


| Basic Information | |
|---|---|
| Family ID | F059414 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 134 |
| Average Sequence Length | 42 residues |
| Representative Sequence | YIDSRGRVGIAVNQGNYSKKFNIEPPGTIFIPRKGAPLKEK |
| Number of Associated Samples | 102 |
| Number of Associated Scaffolds | 134 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 99.25 % |
| % of genes from short scaffolds (< 2000 bps) | 86.57 % |
| Associated GOLD sequencing projects | 94 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.18 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (84.328 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (47.015 % of family members) |
| Environment Ontology (ENVO) | Unclassified (47.015 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (48.507 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 7.25% β-sheet: 2.90% Coil/Unstructured: 89.86% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.18 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 134 Family Scaffolds |
|---|---|---|
| PF12704 | MacB_PCD | 20.15 |
| PF00108 | Thiolase_N | 9.70 |
| PF04542 | Sigma70_r2 | 8.21 |
| PF02803 | Thiolase_C | 4.48 |
| PF09424 | YqeY | 2.99 |
| PF08281 | Sigma70_r4_2 | 2.24 |
| PF13472 | Lipase_GDSL_2 | 2.24 |
| PF13505 | OMP_b-brl | 2.24 |
| PF02472 | ExbD | 1.49 |
| PF13620 | CarboxypepD_reg | 1.49 |
| PF00389 | 2-Hacid_dh | 1.49 |
| PF00206 | Lyase_1 | 0.75 |
| PF03551 | PadR | 0.75 |
| PF05598 | DUF772 | 0.75 |
| PF13490 | zf-HC2 | 0.75 |
| PF00378 | ECH_1 | 0.75 |
| PF01887 | SAM_HAT_N | 0.75 |
| PF05090 | VKG_Carbox | 0.75 |
| PF00528 | BPD_transp_1 | 0.75 |
| PF05726 | Pirin_C | 0.75 |
| PF01344 | Kelch_1 | 0.75 |
| PF00069 | Pkinase | 0.75 |
| PF11946 | DUF3463 | 0.75 |
| PF10604 | Polyketide_cyc2 | 0.75 |
| PF13628 | DUF4142 | 0.75 |
| PF00561 | Abhydrolase_1 | 0.75 |
| COG ID | Name | Functional Category | % Frequency in 134 Family Scaffolds |
|---|---|---|---|
| COG0183 | Acetyl-CoA acetyltransferase | Lipid transport and metabolism [I] | 14.18 |
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 8.21 |
| COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 8.21 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 8.21 |
| COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 8.21 |
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 2.99 |
| COG0848 | Biopolymer transport protein ExbD | Intracellular trafficking, secretion, and vesicular transport [U] | 1.49 |
| COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 0.75 |
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.75 |
| COG1741 | Redox-sensitive bicupin YhaK, pirin superfamily | General function prediction only [R] | 0.75 |
| COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 0.75 |
| COG1912 | Stereoselective (R,S)-S-adenosylmethionine hydrolase (adenosine-forming) | Defense mechanisms [V] | 0.75 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 84.33 % |
| Unclassified | root | N/A | 15.67 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000955|JGI1027J12803_100974855 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 540 | Open in IMG/M |
| 3300000955|JGI1027J12803_104694506 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
| 3300002909|JGI25388J43891_1054525 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 598 | Open in IMG/M |
| 3300004080|Ga0062385_10710187 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 649 | Open in IMG/M |
| 3300004082|Ga0062384_100858456 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 639 | Open in IMG/M |
| 3300004092|Ga0062389_100366301 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1545 | Open in IMG/M |
