


| Basic Information | |
|---|---|
| Family ID | F059696 |
| Family Type | Metagenome |
| Number of Sequences | 133 |
| Average Sequence Length | 42 residues |
| Representative Sequence | YLSGPAAVATAGEEIAAAHADGRPQRDSMRIDRIAQFRF |
| Number of Associated Samples | 67 |
| Number of Associated Scaffolds | 133 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 98.50 % |
| % of genes from short scaffolds (< 2000 bps) | 90.98 % |
| Associated GOLD sequencing projects | 52 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.47 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (79.699 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland (42.857 % of family members) |
| Environment Ontology (ENVO) | Unclassified (54.887 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Sediment (saline) (45.113 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 47.76% β-sheet: 0.00% Coil/Unstructured: 52.24% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.47 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 133 Family Scaffolds |
|---|---|---|
| PF04015 | DUF362 | 3.76 |
| PF13740 | ACT_6 | 2.26 |
| PF01654 | Cyt_bd_oxida_I | 2.26 |
| PF07729 | FCD | 1.50 |
| PF00206 | Lyase_1 | 1.50 |
| PF13458 | Peripla_BP_6 | 1.50 |
| PF13579 | Glyco_trans_4_4 | 1.50 |
| PF03060 | NMO | 1.50 |
| PF14559 | TPR_19 | 1.50 |
| PF02518 | HATPase_c | 1.50 |
| PF00465 | Fe-ADH | 1.50 |
| PF01934 | HepT-like | 1.50 |
| PF00202 | Aminotran_3 | 1.50 |
| PF00392 | GntR | 0.75 |
| PF02954 | HTH_8 | 0.75 |
| PF04290 | DctQ | 0.75 |
| PF02350 | Epimerase_2 | 0.75 |
| PF01048 | PNP_UDP_1 | 0.75 |
| PF00005 | ABC_tran | 0.75 |
| PF00144 | Beta-lactamase | 0.75 |
| PF01061 | ABC2_membrane | 0.75 |
| PF01594 | AI-2E_transport | 0.75 |
| PF04909 | Amidohydro_2 | 0.75 |
| PF02915 | Rubrerythrin | 0.75 |
| PF03460 | NIR_SIR_ferr | 0.75 |
| PF14489 | QueF | 0.75 |
| PF02626 | CT_A_B | 0.75 |
| PF01208 | URO-D | 0.75 |
| PF04126 | Cyclophil_like | 0.75 |
| PF00701 | DHDPS | 0.75 |
| PF09350 | DJC28_CD | 0.75 |
| PF07298 | NnrU | 0.75 |
| PF00834 | Ribul_P_3_epim | 0.75 |
| PF01553 | Acyltransferase | 0.75 |
| PF12838 | Fer4_7 | 0.75 |
| PF02085 | Cytochrom_CIII | 0.75 |
| PF13404 | HTH_AsnC-type | 0.75 |
| PF08323 | Glyco_transf_5 | 0.75 |
| PF14710 | Nitr_red_alph_N | 0.75 |
| PF14765 | PS-DH | 0.75 |
| PF13557 | Phenol_MetA_deg | 0.75 |
| PF02401 | LYTB | 0.75 |
| PF02899 | Phage_int_SAM_1 | 0.75 |
| PF13378 | MR_MLE_C | 0.75 |
| PF03063 | Prismane | 0.75 |
| PF02882 | THF_DHG_CYH_C | 0.75 |
| PF01170 | UPF0020 | 0.75 |
| PF00141 | peroxidase | 0.75 |
| PF00550 | PP-binding | 0.75 |
| PF00072 | Response_reg | 0.75 |
| PF00398 | RrnaAD | 0.75 |
| PF13527 | Acetyltransf_9 | 0.75 |
| PF00456 | Transketolase_N | 0.75 |
| PF13432 | TPR_16 | 0.75 |
| PF01869 | BcrAD_BadFG | 0.75 |
| PF01943 | Polysacc_synt | 0.75 |
| PF00581 | Rhodanese | 0.75 |
| PF00583 | Acetyltransf_1 | 0.75 |
| PF02579 | Nitro_FeMo-Co | 0.75 |
| PF01475 | FUR | 0.75 |
| PF12695 | Abhydrolase_5 | 0.75 |
| PF01116 | F_bP_aldolase | 0.75 |
| PF00107 | ADH_zinc_N | 0.75 |
| PF09989 | DUF2229 | 0.75 |
| PF02618 | YceG | 0.75 |
| PF01220 | DHquinase_II | 0.75 |
| PF00892 | EamA | 0.75 |
| PF00596 | Aldolase_II | 0.75 |
| PF03746 | LamB_YcsF | 0.75 |
| COG ID | Name | Functional Category | % Frequency in 133 Family Scaffolds |
|---|---|---|---|
| COG2006 | Uncharacterized conserved protein, DUF362 family | Function unknown [S] | 3.76 |
| COG1271 | Cytochrome bd-type quinol oxidase, subunit 1 | Energy production and conversion [C] | 2.26 |
| COG0329 | 4-hydroxy-tetrahydrodipicolinate synthase/N-acetylneuraminate lyase | Cell wall/membrane/envelope biogenesis [M] | 1.50 |
| COG0337 | 3-dehydroquinate synthetase | Amino acid transport and metabolism [E] | 1.50 |
| COG0371 | Glycerol dehydrogenase or related enzyme, iron-containing ADH family | Energy production and conversion [C] | 1.50 |
| COG0516 | IMP dehydrogenase/GMP reductase | Nucleotide transport and metabolism [F] | 1.50 |
| COG0761 | 4-Hydroxy-3-methylbut-2-enyl diphosphate reductase IspH | Lipid transport and metabolism [I] | 1.50 |
| COG1454 | Alcohol dehydrogenase, class IV | Energy production and conversion [C] | 1.50 |
| COG1802 | DNA-binding transcriptional regulator, GntR family | Transcription [K] | 1.50 |
| COG1979 | Alcohol dehydrogenase YqhD, Fe-dependent ADH family | Energy production and conversion [C] | 1.50 |
| COG2070 | NAD(P)H-dependent flavin oxidoreductase YrpB, nitropropane dioxygenase family | General function prediction only [R] | 1.50 |
| COG2186 | DNA-binding transcriptional regulator, FadR family | Transcription [K] | 1.50 |
| COG2361 | HEPN domain protein, predicted toxin of MNT-HEPN system | Defense mechanisms [V] | 1.50 |
| COG2445 | Uncharacterized HEPN domain protein YutE, UPF0331/DUF86 family | General function prediction only [R] | 1.50 |
| COG0021 | Transketolase | Carbohydrate transport and metabolism [G] | 0.75 |
| COG0030 | 16S rRNA A1518 and A1519 N6-dimethyltransferase RsmA/KsgA/DIM1 (may also have DNA glycosylase/AP lyase activity) | Translation, ribosomal structure and biogenesis [J] | 0.75 |
| COG0036 | Pentose-5-phosphate-3-epimerase | Carbohydrate transport and metabolism [G] | 0.75 |
| COG0116 | 23S rRNA G2445 N2-methylase RlmL | Translation, ribosomal structure and biogenesis [J] | 0.75 |
| COG0190 | 5,10-methylene-tetrahydrofolate dehydrogenase/Methenyl tetrahydrofolate cyclohydrolase | Coenzyme transport and metabolism [H] | 0.75 |
| COG0191 | Fructose/tagatose bisphosphate aldolase | Carbohydrate transport and metabolism [G] | 0.75 |
| COG0286 | Type I restriction-modification system, DNA methylase subunit | Defense mechanisms [V] | 0.75 |
