 | 3300002503 | Soil | KRLHRLLIQVNPKVADVKVESVIDNSFISKLESSGYIQGVYKKK* |
| Ga0066395_105305461 | 3300004633 | Tropical Forest Soil | PTPSLDGMKRLQRLLTHVNPKVSEVKVENVIDSSFMNKLESSGFIQTVYKRN* |
| Ga0068999_101161022 | 3300005205 | Natural And Restored Wetlands | LLIQLNPKIADVRVETLLDNSFMNKLESSGFIQGLYKKN* |
| Ga0070670_1019959791 | 3300005331 | Switchgrass Rhizosphere | MKRLHKLMTQITPGIGDVRVENVIDNSFMNKLETSGYIQSFYKKN* |
| Ga0070666_111458382 | 3300005335 | Switchgrass Rhizosphere | LQRLLTHVNPKVSEVKVESVIDSSFMNKLESSGFIQSVYKKN* |
| Ga0070680_1014959702 | 3300005336 | Corn Rhizosphere | TSVEGMKRLQKLMAQITPKIADVRVETVVDTSFMNKLESSGYIQSLYKKN* |
| Ga0070703_105148632 | 3300005406 | Corn, Switchgrass And Miscanthus Rhizosphere | LMAQITPKLADVRVETAVDSSFMNKLESSGYIQSLYKKN* |
| Ga0070701_111518202 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | LHKLMTQINPKIADVRVENAIDNSFMNKLETSGFIQSVSKRN* |
| Ga0070681_1000054237 | 3300005458 | Corn Rhizosphere | KRLQRLLTHVNPKVSEVKVESVIDSSFMNKLESSGFIQNVYKKN* |
| Ga0070699_1008914192 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | SVEGMKRLQKLLTQLNPKIAEVRVETLIDNSFMNKLESSGFIESLYKKN* |
| Ga0070697_1006642053 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | HKLMTQITPGIGDVRVENVIDNSFMNKLETSGYIQSFYKKN* |
| Ga0066695_103683942 | 3300005553 | Soil | TLEGMKRLQKLLIQLNPKIAEVRVESLIDNSFMNKLESSGFIQSLYKKN* |
| Ga0066700_101646472 | 3300005559 | Soil | ISLDGMKRLHKLLTQINAKVADVRVENVIDTSFMNRLESTGYIQNLYKKN* |
| Ga0068855_1011098612 | 3300005563 | Corn Rhizosphere | HVNPKVSEVKVESVIDSSFMNKLESSGFIQNVYKKN* |
| Ga0066905_1010792621 | 3300005713 | Tropical Forest Soil | MKKLQRLLAQINPKIAEVRVENVIDNSFMNKLESSGFIQSVYKKN* |
| Ga0074470_100507491 | 3300005836 | Sediment (Intertidal) | LLVQFNPKIADVRVETLIDNSLMNKLESSGFIQGLYKKN* |
| Ga0081538_101894491 | 3300005981 | Tabebuia Heterophylla Rhizosphere | ISLEAMKRLQGLLIQINPKIAEVRVENVIDNSFMNKLESSGYIQSVYKKQ* |
| Ga0075417_100423581 | 3300006049 | Populus Rhizosphere | SLEGMKRLQVLLTQINPKIAEVRVENVIDNSFMNKLERSGYIQSVYKKH* |
| Ga0079221_117542272 | 3300006804 | Agricultural Soil | RLLTHVNPKVSEVKVESVVDSSFMNKLESSGFIQSVYKKN* |
| Ga0075433_112545941 | 3300006852 | Populus Rhizosphere | NPKIAEVRVETLIDNSFMNRLESSGFIQSLYKKH* |
| Ga0075425_1012862122 | 3300006854 | Populus Rhizosphere | ERVPQTSLEGMKRLQKLMLQINPKMGDVRVESVIDNSFMNKLESSGFIQSVYKRN* |