| 3300004092|Ga0062389_102920567 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 639 | Open in IMG/M |
| 3300004479|Ga0062595_101421011 | Not Available | 634 | Open in IMG/M |
| 3300005167|Ga0066672_10350231 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 964 | Open in IMG/M |
| 3300005468|Ga0070707_101028225 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 789 | Open in IMG/M |
| 3300005554|Ga0066661_10551774 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 689 | Open in IMG/M |
| 3300005554|Ga0066661_10576409 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 670 | Open in IMG/M |
| 3300005557|Ga0066704_10885825 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300005921|Ga0070766_10724810 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 674 | Open in IMG/M |
| 3300006032|Ga0066696_10764885 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
| 3300006046|Ga0066652_102020015 | Not Available | 513 | Open in IMG/M |
| 3300006163|Ga0070715_10067025 | Not Available | 1593 | Open in IMG/M |
| 3300006176|Ga0070765_100567804 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 1069 | Open in IMG/M |
| 3300006755|Ga0079222_10219658 | All Organisms → cellular organisms → Bacteria | 1163 | Open in IMG/M |
| 3300006755|Ga0079222_11674835 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
| 3300006794|Ga0066658_10715948 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 555 | Open in IMG/M |
| 3300006796|Ga0066665_10513763 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 979 | Open in IMG/M |
| 3300006796|Ga0066665_11517597 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
| 3300007255|Ga0099791_10351902 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 706 | Open in IMG/M |
| 3300007258|Ga0099793_10065204 | Not Available | 1635 | Open in IMG/M |
| 3300009038|Ga0099829_10063318 | Not Available | 2783 | Open in IMG/M |
| 3300009038|Ga0099829_10083596 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2450 | Open in IMG/M |
| 3300009038|Ga0099829_11009051 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 690 | Open in IMG/M |
| 3300009088|Ga0099830_10021241 | All Organisms → cellular organisms → Bacteria | 4235 | Open in IMG/M |
| 3300009088|Ga0099830_10910789 | All Organisms → cellular organisms → Bacteria | 727 | Open in IMG/M |
| 3300009089|Ga0099828_11991440 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 508 | Open in IMG/M |
| 3300009137|Ga0066709_104432028 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 513 | Open in IMG/M |
| 3300009143|Ga0099792_11058498 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 544 | Open in IMG/M |
| 3300010043|Ga0126380_10966909 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 714 | Open in IMG/M |
| 3300010047|Ga0126382_11217451 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → unclassified Sphingobacteriales → Sphingobacteriales bacterium | 675 | Open in IMG/M |
| 3300010303|Ga0134082_10439708 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 562 | Open in IMG/M |
| 3300010360|Ga0126372_10972498 | All Organisms → cellular organisms → Bacteria | 858 | Open in IMG/M |
| 3300010360|Ga0126372_12572322 | Not Available | 560 | Open in IMG/M |
| 3300010364|Ga0134066_10014134 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1668 | Open in IMG/M |
| 3300011269|Ga0137392_10159238 | All Organisms → cellular organisms → Bacteria | 1827 | Open in IMG/M |
| 3300011269|Ga0137392_10405931 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1131 | Open in IMG/M |
| 3300011269|Ga0137392_11252470 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 600 | Open in IMG/M |
| 3300011270|Ga0137391_10638501 | All Organisms → cellular organisms → Bacteria | 889 | Open in IMG/M |