| COG0297 | Glycogen synthase | Carbohydrate transport and metabolism [G] | 0.75 |
| COG0376 | Catalase (peroxidase I) | Inorganic ion transport and metabolism [P] | 0.75 |
| COG0381 | UDP-N-acetylglucosamine 2-epimerase | Cell wall/membrane/envelope biogenesis [M] | 0.75 |
| COG0407 | Uroporphyrinogen-III decarboxylase HemE | Coenzyme transport and metabolism [H] | 0.75 |
| COG0438 | Glycosyltransferase involved in cell wall bisynthesis | Cell wall/membrane/envelope biogenesis [M] | 0.75 |
| COG0628 | Predicted PurR-regulated permease PerM | General function prediction only [R] | 0.75 |
| COG0686 | Alanine dehydrogenase (includes sporulation protein SpoVN) | Amino acid transport and metabolism [E] | 0.75 |
| COG0707 | UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase | Cell wall/membrane/envelope biogenesis [M] | 0.75 |
| COG0735 | Fe2+ or Zn2+ uptake regulation protein Fur/Zur | Inorganic ion transport and metabolism [P] | 0.75 |
| COG0757 | 3-dehydroquinate dehydratase | Amino acid transport and metabolism [E] | 0.75 |
| COG0775 | Nucleoside phosphorylase/nucleosidase, includes 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase MtnN and futalosine hydrolase MqnB | Nucleotide transport and metabolism [F] | 0.75 |
| COG0813 | Purine-nucleoside phosphorylase | Nucleotide transport and metabolism [F] | 0.75 |
| COG1041 | tRNA G10 N-methylase Trm11 | Translation, ribosomal structure and biogenesis [J] | 0.75 |
| COG1092 | 23S rRNA G2069 N7-methylase RlmK or C1962 C5-methylase RlmI | Translation, ribosomal structure and biogenesis [J] | 0.75 |
| COG1151 | Hydroxylamine reductase (hybrid-cluster protein) | Energy production and conversion [C] | 0.75 |
| COG1152 | CO dehydrogenase/acetyl-CoA synthase alpha subunit | Energy production and conversion [C] | 0.75 |
| COG1540 | 5-oxoprolinase subunit A | Amino acid transport and metabolism [E] | 0.75 |
| COG1559 | Endolytic transglycosylase MltG, terminates peptidoglycan polymerization | Cell wall/membrane/envelope biogenesis [M] | 0.75 |
| COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 0.75 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.75 |
| COG2226 | Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenG | Coenzyme transport and metabolism [H] | 0.75 |
| COG2263 | Predicted RNA methylase | General function prediction only [R] | 0.75 |
| COG2264 | Ribosomal protein L11 methylase PrmA | Translation, ribosomal structure and biogenesis [J] | 0.75 |
| COG2265 | tRNA/tmRNA/rRNA uracil-C5-methylase, TrmA/RlmC/RlmD family | Translation, ribosomal structure and biogenesis [J] | 0.75 |
| COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 0.75 |
| COG2813 | 16S rRNA G1207 or 23S rRNA G1835 methylase RsmC/RlmG | Translation, ribosomal structure and biogenesis [J] | 0.75 |
| COG2820 | Uridine phosphorylase | Nucleotide transport and metabolism [F] | 0.75 |
| COG2890 | Methylase of polypeptide chain release factors | Translation, ribosomal structure and biogenesis [J] | 0.75 |
| COG3959 | Transketolase, N-terminal subunit | Carbohydrate transport and metabolism [G] | 0.75 |
| COG4094 | Uncharacterized membrane protein | Function unknown [S] | 0.75 |
| COG4123 | tRNA1(Val) A37 N6-methylase TrmN6 | Translation, ribosomal structure and biogenesis [J] | 0.75 |
| COG4973 | Site-specific recombinase XerC | Replication, recombination and repair [L] | 0.75 |
| COG4974 | Site-specific recombinase XerD | Replication, recombination and repair [L] | 0.75 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 79.70 % |
| Unclassified | root | N/A | 20.30 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000030|WSSedB1B_c033580 | All Organisms → cellular organisms → Bacteria | 674 | Open in IMG/M |
| 3300000241|BS_KBA_SWE21_205mDRAFT_10074525 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium | 753 | Open in IMG/M |
| 3300000309|WSSedA1BaDRAFT_1004539 | All Organisms → cellular organisms → Bacteria | 2533 | Open in IMG/M |
| 3300000309|WSSedA1BaDRAFT_1008863 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1730 | Open in IMG/M |
| 3300000309|WSSedA1BaDRAFT_1056436 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 627 | Open in IMG/M |
| 3300000309|WSSedA1BaDRAFT_1070251 | Not Available | 564 | Open in IMG/M |
| 3300000310|WSSedA1Ba2DRAFT_1012527 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1050 | Open in IMG/M |
| 3300000310|WSSedA1Ba2DRAFT_1045151 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium | 520 | Open in IMG/M |
| 3300000311|WSSedA1Ba3DRAFT_1007666 | All Organisms → cellular organisms → Bacteria | 2665 | Open in IMG/M |
| 3300000311|WSSedA1Ba3DRAFT_1008188 | Not Available | 2565 | Open in IMG/M |
| 3300000311|WSSedA1Ba3DRAFT_1015992 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1705 | Open in IMG/M |
| 3300000311|WSSedA1Ba3DRAFT_1033059 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1069 | Open in IMG/M |
| 3300000311|WSSedA1Ba3DRAFT_1059153 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 750 | Open in IMG/M |
| 3300000311|WSSedA1Ba3DRAFT_1086088 | Not Available | 605 | Open in IMG/M |
| 3300000786|WSSedA2C2DRAFT_1006296 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium | 997 | Open in IMG/M |
| 3300000786|WSSedA2C2DRAFT_1021704 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 602 | Open in IMG/M |
| 3300000786|WSSedA2C2DRAFT_1021934 | Not Available | 600 | Open in IMG/M |
| 3300000786|WSSedA2C2DRAFT_1030512 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 525 | Open in IMG/M |
| 3300000854|WSSedB2T2DRAFT_1005625 | All Organisms → cellular organisms → Bacteria | 1203 | Open in IMG/M |