| Ga0111539_125029121 | 3300009094 | Populus Rhizosphere | RAPHTSLEGMKRLQVLLTQINPKIAEVRVENVIDNSFMNKLERSGYIQSVYKKH* |
| Ga0075418_102074703 | 3300009100 | Populus Rhizosphere | KRLQVLLTQINPKIAEVRVENVIDTSFMNKLENSGYIQSVYKKH* |
| Ga0075418_111256031 | 3300009100 | Populus Rhizosphere | KRLQKLLIQLNPKIAEVRVETLIDNSFMNKLESSGFIQRLYKKN* |
| Ga0105247_104089802 | 3300009101 | Switchgrass Rhizosphere | LQTLMAQITPKLADVRVETAVDSSFMNKLESSGYIQSLYKKN* |
| Ga0114129_112645151 | 3300009147 | Populus Rhizosphere | LQKLLMQINPKMGDVRVENVLDNSFMNKLESSGYIQSVYKKN* |
| Ga0114129_116911781 | 3300009147 | Populus Rhizosphere | LLIQLNPKIAEVRVESLIDNSFMNKLESSGFIQGLYKKN* |
| Ga0114129_131267432 | 3300009147 | Populus Rhizosphere | EGMKRLQVLLTQINPKIADVRVENLIDNSFMSKLESSGYIQSVYKK* |
| Ga0105104_102890751 | 3300009168 | Freshwater Sediment | KLLMQINPKMGDVRVENVIENSFMNKLETSGYIQSVYKKN* |
| Ga0105248_113238811 | 3300009177 | Switchgrass Rhizosphere | LMAQITPKLADVRVETAVDTSFMNKLESSGYIQSLYKKN* |
| Ga0105238_116841482 | 3300009551 | Corn Rhizosphere | MKRLQRLLTHVNPKVSEVKVESVIDSSFMNKLESSGFIQNVYKKN* |
| Ga0126380_112369972 | 3300010043 | Tropical Forest Soil | GLLVQINPKIAEVRVENLIDSSFMNKIESSGYIQSVYKKH* |
| Ga0134125_127462361 | 3300010371 | Terrestrial Soil | KLLIQLNPKIAEVRVESLIDNSFMNKLESSGFIQSLYKKN* |
| Ga0134128_105165182 | 3300010373 | Terrestrial Soil | QKLLIQLNPKIAEVRVESLIDNSFMNKLESSGFIQSLYKKN* |
| Ga0105239_101166154 | 3300010375 | Corn Rhizosphere | VNPKVSEVKVESVIDSSFMNKLESSGFIQSVYKKN* |
| Ga0134127_124619662 | 3300010399 | Terrestrial Soil | LHKLMTQINPKIADVRVENAIDNSFMNKLETSGYIDSFYKKN* |
| Ga0134121_121663382 | 3300010401 | Terrestrial Soil | QLNPKIAEVRVESLIDNSFMNKLESSGFIQSLYKKN* |
| Ga0134123_103668221 | 3300010403 | Terrestrial Soil | TLMAQITPKLADVRVETAVDTSFMNKLESSGYMQRLYKKN* |
| Ga0134123_113759031 | 3300010403 | Terrestrial Soil | GMKRLHKLMTQITPKLADVRVENTVDPSFMNKLEASGYIQSLYKKN* |
| Ga0137313_11105581 | 3300011403 | Soil | LLIQLNPKIADVRVETLIDNSFMNKLESSGFIQGLYKKN* |
| Ga0137428_12556841 | 3300011432 | Soil | LHKLLTQLNPKMADVRVENCIDNSFMNKLESSGFIQSVYKKN* |
| Ga0137426_11376422 | 3300011435 | Soil | LHKLLLQINPKMGDVRVENVIDNSFMNKLETSGYIQSVYKKN* |
| Ga0137433_12466252 | 3300011440 | Soil | EGMKRLQKILAQINPKISEVRVENIIDSSFMNRLESSGFIQNLYKK* |