| 3300011271|Ga0137393_11627271 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 535 | Open in IMG/M |
| 3300012096|Ga0137389_10114607 | All Organisms → cellular organisms → Bacteria | 2163 | Open in IMG/M |
| 3300012096|Ga0137389_11678417 | Not Available | 531 | Open in IMG/M |
| 3300012096|Ga0137389_11689579 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 529 | Open in IMG/M |
| 3300012189|Ga0137388_10219970 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 1718 | Open in IMG/M |
| 3300012189|Ga0137388_10420384 | Not Available | 1238 | Open in IMG/M |
| 3300012189|Ga0137388_10515402 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1111 | Open in IMG/M |
| 3300012199|Ga0137383_10415224 | Not Available | 986 | Open in IMG/M |
| 3300012199|Ga0137383_10431491 | Not Available | 965 | Open in IMG/M |
| 3300012202|Ga0137363_11357335 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 600 | Open in IMG/M |
| 3300012203|Ga0137399_10642866 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 892 | Open in IMG/M |
| 3300012203|Ga0137399_11636136 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 532 | Open in IMG/M |
| 3300012205|Ga0137362_10241330 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 1560 | Open in IMG/M |
| 3300012207|Ga0137381_10144368 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2044 | Open in IMG/M |
| 3300012208|Ga0137376_10193908 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 1756 | Open in IMG/M |
| 3300012210|Ga0137378_10831785 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 836 | Open in IMG/M |
| 3300012210|Ga0137378_11212529 | Not Available | 670 | Open in IMG/M |
| 3300012211|Ga0137377_10347911 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 1419 | Open in IMG/M |
| 3300012349|Ga0137387_10914144 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 633 | Open in IMG/M |
| 3300012357|Ga0137384_10626415 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 877 | Open in IMG/M |
| 3300012361|Ga0137360_10268943 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1406 | Open in IMG/M |
| 3300012361|Ga0137360_11884744 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 504 | Open in IMG/M |
| 3300012362|Ga0137361_11048608 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 736 | Open in IMG/M |
| 3300012363|Ga0137390_10190277 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2038 | Open in IMG/M |
| 3300012363|Ga0137390_11121759 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 735 | Open in IMG/M |
| 3300012582|Ga0137358_10041546 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3047 | Open in IMG/M |
| 3300012582|Ga0137358_10391765 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 940 | Open in IMG/M |
| 3300012685|Ga0137397_10009826 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 6661 | Open in IMG/M |
| 3300012685|Ga0137397_11271751 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 525 | Open in IMG/M |
| 3300012918|Ga0137396_10970154 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 618 | Open in IMG/M |
| 3300012922|Ga0137394_10587474 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 942 | Open in IMG/M |
| 3300012924|Ga0137413_11178321 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 610 | Open in IMG/M |
| 3300012925|Ga0137419_10485794 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 978 | Open in IMG/M |
| 3300012925|Ga0137419_10719738 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 811 | Open in IMG/M |
| 3300012925|Ga0137419_11331515 | Not Available | 604 | Open in IMG/M |
| 3300012925|Ga0137419_11345599 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 601 | Open in IMG/M |