| 3300000917|WSSedA2C3DRAFT_1002719 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfosudaceae → Desulfosudis → Desulfosudis oleivorans | 2611 | Open in IMG/M |
| 3300000917|WSSedA2C3DRAFT_1005045 | All Organisms → cellular organisms → Bacteria | 1971 | Open in IMG/M |
| 3300000917|WSSedA2C3DRAFT_1010411 | All Organisms → cellular organisms → Bacteria | 1383 | Open in IMG/M |
| 3300000917|WSSedA2C3DRAFT_1013879 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium | 1188 | Open in IMG/M |
| 3300000917|WSSedA2C3DRAFT_1018552 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium | 1008 | Open in IMG/M |
| 3300000917|WSSedA2C3DRAFT_1021339 | All Organisms → cellular organisms → Bacteria | 929 | Open in IMG/M |
| 3300000917|WSSedA2C3DRAFT_1023464 | Not Available | 879 | Open in IMG/M |
| 3300000917|WSSedA2C3DRAFT_1047213 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 605 | Open in IMG/M |
| 3300001213|JGIcombinedJ13530_102270958 | Not Available | 544 | Open in IMG/M |
| 3300001213|JGIcombinedJ13530_106496311 | All Organisms → cellular organisms → Bacteria | 4296 | Open in IMG/M |
| 3300001279|JGI20214J14112_1015856 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → unclassified Nitrospiraceae → Nitrospiraceae bacterium | 1232 | Open in IMG/M |
| 3300001279|JGI20214J14112_1018957 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium | 1118 | Open in IMG/M |
| 3300001279|JGI20214J14112_1022747 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophobacteraceae → Syntrophobacter → Syntrophobacter fumaroxidans | 1012 | Open in IMG/M |
| 3300001279|JGI20214J14112_1073639 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 545 | Open in IMG/M |
| 3300001281|JGI20213J14113_1006771 | Not Available | 1855 | Open in IMG/M |
| 3300001547|JGI20215J15232_1040216 | All Organisms → cellular organisms → Bacteria | 616 | Open in IMG/M |
| 3300002961|JGI11641J44799_10027434 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1685 | Open in IMG/M |
| 3300002961|JGI11641J44799_10044122 | All Organisms → cellular organisms → Bacteria | 1292 | Open in IMG/M |
| 3300002961|JGI11641J44799_10091083 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → unclassified Syntrophobacterales → Syntrophobacterales bacterium | 858 | Open in IMG/M |
| 3300002961|JGI11641J44799_10126184 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 717 | Open in IMG/M |
| 3300002961|JGI11641J44799_10183506 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 587 | Open in IMG/M |
| 3300002961|JGI11641J44799_10190481 | Not Available | 575 | Open in IMG/M |
| 3300003432|JGI20214J51088_10070276 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2450 | Open in IMG/M |
| 3300003432|JGI20214J51088_10155012 | All Organisms → cellular organisms → Bacteria | 1618 | Open in IMG/M |
| 3300003432|JGI20214J51088_10253558 | All Organisms → cellular organisms → Bacteria | 1221 | Open in IMG/M |
| 3300003432|JGI20214J51088_10296493 | Not Available | 1108 | Open in IMG/M |
| 3300003432|JGI20214J51088_10330585 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Chlorobi → Chlorobia → Chlorobiales → Chlorobiaceae → Chlorobium/Pelodictyon group → Chlorobium → Chlorobium chlorochromatii → Chlorobium chlorochromatii CaD3 | 1034 | Open in IMG/M |
| 3300003432|JGI20214J51088_10660165 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 665 | Open in IMG/M |
| 3300003432|JGI20214J51088_10781159 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → unclassified Syntrophobacterales → Syntrophobacterales bacterium | 618 | Open in IMG/M |
| 3300003432|JGI20214J51088_10962423 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 561 | Open in IMG/M |
| 3300003541|JGI20214J51650_10587538 | All Organisms → cellular organisms → Bacteria | 782 | Open in IMG/M |
| 3300003541|JGI20214J51650_10589633 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 780 | Open in IMG/M |
| 3300003541|JGI20214J51650_10654234 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 737 | Open in IMG/M |
| 3300003541|JGI20214J51650_10847607 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
| 3300003541|JGI20214J51650_10956643 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 598 | Open in IMG/M |
| 3300003541|JGI20214J51650_11155014 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 538 | Open in IMG/M |
| 3300003541|JGI20214J51650_11300945 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 502 | Open in IMG/M |
| 3300004078|Ga0055513_10073450 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales | 749 | Open in IMG/M |
| 3300004079|Ga0055514_10231367 | Not Available | 539 | Open in IMG/M |
| 3300005219|Ga0069004_10033510 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium | 1100 | Open in IMG/M |
| 3300005833|Ga0074472_10884831 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1975 | Open in IMG/M |
| 3300005833|Ga0074472_11406101 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium | 522 | Open in IMG/M |
| 3300006930|Ga0079303_10480463 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium | 534 | Open in IMG/M |
| 3300009009|Ga0105105_10059027 | All Organisms → cellular organisms → Bacteria | 1756 | Open in IMG/M |
| 3300009009|Ga0105105_10177277 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → unclassified Syntrophobacterales → Syntrophobacterales bacterium | 1091 | Open in IMG/M |
| 3300009009|Ga0105105_10668701 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium | 614 | Open in IMG/M |
| 3300009037|Ga0105093_10887876 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
| 3300009075|Ga0105090_10549951 | Not Available | 701 | Open in IMG/M |