| Ga0137452_11496671 | 3300011441 | Soil | GMKRLQKLLIQLNPKIADVRVETLIDNSFMNKLESSGFIQGLYKKN* |
| Ga0137353_10415831 | 3300012157 | Soil | QKILAQINPKISEVRVENIIDSSFMNRLESSGFIQSLYKK* |
| Ga0137320_10623851 | 3300012172 | Soil | QLNPKIADVRVETLIDNSFMNKLESSGFIQGLYKKN* |
| Ga0137378_106500752 | 3300012210 | Vadose Zone Soil | EGMKRLQKLLIQLNPKISEVRVETLIDNSFMNRLESSGFIQSLYKKN* |
| Ga0137370_101293192 | 3300012285 | Vadose Zone Soil | RAPHTTIEGMKRLQKLLIQLNPKIAEVRVETLIDNSFMNKLESSGFIQNLYKKN* |
| Ga0137369_110570832 | 3300012355 | Vadose Zone Soil | QKLLIQLNPKIAEVRVETLIDDSFMNRLESSGFIQSLYKKN* |
| Ga0157356_10249171 | 3300012474 | Unplanted Soil | TTIEGMKRLQKLLIQLNPKIAEVRVETLIDNSFMNKLESSGFIQRLYKKN* |
| Ga0137373_108810691 | 3300012532 | Vadose Zone Soil | KRLQKLLIQLNPKIAEVRVETLIDNSFMNRLESSGFIQSLYKKN* |
| Ga0137394_104245591 | 3300012922 | Vadose Zone Soil | RLQKLLIQLNPKIAEVRVETLIDNSFMNKLESSGFIKSLYKKN* |
| Ga0137410_105278902 | 3300012944 | Vadose Zone Soil | KRLHKLMTQINPKIADVRVENAIDNSFMNKLETSGFIQSVSKKN* |
| Ga0137410_114692041 | 3300012944 | Vadose Zone Soil | NPKIVEVRVETLIDNSFMNKLESSGFIQSLYKKN* |
| Ga0126375_102586552 | 3300012948 | Tropical Forest Soil | MKRLQGLLVQINPKIADVRVENLIDSSFMNRIESSGYIQSVYKKH* |
| Ga0164298_100062736 | 3300012955 | Soil | MAQITPKIADVRVETVVDTSFMNKLESSGYIQSLYKKN* |
| Ga0126369_118738121 | 3300012971 | Tropical Forest Soil | PSLDGMKRLQRLLTHVNPKVSEVKVENVIDSSFMNKLESSGFIQTVYKRN* |
| Ga0164305_100001151 | 3300012989 | Soil | HVNPKVSEVKVESVIDSSFMNKLESSGFIQSVYKKN* |
| Ga0163162_102849633 | 3300013306 | Switchgrass Rhizosphere | GMKRLHKLMTQINPKIADVRVENAIDNSFMNKLETSGFIQSVSKRN* |
| Ga0163162_120382872 | 3300013306 | Switchgrass Rhizosphere | DGMKRLQRLLTHVNPKVSEVKVESVIDSSFMNKLESSGFIQNVYKKN* |
| Ga0157375_131846872 | 3300013308 | Miscanthus Rhizosphere | IEGMKRLQKLLIQLNPKIAEVRVETLIDNSFMNKLESSGFIQSLYKKN* |
| Ga0137409_110795451 | 3300015245 | Vadose Zone Soil | TTLEGMKRLQKLLIQLNPKIAEVRVESLIDNSFMNKLESSGFIQSLYKKN* |
| Ga0132258_139606582 | 3300015371 | Arabidopsis Rhizosphere | AQITPKIADVRVETVVDTSFMNKLESSGYIQSLYKKN* |
| Ga0132256_1000693336 | 3300015372 | Arabidopsis Rhizosphere | NSFERVPTPNLDGMKRLQRLLTHVNPKVSEVKVESVIDSSFMNKLESSGFIQSVYKKN* |
| Ga0132256_1037135011 | 3300015372 | Arabidopsis Rhizosphere | MKRLQRLLAQVNPKVSEVKVENVIDSSFMNKLESSGFMQSVYKKN* |