| 3300012927|Ga0137416_10606293 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 954 | Open in IMG/M |
| 3300014166|Ga0134079_10012655 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2595 | Open in IMG/M |
| 3300014201|Ga0181537_10038346 | All Organisms → cellular organisms → Bacteria | 3278 | Open in IMG/M |
| 3300015053|Ga0137405_1304703 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2465 | Open in IMG/M |
| 3300015241|Ga0137418_10537603 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 928 | Open in IMG/M |
| 3300015241|Ga0137418_11309419 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 505 | Open in IMG/M |
| 3300015264|Ga0137403_10469305 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1132 | Open in IMG/M |
| 3300016270|Ga0182036_10121745 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1812 | Open in IMG/M |
| 3300017943|Ga0187819_10072850 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2045 | Open in IMG/M |
| 3300018090|Ga0187770_10644375 | All Organisms → cellular organisms → Bacteria | 844 | Open in IMG/M |
| 3300018468|Ga0066662_11389427 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 726 | Open in IMG/M |
| 3300020021|Ga0193726_1172928 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 926 | Open in IMG/M |
| 3300020199|Ga0179592_10216832 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 865 | Open in IMG/M |
| 3300020579|Ga0210407_11031993 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 626 | Open in IMG/M |
| 3300020579|Ga0210407_11420713 | Not Available | 514 | Open in IMG/M |
| 3300020581|Ga0210399_11546908 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 513 | Open in IMG/M |
| 3300021046|Ga0215015_10225413 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 711 | Open in IMG/M |
| 3300021170|Ga0210400_11098143 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 644 | Open in IMG/M |
| 3300021420|Ga0210394_10558899 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1006 | Open in IMG/M |
| 3300021432|Ga0210384_10565456 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1022 | Open in IMG/M |
| 3300021433|Ga0210391_10672212 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 812 | Open in IMG/M |
| 3300021479|Ga0210410_10000887 | All Organisms → cellular organisms → Bacteria | 29427 | Open in IMG/M |
| 3300021560|Ga0126371_13411602 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300022726|Ga0242654_10306231 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 586 | Open in IMG/M |
| 3300024288|Ga0179589_10269129 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 760 | Open in IMG/M |
| 3300026328|Ga0209802_1277197 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 561 | Open in IMG/M |
| 3300026515|Ga0257158_1005414 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1784 | Open in IMG/M |
| 3300026537|Ga0209157_1017353 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4562 | Open in IMG/M |
| 3300026538|Ga0209056_10357888 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 951 | Open in IMG/M |
| 3300026557|Ga0179587_11182229 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 503 | Open in IMG/M |
| 3300027370|Ga0209010_1031738 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 905 | Open in IMG/M |
| 3300027545|Ga0209008_1155821 | Not Available | 501 | Open in IMG/M |
| 3300027587|Ga0209220_1123532 | Not Available | 675 | Open in IMG/M |
| 3300027591|Ga0209733_1115754 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 668 | Open in IMG/M |
| 3300027655|Ga0209388_1076785 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 962 | Open in IMG/M |