| 3300009075|Ga0105090_10892787 | Not Available | 541 | Open in IMG/M |
| 3300009081|Ga0105098_10060368 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1565 | Open in IMG/M |
| 3300009081|Ga0105098_10633659 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 560 | Open in IMG/M |
| 3300009146|Ga0105091_10067742 | All Organisms → cellular organisms → Bacteria | 1604 | Open in IMG/M |
| 3300009165|Ga0105102_10441033 | Not Available | 698 | Open in IMG/M |
| 3300009169|Ga0105097_10743666 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 557 | Open in IMG/M |
| 3300009169|Ga0105097_10928422 | Not Available | 501 | Open in IMG/M |
| 3300009170|Ga0105096_10597368 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 580 | Open in IMG/M |
| 3300009179|Ga0115028_11856667 | Not Available | 526 | Open in IMG/M |
| 3300011340|Ga0151652_12776376 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
| 3300014258|Ga0075315_1047559 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 710 | Open in IMG/M |
| 3300014316|Ga0075339_1003611 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 3194 | Open in IMG/M |
| 3300014322|Ga0075355_1009392 | Not Available | 1892 | Open in IMG/M |
| 3300014323|Ga0075356_1025570 | All Organisms → cellular organisms → Bacteria | 1163 | Open in IMG/M |
| 3300027683|Ga0209392_1044264 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1447 | Open in IMG/M |
| 3300027716|Ga0209682_10038030 | Not Available | 1158 | Open in IMG/M |
| 3300027721|Ga0209492_1040122 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1643 | Open in IMG/M |
| 3300027721|Ga0209492_1139539 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 848 | Open in IMG/M |
| 3300027721|Ga0209492_1233938 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 625 | Open in IMG/M |
| 3300027726|Ga0209285_10142628 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 741 | Open in IMG/M |
| 3300027739|Ga0209575_10013965 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2792 | Open in IMG/M |
| 3300027739|Ga0209575_10017846 | Not Available | 2494 | Open in IMG/M |
| 3300027739|Ga0209575_10028716 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 1994 | Open in IMG/M |
| 3300027739|Ga0209575_10053959 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1466 | Open in IMG/M |
| 3300027739|Ga0209575_10056053 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1437 | Open in IMG/M |
| 3300027762|Ga0209288_10058294 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1168 | Open in IMG/M |
| 3300027762|Ga0209288_10116646 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 845 | Open in IMG/M |
| 3300027792|Ga0209287_10277606 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 642 | Open in IMG/M |
| 3300027796|Ga0209373_10144111 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales | 1048 | Open in IMG/M |
| 3300027796|Ga0209373_10283141 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 679 | Open in IMG/M |
| 3300027796|Ga0209373_10454461 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium | 500 | Open in IMG/M |
| 3300027800|Ga0209800_10115062 | All Organisms → cellular organisms → Bacteria | 1211 | Open in IMG/M |
| 3300027800|Ga0209800_10364263 | Not Available | 598 | Open in IMG/M |
| 3300027841|Ga0209262_10215779 | All Organisms → cellular organisms → Bacteria | 929 | Open in IMG/M |
| 3300027841|Ga0209262_10275893 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium | 817 | Open in IMG/M |
| 3300027871|Ga0209397_10489212 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 610 | Open in IMG/M |
| 3300027885|Ga0209450_10551441 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 843 | Open in IMG/M |
| 3300027887|Ga0208980_10008089 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 6223 | Open in IMG/M |
| 3300027887|Ga0208980_10320118 | Not Available | 898 | Open in IMG/M |
| 3300027890|Ga0209496_10267712 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 844 | Open in IMG/M |
| 3300027900|Ga0209253_10878930 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 630 | Open in IMG/M |
| 3300027956|Ga0209820_1117271 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 728 | Open in IMG/M |
| 3300027972|Ga0209079_10237255 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 622 | Open in IMG/M |
| 3300027975|Ga0209391_10228861 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 761 | Open in IMG/M |
| 3300031834|Ga0315290_10649556 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 912 | Open in IMG/M |
| 3300031873|Ga0315297_10514762 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Magnetospirillum → Magnetospirillum kuznetsovii | 1006 | Open in IMG/M |
| 3300031873|Ga0315297_10560224 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales | 960 | Open in IMG/M |
| 3300031873|Ga0315297_11234200 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 611 | Open in IMG/M |
| 3300031999|Ga0315274_11187430 | Not Available | 757 | Open in IMG/M |
| 3300032053|Ga0315284_10496414 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1482 | Open in IMG/M |
| 3300032156|Ga0315295_10573434 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1144 | Open in IMG/M |
| 3300032156|Ga0315295_11701691 | Not Available | 602 | Open in IMG/M |
| 3300032164|Ga0315283_10460291 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfococcus → Desulfococcus multivorans | 1382 | Open in IMG/M |
| 3300032256|Ga0315271_10813161 | Not Available | 805 | Open in IMG/M |
| 3300032275|Ga0315270_10374882 | Not Available | 904 | Open in IMG/M |
| 3300032397|Ga0315287_10489436 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1460 | Open in IMG/M |