| Ga0132257_1028453421 | 3300015373 | Arabidopsis Rhizosphere | GMKRLHKLMTQINPKIADVRVENAIDNSFMNKLETSGFIQSVSKKN* |
| Ga0132255_1017733661 | 3300015374 | Arabidopsis Rhizosphere | MKRLQRLLTHVNPKVAEVKVESVIDSSFMNKLESSGFIQSVYKKN* |
| Ga0182033_117479512 | 3300016319 | Soil | MKRLQKLMTQINPKMGDVRVENIIDNSFMNKLESSGYIQSVYKKN |
| Ga0187824_100396501 | 3300017927 | Freshwater Sediment | MKRLHGLLSTINPKVKDVRVESVIDNSFISRLDQSGFVQSVWKK |
| Ga0184626_102673212 | 3300018053 | Groundwater Sediment | HTNLEGMKRLHKLLTQINPKIADVRIENTIDNSFMNKLETSGYIQSVYKKN |
| Ga0184623_100392843 | 3300018056 | Groundwater Sediment | MKRLHKLLIQINPKVTDVRVENVIDTSFMNKLDSSGFIQSVYKKH |
| Ga0184623_101268282 | 3300018056 | Groundwater Sediment | NQLNLKIADVRVETLIDNSFMNKLASSGFIQSLYKKN |
| Ga0184623_102055071 | 3300018056 | Groundwater Sediment | EGMKRLHKLLVQINPKVADVRVENVIDPSFMNRLESSGYIQSLYKKN |
| Ga0187773_105936531 | 3300018064 | Tropical Peatland | YERVPHINLEGMKRLQKLLTQINPKMGDVRVENVIDDSFMNKLESSGYIQSVYRKN |
| Ga0184609_100600712 | 3300018076 | Groundwater Sediment | EGMKRLQKLLIQLNPKIAEVRVETLIDDSFMNRLESSGFIQGLYKKN |
| Ga0184639_103087871 | 3300018082 | Groundwater Sediment | RLQKLLVQLNPKIAEVRVENLLDSSFMNKLESSGFIQGLYKKN |
| Ga0184629_101031711 | 3300018084 | Groundwater Sediment | IQLNPKIADVRVETLLDNSFMNKLESSGFIQGLYKKN |
| Ga0190265_106513182 | 3300018422 | Soil | MKRLQKLLIQLNPKIAEVRVESLIDNSFMNKLESSGFIQSLYKKN |
| Ga0190270_122448851 | 3300018469 | Soil | IQLNPKIAEVRVENLIDNSFMNKLESSGFIQGLYKKN |
| Ga0190270_133457712 | 3300018469 | Soil | LNPKIADVRVETLLDNSFMNKLESSGFIQGLYKKN |
| Ga0193723_11227421 | 3300019879 | Soil | LNPKIVEVRVETLIDNSFMNKLESSGFIRSLYKKN |
| Ga0193707_11846691 | 3300019881 | Soil | RLHKLMTQITPGIGDVRVENVIDNSFMNKLETSGYIQSFYKKN |
| Ga0163150_103836422 | 3300020195 | Freshwater Microbial Mat | HISMEGMKRLQKLLTQLNPKIADVRVETLIDNSFMNKLESSGFIQGLYKKN |
| Ga0210378_100654102 | 3300021073 | Groundwater Sediment | EGMKRLHKLLTQINPKIADARIENTIDNSFMNKLETSGYIQSVYKKN |
| Ga0210382_101055742 | 3300021080 | Groundwater Sediment | VEGMKRLQKLLIQLNPKIAEVRVETLIDDSFMNRLESSGFIQSLYKKN |
| Ga0210380_104536761 | 3300021082 | Groundwater Sediment | MKRLHKLMTQINSKIADVRVENAVDNSFMNKLEAAGFIQSIYKKN |