| 3300027655|Ga0209388_1233106 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 504 | Open in IMG/M |
| 3300027795|Ga0209139_10318214 | Not Available | 546 | Open in IMG/M |
| 3300027862|Ga0209701_10368477 | All Organisms → cellular organisms → Bacteria | 808 | Open in IMG/M |
| 3300027862|Ga0209701_10556265 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
| 3300027882|Ga0209590_10257927 | Not Available | 1113 | Open in IMG/M |
| 3300028536|Ga0137415_11064693 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 621 | Open in IMG/M |
| 3300030618|Ga0311354_10881233 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 836 | Open in IMG/M |
| 3300030618|Ga0311354_11845678 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 524 | Open in IMG/M |
| 3300031236|Ga0302324_100087092 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE0068 | 5363 | Open in IMG/M |
| 3300031718|Ga0307474_11642462 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 504 | Open in IMG/M |
| 3300031768|Ga0318509_10846781 | Not Available | 505 | Open in IMG/M |
| 3300031820|Ga0307473_10322184 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 982 | Open in IMG/M |
| 3300031897|Ga0318520_10050027 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2192 | Open in IMG/M |
| 3300031962|Ga0307479_10190249 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2020 | Open in IMG/M |
| 3300031962|Ga0307479_10712989 | Not Available | 982 | Open in IMG/M |
| 3300032089|Ga0318525_10655318 | Not Available | 535 | Open in IMG/M |
| 3300032091|Ga0318577_10085095 | Not Available | 1466 | Open in IMG/M |
| 3300032174|Ga0307470_11512079 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 558 | Open in IMG/M |
| 3300032180|Ga0307471_100156276 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2204 | Open in IMG/M |
| 3300032180|Ga0307471_103187487 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 581 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 47.01% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 10.45% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 10.45% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 5.22% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 3.73% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.73% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.99% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.24% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.24% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 2.24% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.49% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.49% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.49% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.49% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.75% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.75% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.75% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.75% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.75% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002909 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm | Environmental | Open in IMG/M |
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010364 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
| 3300014201 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaG | Environmental | Open in IMG/M |
| 3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300020021 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c1 | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021046 | Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depth | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022726 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300026328 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes) | Environmental | Open in IMG/M |