| 3300032397|Ga0315287_10851541 | Not Available | 1069 | Open in IMG/M |
| 3300033414|Ga0316619_10825976 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → unclassified Syntrophobacterales → Syntrophobacterales bacterium | 794 | Open in IMG/M |
| 3300033434|Ga0316613_11187661 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 526 | Open in IMG/M |
| 3300033482|Ga0316627_100935487 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium | 834 | Open in IMG/M |
| 3300033488|Ga0316621_10640745 | All Organisms → cellular organisms → Bacteria | 761 | Open in IMG/M |
| 3300033521|Ga0316616_103623718 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
| 3300033521|Ga0316616_104051213 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
| 3300033557|Ga0316617_102529868 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 533 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Wetland | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland | 42.86% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 18.80% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 9.77% |
| Freshwater | Environmental → Aquatic → Freshwater → Pond → Sediment → Freshwater | 9.02% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 5.26% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 3.01% |
| Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 2.26% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 2.26% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 1.50% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 1.50% |
| Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 0.75% |
| Wetland | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Wetland | 0.75% |
| Wetland | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Wetland | 0.75% |
| Marine | Environmental → Aquatic → Marine → Wetlands → Sediment → Marine | 0.75% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 0.75% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000030 | Wetland microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Feb2011 Site B1 Bulk | Environmental | Open in IMG/M |
| 3300000241 | Marine microbial communities from chronically polluted sediments in the Baltic Sea - site KBB sample SWE 21_20.5m | Environmental | Open in IMG/M |
| 3300000309 | Wetland microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Feb2011 Site A1 Bulk | Environmental | Open in IMG/M |
| 3300000310 | Wetland microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Feb2011 Site A1 Bulk | Environmental | Open in IMG/M |
| 3300000311 | Wetland microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Feb2011 Site A1 Bulk | Environmental | Open in IMG/M |
| 3300000786 | Wetland microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Feb2011 Site A2 Cattail | Environmental | Open in IMG/M |
| 3300000854 | Wetland microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Feb2011 Site B2 Tule | Environmental | Open in IMG/M |
| 3300000917 | Wetland microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Feb2011 Site A2 Cattail | Environmental | Open in IMG/M |
| 3300001213 | Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly) | Environmental | Open in IMG/M |
| 3300001279 | Wetland sediment microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Aug2011 Site B2 Bulk | Environmental | Open in IMG/M |
| 3300001281 | Wetland microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Aug2011 Site A1 Bulk | Environmental | Open in IMG/M |
| 3300001547 | Wetland microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Aug2011 Site C1 Bulk | Environmental | Open in IMG/M |
| 3300002961 | Wetland microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Feb2011 Site A1 Bulk | Environmental | Open in IMG/M |
| 3300003432 | Wetland sediment microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Aug2011 Site B2 Bulk | Environmental | Open in IMG/M |
| 3300003541 | Wetland sediment microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Aug2011 Site B2 Bulk | Environmental | Open in IMG/M |
| 3300004078 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_TuleB_D2 | Environmental | Open in IMG/M |
| 3300004079 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_TuleC_D2 | Environmental | Open in IMG/M |
| 3300005219 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_CattailB_D2 | Environmental | Open in IMG/M |
| 3300005833 | Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.174_CBK | Environmental | Open in IMG/M |
| 3300006930 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Methanogen_OWC | Environmental | Open in IMG/M |
| 3300009009 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
| 3300009037 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 1-3cm March2015 | Environmental | Open in IMG/M |
| 3300009075 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm March2015 | Environmental | Open in IMG/M |
| 3300009081 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
| 3300009146 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm March2015 | Environmental | Open in IMG/M |
| 3300009165 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
| 3300009169 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
| 3300009170 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm May2015 | Environmental | Open in IMG/M |
| 3300009179 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1 | Environmental | Open in IMG/M |
| 3300011340 | Combined Assembly of Wetland Metatranscriptomes | Environmental | Open in IMG/M |
| 3300014258 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_TuleA_D1 | Environmental | Open in IMG/M |