| Ga0210384_104484171 | 3300021432 | Soil | QINPKMGDVRVENVIDNTFMNKLESSGFIQSVYKKN |
| Ga0224452_11407591 | 3300022534 | Groundwater Sediment | SVEGMKRLQKLLIQLNPKIAEVRVETLIDDSFMNRLESSGFIQGLYKKN |
| Ga0212128_105371602 | 3300022563 | Thermal Springs | ERAPHTSPEGMKRLHRLLIQINPKVADVRIETVVDNSFMNKLESSGFIQSVYKKH |
| Ga0222623_104269071 | 3300022694 | Groundwater Sediment | VEGMKRLQKLLIQLNPKIAEVRVETLIDDSFMNRLESSGFIQGLYKKN |
| Ga0209322_100805175 | 3300025146 | Soil | VPYSNLENMKRLHRLLIQVNPKVADVKVESVIDNSFISKLESSGYIQSVYKKR |
| Ga0209002_101932945 | 3300025289 | Soil | IQVNPKVADVKVESVIDNSFISKLESSGYIQSVYKKR |
| Ga0209002_103434121 | 3300025289 | Soil | LLIQVNPKVADVKVESVIDNSFISKLENSGYVQSVYKKK |
| Ga0209002_105538171 | 3300025289 | Soil | RLHQLLIQVNPKVADVKVESVIDNSFISKLESSGYVQSVYKKK |
| Ga0209002_106728781 | 3300025289 | Soil | NLENMKRLHRLLIQVNPKVADVKVESVIDNSFISKLESSGYIQGVYKKK |
| Ga0209431_105037471 | 3300025313 | Soil | KRLHRLLIQVNPKVADVKVESVIDNSFISKLENSGYVQSVYKKK |
| Ga0209431_105830711 | 3300025313 | Soil | KRLHRLLIQVNPKVADVKVESVIDNSFISKLESSGYIQGVYKKK |
| Ga0209342_100784561 | 3300025326 | Soil | LENMKRLHRLLIQVNPKVVDVKVESVIDNSFISKLERSGYIQSVYKKR |
| Ga0210113_10170641 | 3300025796 | Natural And Restored Wetlands | SLQGMQRLQKILAQSNPKISEVRVENTIDNSVMERLENSGFIQSAYRKN |
| Ga0207680_104221772 | 3300025903 | Switchgrass Rhizosphere | FERVPSPSLDGMKRLQRLLTHVNPKVSEVKVESVIDSSFMNKLESSGFIQNVYKKN |
| Ga0207650_117056262 | 3300025925 | Switchgrass Rhizosphere | MKRLHKLMTQITPGIGDVRVENVIDNSFMNKLETSGYIQSFYKKN |
| Ga0207644_109060862 | 3300025931 | Switchgrass Rhizosphere | MAQITPKIADVRVETVVDTSFMNKLESSGYIQSLYKKN |
| Ga0207670_104583141 | 3300025936 | Switchgrass Rhizosphere | QKLLTQQNPKIAEVRVETLIDAAPMNKLESSGFIHSLYKK |
| Ga0207670_109983721 | 3300025936 | Switchgrass Rhizosphere | QKLLIQLNPKIAEVRVESLIDNSFMNKLESSGFIQSLYKKN |
| Ga0210068_10751402 | 3300025953 | Natural And Restored Wetlands | LLVQVNPKVADVRIEGVIENSFINKLESSGYIQSVYKKN |
| Ga0210102_10059741 | 3300025971 | Natural And Restored Wetlands | QVNPKVADVRIDGVIENSFINKLESSGYIQSVYKKN |
| Ga0207640_105494011 | 3300025981 | Corn Rhizosphere | SLDGMKRLQRLLTHVNPKVSEVKVESVIDSSFMNKLESSGFIQSVYKKN |
| Ga0207702_107360141 | 3300026078 | Corn Rhizosphere | DGMKRLQRLLTHVNPKVSEVKVESVIDSSFMNKLESSGFIQSVYKKN |