| 3300026515 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-03-A | Environmental | Open in IMG/M |
| 3300026537 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 (SPAdes) | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027370 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027545 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027587 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027591 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027655 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027795 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300030618 | II_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
| 3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI1027J12803_1009748551 | 3300000955 | Soil | GEPLLYVDSRGRMTIAVNQGNYSKKFGVEPGASIVVPRRSRKSK* |
| JGI1027J12803_1046945062 | 3300000955 | Soil | GEPLLYVDSRGRMTIAVNQGNYSKKFGVEPGASIVVPPRSRKSK* |
| JGI25388J43891_10545251 | 3300002909 | Grasslands Soil | DPLLFIDSRNRVSIAVNQGDYSKKFGVAPPATIFIPRKGAFLKAK* |
| Ga0062385_107101872 | 3300004080 | Bog Forest Soil | LLYIDSRGRVGIAVNEGNYSKKFTITPPGAIFIPRKGAPLKGK* |
| Ga0062384_1008584561 | 3300004082 | Bog Forest Soil | GDTLLYIDSRGRLGVAVNQGNYSEKFSIRPPGTIFVPRKRKP* |
| Ga0062389_1003663013 | 3300004092 | Bog Forest Soil | DSRGRVGIAVNEGNYSKKFNITPPGTIFIPRKGAPLKGK* |
| Ga0062389_1029205672 | 3300004092 | Bog Forest Soil | DSRGRVGIAVNEGNYSKKFTITPPGAIFIPRKGAPLKGK* |
| Ga0062595_1014210112 | 3300004479 | Soil | LLYIDSRGRVGIAINQGDFGRKYNIHPPGTIFIPRKGLPFKGR* |
| Ga0066672_103502311 | 3300005167 | Soil | LLFIDSRDRVSIAVNQGNYSKKFNVEPPGAIFIPRKGAPLKEK* |
| Ga0070707_1010282251 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | LLYQDSRGRIAIAINQGNYSRKFAIEPPGTIFIPRKGALLKR* |
| Ga0066661_105517742 | 3300005554 | Soil | SLLFIDSRNRVSIAVNQGDYSRKFGVEPPGTIFIPRKGAFVKAR* |
| Ga0066661_105764092 | 3300005554 | Soil | DSRNRVSIAVNQGDYSRKFGVEPPGTIFIPRKGAFLKVR* |
| Ga0066704_108858251 | 3300005557 | Soil | VAVGESLLYVDSRGRVGIAVNQGSYSKKFNVMPPEKIFIPRKGLPFRVR* |
| Ga0070766_107248102 | 3300005921 | Soil | LYIDSRGRVGIANNEGNYAKKFDVNPPGTIFIPRKGAAHK* |
| Ga0066696_107648852 | 3300006032 | Soil | GDSLLFIDSRNRVSIAVNQGDYSRKFGVEHPGTIFIPRKGAFVKAR* |
| Ga0066652_1020200151 | 3300006046 | Soil | VDSRGRVGIAVNQGSYSKQFEVAPPGTIFIPRKGVALKSK* |
| Ga0070715_100670251 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | QDSRGRIAIAINQGNYSRKFAIEPPGTIFIPRKGALLKR* |
| Ga0070765_1005678042 | 3300006176 | Soil | RGRVSIAVNQGNYSKKFAVEPPGTISIPRKGVPTKGR* |
| Ga0079222_102196582 | 3300006755 | Agricultural Soil | LLYVDSRGRVGIAVNQGNYSIQFDVTPPGTIFIARKGIPFKTK* |
| Ga0079222_116748352 | 3300006755 | Agricultural Soil | YVDSRGRVGIAVNQGSYSKQFGVTPPASIFVARKGIPIKTK* |
| Ga0066658_107159481 | 3300006794 | Soil | IDSRGRVSIAVNQGDYSRKFSVEPPATIFILRKGAFLKPR* |
| Ga0066665_105137632 | 3300006796 | Soil | FIDSRNRVSIAVNQGDYSRKFGVEPPGTIFIPRKGVFLKVR* |
| Ga0066665_115175972 | 3300006796 | Soil | GDSLLFIDSRDRVSIAVNQGNYSKKFNVEPPGAIFIPRKGAPLKEK* |
| Ga0099791_103519022 | 3300007255 | Vadose Zone Soil | GDSLLYVDSRGRVGIANNQGNYSKKFDVTPPATIFIPRKGVPIKGK* |
| Ga0099793_100652042 | 3300007258 | Vadose Zone Soil | LLVIDSRGRVSIAVNQGNYSKKFNVEPPGTMFIPRKGAPLKER* |
| Ga0099829_100633184 | 3300009038 | Vadose Zone Soil | DSLLFVDSRGRVSIAINQGNYSKKYNVEPPGTVFIPRKGAALKEK* |
| Ga0099829_100835962 | 3300009038 | Vadose Zone Soil | VSVAMNQGNYSKKFGIEPPATIFIPRNGPFVKDK* |
| Ga0099829_110090512 | 3300009038 | Vadose Zone Soil | YIDSRGRVGIALSQGNYSRKFSITPPGTISIPRKGAPIKGK* |
| Ga0099830_100212417 | 3300009088 | Vadose Zone Soil | SRDRVSIAINQSNYSKKFGVEPPGTIFIPRKGAAIKDK* |