| 3300014316 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_CattailNLC_D1 | Environmental | Open in IMG/M |
| 3300014322 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_CattailA_D1 | Environmental | Open in IMG/M |
| 3300014323 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_CattailB_D1 | Environmental | Open in IMG/M |
| 3300027683 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm May2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027716 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare2Fresh (SPAdes) | Environmental | Open in IMG/M |
| 3300027721 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027726 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 1-3cm March2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027739 | Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Medium cellulose week 11 (SPAdes) | Environmental | Open in IMG/M |
| 3300027762 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm September2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027792 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027796 | Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - High cellulose week 5 (SPAdes) | Environmental | Open in IMG/M |
| 3300027800 | Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - High cellulose week 8 (SPAdes) | Environmental | Open in IMG/M |
| 3300027841 | Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Low cellulose week 11 (SPAdes) | Environmental | Open in IMG/M |
| 3300027871 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027885 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - LWP11 LW (SPAdes) | Environmental | Open in IMG/M |
| 3300027887 | Wetland microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Aug2011 Site A1 Bulk | Environmental | Open in IMG/M |
| 3300027890 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027900 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR (SPAdes) | Environmental | Open in IMG/M |
| 3300027956 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027972 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027975 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm March2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300031834 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_0 | Environmental | Open in IMG/M |
| 3300031873 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G15_0 | Environmental | Open in IMG/M |
| 3300031999 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20 | Environmental | Open in IMG/M |
| 3300032053 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16 | Environmental | Open in IMG/M |
| 3300032156 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G14_0 | Environmental | Open in IMG/M |
| 3300032164 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_0 | Environmental | Open in IMG/M |
| 3300032256 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_top | Environmental | Open in IMG/M |
| 3300032275 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_bottom | Environmental | Open in IMG/M |
| 3300032397 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0 | Environmental | Open in IMG/M |
| 3300033414 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D4_B | Environmental | Open in IMG/M |
| 3300033434 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day10_CT_b | Environmental | Open in IMG/M |
| 3300033482 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D1_C | Environmental | Open in IMG/M |
| 3300033488 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_OW2_C1_D1_C | Environmental | Open in IMG/M |
| 3300033521 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D1_B | Environmental | Open in IMG/M |
| 3300033557 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D2_B | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| WSSedB1B_0335801 | 3300000030 | Wetland | PAAVATAGEEIAAAHADGRPQRDSMRIDRIAQFRY* |
| BS_KBA_SWE21_205mDRAFT_100745251 | 3300000241 | Marine | TAAEKIAAAHADGRPHRDSMHIDKIAQFRLYFVS* |
| WSSedA1BaDRAFT_10045391 | 3300000309 | Wetland | AFCHYLSGYSAVATAGEKIAAAHADGRPQRDSMRIDRIAKFRS* |
| WSSedA1BaDRAFT_10088632 | 3300000309 | Wetland | GAMSSGAFRQYLSGYAAVEAAGEEIAAAHADGRPHRDYRRIDRIAQFG* |
| WSSedA1BaDRAFT_10564362 | 3300000309 | Wetland | LSGPAAVATAGEEIAAAHADGRPQRDSMRVDKLAQFRWY* |
| WSSedA1BaDRAFT_10702511 | 3300000309 | Wetland | LSGPAAVATAGAEIAAAHADGRPQRVYMHIDRTAQFRWL* |
| WSSedA1Ba2DRAFT_10125272 | 3300000310 | Wetland | LSGPAAVATAGEEIAAAHADGRPQRAYMRIDRIAQFR* |
| WSSedA1Ba2DRAFT_10227141 | 3300000310 | Wetland | CRGALSSGAFCHYLSCPAAVATAGEEIAAAHAGGRPQRDSMRIDSRSI* |
| WSSedA1Ba2DRAFT_10451511 | 3300000310 | Wetland | PAAVEVAGEEIAAAHADGRPQRDSMRIDRIAQFRFQ* |
| WSSedA1Ba3DRAFT_10076664 | 3300000311 | Wetland | PSLSWGTASGAFCHYLSGYSAVETAGEKIAAAHADGRPQRDSMRIDRIAKFRS* |
| WSSedA1Ba3DRAFT_10081881 | 3300000311 | Wetland | CHYLSGPAAVATAGEEIAAAHADGRPQRDSMRIDKIAQFRTY* |
| WSSedA1Ba3DRAFT_10159921 | 3300000311 | Wetland | FCHYLSGPAAVATAGEEIAAAHAAGRPQQDSMRIDRIAQFRC* |
| WSSedA1Ba3DRAFT_10330591 | 3300000311 | Wetland | AFCHYLSGPAAVATAGAEIAAAHAGGRPQRDSMRIDRIAQFR* |
| WSSedA1Ba3DRAFT_10591531 | 3300000311 | Wetland | LSGPAAVATAGAEIAAAHADGRPQRDSMHIDRIAQFR* |
| WSSedA1Ba3DRAFT_10860882 | 3300000311 | Wetland | LSSGAFCHYLSGPAAVATAGAEIAAAHADGRPQRVYMHIDRTAQFRWL* |
| WSSedA2C2DRAFT_10062962 | 3300000786 | Wetland | AAVEVAGEEIAAAHADGRPQRDSMRIDRIAQFRFQ* |
| WSSedA2C2DRAFT_10217042 | 3300000786 | Wetland | PAAVATAGEEIAAAHADGRPQRDSMRIGIIAQFRTY* |
| WSSedA2C2DRAFT_10219342 | 3300000786 | Wetland | HYLSGPAAVATAGAEIAAAHADGRPQRVYMHIDRTAQFRWL* |
| WSSedA2C2DRAFT_10305121 | 3300000786 | Wetland | FWQYLRIPAAAEAAGEEIAAAHADGRPHRDSMWIDTIAQFR* |