| Ga0209472_10642942 | 3300026323 | Soil | HKLLTQINAKVADVRVENVIDTSFMNRLESTGYIQNLYKKN |
| Ga0209973_10290941 | 3300027252 | Arabidopsis Thaliana Rhizosphere | GMKRLQKLMAQLNPKVAEVRVENLIDSSFMNKLESSGYIQNVYKKH |
| Ga0209073_105240541 | 3300027765 | Agricultural Soil | APHTSVAGMKRLQTLMAQITPKLADVRVETAVDTSFMNKLESSGYIQSLYKKN |
| Ga0209464_100792221 | 3300027778 | Wetland Sediment | RVPYSQLESMKRLHQLLVQINPKVADVRVESVIDNSILNRLESSGYIQSVYKKN |
| Ga0209382_100524395 | 3300027909 | Populus Rhizosphere | APHTSLEGMKRLQVLLTQINPKIAEVRVENVIDNSFMNKLERSGYIQSVYKKH |
| Ga0247663_11140042 | 3300028145 | Soil | LNPNIADVRVENVIDNSFMNKLESSGYIQSVYKKN |
| Ga0307469_124550421 | 3300031720 | Hardwood Forest Soil | MVQINPKMGDVRVENVIDNSFMNKLESSGFIQSVYRKN |
| Ga0310892_100698841 | 3300031858 | Soil | LDGMKRLQRLLTHVNPKVSEVKVESVVDSSFMNKLESSGFIQSVYKKN |
| Ga0306925_110278391 | 3300031890 | Soil | TPSLDGMKRLQRLLTHVNPKVSEVKVENVIDSSFMNKLESSGFIQSVYKRN |
| Ga0310900_113155612 | 3300031908 | Soil | IQLNPKIAEVRVESLIDNSFMNKLESSGFIQSLYKKN |
| Ga0310884_110200872 | 3300031944 | Soil | ERAPHTNVEGMKRLHKLMTQINPKIADVRVENAIDNSFMNKLETSGFIQSVSKKN |
| Ga0214473_124103731 | 3300031949 | Soil | ENMKRLHQLLIQVNPKVADVKVESVIDNSFISRLESSGYIQSVYKKK |
| Ga0326597_104295131 | 3300031965 | Soil | HTTLEGMKRLQKILTQINPKISEVRVENIIDSSFMNKLESSGFMQSLNKK |
| Ga0310903_106299081 | 3300032000 | Soil | HTTLEGMKRLQKLLIQLNPKIAEVRVENLIDNSFMNKLESSGFIQGLYKKN |
| Ga0307470_109129143 | 3300032174 | Hardwood Forest Soil | KRLQKLLIQINPKMGDVRVENVIDNSFMNKLENSGFIQSVYRKN |
| Ga0335070_100741583 | 3300032829 | Soil | MSRLHQLLLQINPKVSDVRVEAVIDNSFINKLETSGYLQPLYKRN |
| Ga0316601_1014298271 | 3300033419 | Soil | MKRLQKLLTQLNPKIAEVRVETLIDSSFMNKLESSGFIQGLYKKN |
| Ga0310811_107264602 | 3300033475 | Soil | EGMKRLQRLLAQINPKVAEVRIESVIDNSFMNKLENSGFIQAAYKKN |
| Ga0364930_0227309_12_146 | 3300033814 | Sediment | MKRLQKILAQINPKISEVRVENVIDSSFMNRLESSGFMQSLYKK |
| Ga0364925_0330956_3_134 | 3300034147 | Sediment | RLHKLITQINTKIADVRVENAVDNSFMNKLEAAGFIQSIYKKN |
| Ga0364931_0246316_431_568 | 3300034176 | Sediment | MKRLQVLLTQINPKIAEVRVENVIDNSFMNKLESSGYIQSVYKKH |
| Ga0364932_0010682_2_136 | 3300034177 | Sediment | KRLHRLLIQVNPKVADVRVESVIDNSFISKLENSGYIQSVYKKR |
| Ga0364932_0081861_26_163 | 3300034177 | Sediment | MKRLHRLLIQVNPNVADVRVESVIDNSFISKLESSGYIQSVYKKK |
| ⦗Top⦘ |