| WSSedB2T2DRAFT_10056251 | 3300000854 | Wetland | AAVATAGEEIAAAHADGRPQRDSMRIDKIAQFRF* |
| WSSedA2C3DRAFT_10027193 | 3300000917 | Wetland | PAAVATAGEEIAAAHADGRPQRDSMRIDKIAQFRF* |
| WSSedA2C3DRAFT_10050453 | 3300000917 | Wetland | AFCHYLSGPAAVATAGEEIAAAHAAGRPQQDSMRIDRIAQFRY* |
| WSSedA2C3DRAFT_10104111 | 3300000917 | Wetland | SGPAAVATAGAEIAAAHADGRPQRDSMRIETIAQFRYHLL* |
| WSSedA2C3DRAFT_10138791 | 3300000917 | Wetland | AFCHYLSGPAAVATAGAEIAAAHADGRPQRVYMHIDRTAQFRWL* |
| WSSedA2C3DRAFT_10185521 | 3300000917 | Wetland | LSGPAAVEVAGEEIAAAHADGRPQRDSMRIDRIAQFRFQ* |
| WSSedA2C3DRAFT_10213391 | 3300000917 | Wetland | QYLSGPAAVEAAGQEIAAAHADGRPQRDSMRIDKIAQF* |
| WSSedA2C3DRAFT_10234641 | 3300000917 | Wetland | LSSGAFRHYLSGPAAVETAGKEIAAAHADGRPQRDSMRIDTIAQFRWK* |
| WSSedA2C3DRAFT_10472131 | 3300000917 | Wetland | GPAAVATAGEEIAAAHADGRPQRDSMRIGIIAQFRTY* |
| JGIcombinedJ13530_1022709581 | 3300001213 | Wetland | WDYLSGPAAVARAGEKIAAASADGRPQQASMRIDGITQFR* |
| JGIcombinedJ13530_1064963111 | 3300001213 | Wetland | PAAVATAGEEIAAAHAARRPQQDSMRIARIAQFRI* |
| JGI20214J14112_10158562 | 3300001279 | Wetland | SGPAAVATAGEEIAAAHADGRPQRDSMRIDRIAHLWSH* |
| JGI20214J14112_10189571 | 3300001279 | Wetland | GPAAVVTAGEKIAGAHADGRPQRDSMRIDKIAQFRLQ* |
| JGI20214J14112_10227473 | 3300001279 | Wetland | HYLSGPAAVATAGEEIAAAHADGRPQRDSMQIVRIAHLRFKFDISSGLN* |
| JGI20214J14112_10736392 | 3300001279 | Wetland | GPAAVATAGEEIAAAHADGRPQRDSMRIDRIAQFRY* |
| JGI20213J14113_10067711 | 3300001281 | Wetland | YLSGPAAVATAGEEIAAAHADGRPQRDSMHIDRIAQFR* |
| JGI20215J15232_10402162 | 3300001547 | Wetland | SGPAAVATAGEEIAAAHADGRPHRDSMRIDKIAQFRYYRMNKIQ* |
| JGI11641J44799_100274343 | 3300002961 | Wetland | FCHYLSGYSAVETAGEKIAAAHADGRPQRDSMRIDRIAKFRS* |
| JGI11641J44799_100441221 | 3300002961 | Wetland | GALSSGAFRQYLSGYAAVEAAGEEIAAAHADGRPHRDYRRIDRIAQFG* |
| JGI11641J44799_100910831 | 3300002961 | Wetland | HYLSGPAAVATAGAEIAAAHADGRPQRDSMRIDKIAQFRL* |
| JGI11641J44799_101261841 | 3300002961 | Wetland | RGALSSGAYRQYLSGLAAVETAGEEIATAHADGRPHRDSMRIDRIAQFR* |
| JGI11641J44799_101835062 | 3300002961 | Wetland | HYLSGPAAVATAGEEIAAAHADGRPQRDSMRIDKIAQFRTY* |
| JGI11641J44799_101904812 | 3300002961 | Wetland | HYLSGPAAVATAGEEIAAAHAAGRPQQDSMRIDKIAQFRYKFESVGMFT* |
| JGI20214J51088_100702761 | 3300003432 | Wetland | SSGAFRHYLSGPAAVATAGEEIAAAHADGRPHRDSMRIDKIAQFRLH* |
| JGI20214J51088_101550124 | 3300003432 | Wetland | SGLAAVATAGEEIAAAHADGRPQRDSMRIDRIAKFRFYKAIG* |
| JGI20214J51088_102535583 | 3300003432 | Wetland | RGALSSGAFCHYLSGPAAVAPAGEEIAAAHADGRPHRDSMRIDRIAQFRF* |
| JGI20214J51088_102964931 | 3300003432 | Wetland | QYLSGLAAVATAGEEIAAAHADGRPQRDLMWIEKIAQFR* |
| JGI20214J51088_103305853 | 3300003432 | Wetland | YLSGPAAVATAGEEIAAAHADGRPHRDSMRIDRMAQFRF* |
| JGI20214J51088_106601652 | 3300003432 | Wetland | FWQYLSGSAAVATVGEKIAAAHAAGRPQRDSMRIDRIAQFR* |
| JGI20214J51088_107811591 | 3300003432 | Wetland | QYLSGPAAVATAGEEIAAAHADGRPHRDSMRIDIIAQFRLN* |
| JGI20214J51088_109624231 | 3300003432 | Wetland | SSGAFWHYLSGPAAVATAGEEIAAAHADGRPQRGSMRIDRIAQFRFLLFYIFQLNIL* |
| JGI20214J51650_105875381 | 3300003541 | Wetland | YLSGPAAVATAGEEIAAAHADGRPQRDSMRIDRIAQFRF* |
| JGI20214J51650_105896331 | 3300003541 | Wetland | GALSSGAFRHYLSGPAAVATAGEEIAAAHADGRPHRDSMRIDKIAQFRLH* |
| JGI20214J51650_106542341 | 3300003541 | Wetland | FYHYLSGPAAVATAGEEIAAAHADGRPQRDSMRIGRIAQFRYY* |
| JGI20214J51650_108476071 | 3300003541 | Wetland | CQYLSGPAAVATAGEEIAAAHADGRPHRDSMRIEKIAQFRMNLIHALRDVL* |
| JGI20214J51650_109566432 | 3300003541 | Wetland | HYLSGLAAVATAGEEIAAAHADGRPQRDSMRIDGIAQFRNHF* |
| JGI20214J51650_111550141 | 3300003541 | Wetland | YLSGPAAVATAGEEIAAAHADGRPHRVSMRIGRIAQFRF* |
| JGI20214J51650_113009452 | 3300003541 | Wetland | HYLSGPAAVATAGAEIAAAHADGRPQRDSMRIDKIAQFR* |
| Ga0055513_100734502 | 3300004078 | Natural And Restored Wetlands | PSGAFWQYLSGPAAVATAGEKIAAAHADGRPLRDSMGIDKIAQFRFYYYYK* |
| Ga0055514_102313671 | 3300004079 | Natural And Restored Wetlands | LSGPAAVETAGEEIAAAHAEGRPQRDSMWIDTIAQFRLQRLY* |
| Ga0069004_100335102 | 3300005219 | Natural And Restored Wetlands | LSGPAAVETAGEEIAAAHAEGRPQRDSMWIDTIAQFRHNLGGIG* |
| Ga0074472_108848314 | 3300005833 | Sediment (Intertidal) | PKAEMTLGEEIAAAHADGRPHRAYRRIDRIAQFR* |
| Ga0074472_114061012 | 3300005833 | Sediment (Intertidal) | FWHYLSGYAAVEAAGEKSAAAHADGRPLRDSMGFDRIA* |
| Ga0079303_104804632 | 3300006930 | Deep Subsurface | GPAAVATAGEEIAAAHADGRPQRDSMRIDRIAQFR* |
| Ga0105105_100590271 | 3300009009 | Freshwater Sediment | YLSGLAAVATAGEEIAAAHADGRPQRDSMRIDKIAQFRFY* |
| Ga0105105_101772772 | 3300009009 | Freshwater Sediment | GAFWHYLSGPAAVATAGEEIAAAHADGRPHRDSMWIDTIAQFRYK* |
| Ga0105105_106687011 | 3300009009 | Freshwater Sediment | GAFRHYLSGPAAVATAGEKSAAARADGRPQRDSMRIDKIAQFRL* |
| Ga0105093_108878763 | 3300009037 | Freshwater Sediment | ATAGEEIAAAHADGRPQRDSMRIDKIAQFRCHDLAD* |
| Ga0105090_105369721 | 3300009075 | Freshwater Sediment | RRPFLSWALSSGAFCHYLSGPAAVATAGEKIAAAHADGRPHRDSMRIDTIAQFRFK* |
| Ga0105090_105499512 | 3300009075 | Freshwater Sediment | AFCHYLSGPAAVATAGEEIAAAHADGRPQRDSMRIDRIVQFR* |
| Ga0105090_108927871 | 3300009075 | Freshwater Sediment | LPSGAFWHYLSGPAAVATAGEEIAAAHAHGRPQRDSMRIGRIAQFRYQLNR* |
| Ga0105098_100603684 | 3300009081 | Freshwater Sediment | SGAFCHYLSGPAAVATAGAEIAAAHADGRPQRDSMGFDKIAQLRLI* |
| Ga0105098_106336592 | 3300009081 | Freshwater Sediment | YLSGPAAVATAGAEIAAVHADGRPHRDSTCLRRGFGRQVRIGRIAQFRSKLLDKKK* |
| Ga0105091_100677423 | 3300009146 | Freshwater Sediment | AFCHYLSGPAAVATAGEEIAATHADGRPQRDSTCLRRGFGRQVRIDRIAQFR* |
| Ga0105102_104410332 | 3300009165 | Freshwater Sediment | FRHYLSGPAAVATAGAEIAAAHADGRPQRDSMRIDRIVQFR* |
| Ga0105097_107436661 | 3300009169 | Freshwater Sediment | YLSGPAAVETGGEKIAAAHADGRPQRDSMRIDTIAQFR* |
| Ga0105097_109284221 | 3300009169 | Freshwater Sediment | GAFRHYLSGPAAVATVGEEIAAAHADGRPQRGSMRIDRIAQFRYDMRDFSGPRR* |
| Ga0105096_105973681 | 3300009170 | Freshwater Sediment | GEEIAAAHADGRPQRDSMRIDKIAQFRSNCLIFS* |
| Ga0115028_118566671 | 3300009179 | Wetland | AAVATAGEEIAAAHADGRPQRVSMRIDRIAQIRQ* |
| Ga0151652_127763762 | 3300011340 | Wetland | GTIRAAVAAVETAGEEIAAAHADGRPQRDSMRIDRIAQFRF* |
| Ga0075315_10475591 | 3300014258 | Natural And Restored Wetlands | PAAVATAGEKIAAARADGSPQRDSMRIDKIAQFR* |
| Ga0075339_10036111 | 3300014316 | Natural And Restored Wetlands | RQYLSGPAAVATAGEKIAAAHADGRPQRDSMRIDKIAQFRYY* |
| Ga0075355_10093922 | 3300014322 | Natural And Restored Wetlands | YLSGPAAVATAGEEIAAAHADGRPQRDSMRIDTIAQFSN* |
| Ga0075356_10255703 | 3300014323 | Natural And Restored Wetlands | FCQYLSGPAAVATAGEEIAAAHADGRPHRDSMRIDKIAQFSN* |
| Ga0209392_10442642 | 3300027683 | Freshwater Sediment | SSGAFYHYLSGPAAVATAGEEIAAAHADGRPQRDSMRIDRIVQFR |
| Ga0209682_100380301 | 3300027716 | Wetland Sediment | YLNGPAAVEAAGEEIAAAHADGRPQRDSMRIDRIAQFRY |
| Ga0209492_10401221 | 3300027721 | Freshwater Sediment | SSGAFRHYLSGLAAVATAGAEIAAAHADGRPQRDSMRIDKIA |
| Ga0209492_11395391 | 3300027721 | Freshwater Sediment | HRQRRPSLSWGTASGAFCHYLSGLAAVATAGEEIAAAHADGRPQWASMRIDIIAQFR |
| Ga0209492_12339381 | 3300027721 | Freshwater Sediment | YAAVEAAGEEIAAAHADGRPQRDSMRIDTIAQFRWK |
| Ga0209285_101426281 | 3300027726 | Freshwater Sediment | GPAALATAGEEIAAAHADGRPQRDSMRIDKIAQFRCHDLAD |
| Ga0209575_100139651 | 3300027739 | Freshwater | HYLSGPAAVATAGEEIAAAHADGRPHRGSMRIDKIAQLR |
| Ga0209575_100178461 | 3300027739 | Freshwater | SSGAFCHYLSGPAAVATAGEEIAAAHADGRPQRDSMRIDRIAQFRSK |
| Ga0209575_100287164 | 3300027739 | Freshwater | AFRQYLSGPAAVEAADQEIAAAHADGRPQRDSMRIDKIAQF |
| Ga0209575_100539591 | 3300027739 | Freshwater | AAVATAGEEIAAAHADGRPQRDSMRIDRIAQFRYLLSFMG |
| Ga0209575_100560531 | 3300027739 | Freshwater | QFSGAFYLYLSGPAAVATAGEAIAATHADGRPQRAYMRIDRIAQFRS |
| Ga0209288_100582941 | 3300027762 | Freshwater Sediment | YLSGPAAVATAGEEIAAAHADGRPQRDSMWIDTIAQFR |
| Ga0209288_101166461 | 3300027762 | Freshwater Sediment | FYHYLSGPAAVATAGEEIAAAHADGRPQRDSMRIDKIAQFRFY |
| Ga0209287_102776062 | 3300027792 | Freshwater Sediment | FWHYLSGHAAVETAGEEIAAAHADGRPQRDSVRIDKIAQFR |
| Ga0209373_101441111 | 3300027796 | Freshwater | VATAGEEIAAAHADGRPQRDSMRIDTIAQFRYKLQYHSGV |
| Ga0209373_102831411 | 3300027796 | Freshwater | LSGPAAVATAGEEIAAAHADGRPHRDSMRIDKIAQFRF |
| Ga0209373_104544611 | 3300027796 | Freshwater | HYLSGPAAVATAGAEIAAAHADGRPQRASMRVDKIAQFR |
| Ga0209800_101150621 | 3300027800 | Freshwater | FCQYLSGPAAVATAGEEIAAAHADGRPQRDSMRIDRIAQFRLQ |
| Ga0209800_103642631 | 3300027800 | Freshwater | HYLSGPAAVATAGEESAAAHADGRPQRDSMRIDRIAQFR |
| Ga0209262_102157791 | 3300027841 | Freshwater | ALSSGAFWHYLSGPAAVATAGEEIAAAHADGRPHRDSMRIDRIAQFR |
| Ga0209262_102758931 | 3300027841 | Freshwater | RGALSSGAFRHYLSGPAAVATAGEKIAAAHADGRPLRDSMGFDKIAQFRSY |
| Ga0209397_104892121 | 3300027871 | Wetland | HYLSGPAAVATAGAEIAATHADGRPQRDSIRIDKIAHFR |
| Ga0209450_105514412 | 3300027885 | Freshwater Lake Sediment | GPAAVATAGEEIAAAHADGRPQRDSMRIDRIAQFRTY |
| Ga0208980_100080896 | 3300027887 | Wetland | GAFRHYLSGYAAVATAGEEIAAAHADGRPQRDSMRIDTIAQFRWK |
| Ga0208980_103201182 | 3300027887 | Wetland | AAVATAGEEIAAAHADGRPQRDSMRIDKIAQFRTY |
| Ga0209496_102677121 | 3300027890 | Wetland | SGPAAVATAGEEIAAAHADGRPHRDSMRIDKIVQLRLK |
| Ga0209253_108789303 | 3300027900 | Freshwater Lake Sediment | AAVATAGEEIAAAHADGRSHRDSMRIDKIAQFRYQIGNDSGV |
| Ga0209820_11172711 | 3300027956 | Freshwater Sediment | VATAGEEIAAAHADGRPQRDSMRIDKIAQFRCHDLAD |
| Ga0209079_102372551 | 3300027972 | Freshwater Sediment | ALSSGAFWHYLSGHAAVETAGEEIAAAHADGRPQRDSVRIDKIAQFR |
| Ga0209391_102288611 | 3300027975 | Freshwater Sediment | AAVATAGEEIAAAHAHGRPQRDSMRIDKIAQFRSNCLIFS |
| Ga0315290_106495561 | 3300031834 | Sediment | LSSGAFRQYLSGPAAVATAGEEIAAAHADGRPHRGSMRIDKIAQFR |
| Ga0315297_105147622 | 3300031873 | Sediment | LSSGAFWQYLSGSAAVETASEKIAAAHADGRPHRDSMRIDRIAQFRSKLN |
| Ga0315297_105602241 | 3300031873 | Sediment | AAVTTAGEEIAATHADGRPHRDSMRIGKIAQFRYK |
| Ga0315297_112342001 | 3300031873 | Sediment | SGAFRHYLSGPAAVATAGEEIAAAHADGRPQRGSMRIDRIAQFRYQSVK |
| Ga0315274_111874302 | 3300031999 | Sediment | TYLSGLAAVATAGEEIAAAYADGRPQRGSMRIDRIAQFRH |
| Ga0315284_104964141 | 3300032053 | Sediment | FRHYLSGPAAVATAGEEIAAAHADGRPQRGSMRIDRIAQFRYQSVK |
| Ga0315295_105734341 | 3300032156 | Sediment | YLSGLAAVATAGEEIAAAHADGRPQWASMRIDIIAQFR |
| Ga0315295_117016911 | 3300032156 | Sediment | VATAGEEIAAAHADGRPHRDSMRIDRIAQFRYHQN |
| Ga0315283_104602913 | 3300032164 | Sediment | FRQYLSGPAAVATAGEEIAAAHADGRPHRGSMRIDKIAQFR |
| Ga0315271_108131611 | 3300032256 | Sediment | SGAFYQYLSGYAAVATAGEEIAATHADGRPQRDSLRIDRIAQFR |
| Ga0315270_103748821 | 3300032275 | Sediment | SGPAAVETAGEEIAAAHADGRPQRGSMRIDRIAQFRSQ |
| Ga0315287_104894364 | 3300032397 | Sediment | LFSGAFWHYLSGPAAVATAGEEIAAAHADGRPHRDSMRIDRIAQFR |
| Ga0315287_108515412 | 3300032397 | Sediment | LSSGAFRHYLSGLAAVATAGAEIAAAHADGRPQRDSMHIDKIA |
| Ga0316619_108259761 | 3300033414 | Soil | VAAVETAGEEIAAAHADGRPQRDLMGFDRIAQFRL |
| Ga0316613_111876612 | 3300033434 | Soil | FRQYLSGPAAVETASEEIAASHADGRPQRDSMRIDRIAQIRLHSIDSYRHRTYVVA |
| Ga0316627_1009354872 | 3300033482 | Soil | FCHYLSGPAAVATGGEEIAAAHADGRPQRDSMRIDGAQES |
| Ga0316621_106407452 | 3300033488 | Soil | LAAVETAGEEIAAAHADGRPQRVSMRIDRIAQIRQ |
| Ga0316616_1036237181 | 3300033521 | Soil | CQYLIGPAAVATAGEEIAAAHADGRPQRDSMRIDKIAQFRLYFFLPSGRKRP |
| Ga0316616_1040512131 | 3300033521 | Soil | AAVETAGEEIAAAHADGRPQRDSMRIDRIAQFRTYL |
| Ga0316617_1025298681 | 3300033557 | Soil | LSSGAFWQYLSGPAAVATAGEEIAAAHADGRPHRDSMRIDTIAQFRCH |
| ⦗Top⦘ |