| Ga0099830_109107891 | 3300009088 | Vadose Zone Soil | VDSRGRVGIAISQGNYARKFNINLPGIIFIPRKGTPIKGK* |
| Ga0099828_119914401 | 3300009089 | Vadose Zone Soil | MDVPVGESLLYVDSRGRVGIAISQGNYARKFNINPPGTIFIPRKGTPIKGK* |
| Ga0066709_1044320282 | 3300009137 | Grasslands Soil | SLLFIDSRNRVSIAVNQGDYSRKFGVEPPGTIFIPRKGAFLKVR* |
| Ga0099792_110584982 | 3300009143 | Vadose Zone Soil | GDSLLFIDSRDRVSISVNQGNYSKKFNIEPPATIFIPRKSPFTRSM* |
| Ga0126380_109669091 | 3300010043 | Tropical Forest Soil | FMDVPVGDSLLYQDSRGRIGIAVNQGNFSKKFNIEPPATIFVPRKGASLAKNAKQSR* |
| Ga0126382_112174511 | 3300010047 | Tropical Forest Soil | PVGDSLLYQDSRGRIGIAINQGNYSKKFGIEPPAKIFIPRKGAAIGKSH* |
| Ga0134082_104397082 | 3300010303 | Grasslands Soil | SLLFIDSRNRVSIAVNQGDYSRKFGVEPPGTIFIPRKGVFLKVR* |
| Ga0126372_109724982 | 3300010360 | Tropical Forest Soil | RGRVGVAVNQGNYSKTFSVTPPASISIPRKGLPLKGK* |
| Ga0126372_125723221 | 3300010360 | Tropical Forest Soil | SVGEPLLYVDSRGRVGVAINQGNYSRMFNVMPPANIFIFRKGVPIKGK* |
| Ga0134066_100141341 | 3300010364 | Grasslands Soil | SRGRVGIAINQGNYSKQFGVTPPAPVFIARKGIPLKTK* |
| Ga0137392_101592385 | 3300011269 | Vadose Zone Soil | SRGRVGIAVNQGNYSKKFDVKPPGTIFIARKGISLKTK* |
| Ga0137392_104059312 | 3300011269 | Vadose Zone Soil | PVGEVLLFIDSRDRVSIAINQGNYSKKFNVESPGTIFIPRKGPAIKDK* |
| Ga0137392_112524702 | 3300011269 | Vadose Zone Soil | SRGRVGIAINQGSYARKFNVTPPEKIFIPRKGALVKFR* |
| Ga0137391_106385013 | 3300011270 | Vadose Zone Soil | DSRGRVGIAISQGNYARKFNINPPGTIFIPRKGTPLKGK* |
| Ga0137393_116272712 | 3300011271 | Vadose Zone Soil | SRGRVGIAISQGNYARKFNINPPGTIFIPRKGTPLKGK* |
| Ga0137389_101146073 | 3300012096 | Vadose Zone Soil | ESLLYVDSRGRVGIAVNQGSYSKKFNVMPPEKIFIQRKGVPIKFR* |
| Ga0137389_116784172 | 3300012096 | Vadose Zone Soil | LLYVDSRGRLGIAINQGNYSKKFNLAPPGTIFIPRKGAPLKGK* |
| Ga0137389_116895791 | 3300012096 | Vadose Zone Soil | GESLLYVDSRERVGIAVNQGSYSKKFNIMPPEKIFISRKGVPIKFR* |
| Ga0137388_102199701 | 3300012189 | Vadose Zone Soil | DSRGRVGIANNQGNYSKKFDVMPPGTIFIPRKGAPIKGK* |
| Ga0137388_104203842 | 3300012189 | Vadose Zone Soil | GDSLLYVDSRGRVGIAINQGNYSKKYNLAPPGTIFIPRKGAPLKGK* |
| Ga0137388_105154021 | 3300012189 | Vadose Zone Soil | DSRGRVGIALNQDNYARKFKITPPEKIFIPRKGVPIRGR* |
| Ga0137383_104152241 | 3300012199 | Vadose Zone Soil | IDSRGRVGIALSQGNYSRKFSITPPGTISIPRKGAPIKGK* |
| Ga0137383_104314912 | 3300012199 | Vadose Zone Soil | LLYIDSRGRVGIALSQGNYSRKFSITPPGTISIPRKGAPIKGK* |
| Ga0137363_113573352 | 3300012202 | Vadose Zone Soil | RVGIAINQGSYSRKFNIEPPGKIFIPRKGVPIKVR* |
| Ga0137399_106428662 | 3300012203 | Vadose Zone Soil | DSRGRVGIAINEGNYSKKFDVTPPATIFIPRKGAPIKGK* |
| Ga0137399_116361361 | 3300012203 | Vadose Zone Soil | RGRVGIAVNEGNYSKKFDVTPPGTIFIPRRGAPFKGK* |
| Ga0137362_102413301 | 3300012205 | Vadose Zone Soil | IDYRGGGAIGNNRGNYSKKFDVTPPGTIFIPRKGSPIKGK* |
| Ga0137381_101443682 | 3300012207 | Vadose Zone Soil | DRVSIAINRGNYSKKFNIEPPGTIFIPRKGAPIKDK* |
| Ga0137376_101939081 | 3300012208 | Vadose Zone Soil | VSIAVNQGNYSKKFNVEPPGTIFIPLKGAPLKERQIDRHP* |
| Ga0137378_108317852 | 3300012210 | Vadose Zone Soil | SRDRVSIAVSQGSYSKKFSVEPPGTIFIPRKGPFFRPK* |
| Ga0137378_112125292 | 3300012210 | Vadose Zone Soil | RVGIALSQGNYSRKFSITPPGTISIPRKGAPIKGK* |
| Ga0137377_103479112 | 3300012211 | Vadose Zone Soil | RGRVGIALSQGNYSRKFSITPPGTISIPRKGAPIKGK* |
| Ga0137387_109141442 | 3300012349 | Vadose Zone Soil | VGIALSQGNYSRKFSITPPGTISIPRKGAPIKGK* |
| Ga0137384_106264151 | 3300012357 | Vadose Zone Soil | RVSIAVNQGSYSKKFNVEPPGNIFIPRKGLPFKAK* |
| Ga0137360_102689433 | 3300012361 | Vadose Zone Soil | YIDSRGRVGIAVNQGSFARKFNFTPPEKIFIPRKGVPLKVR* |
| Ga0137360_118847442 | 3300012361 | Vadose Zone Soil | GRVGIAINQGSYSRKFNIEPPGKIFIPRKGVPIKVR* |
| Ga0137361_110486081 | 3300012362 | Vadose Zone Soil | VPVGESLLYVDSRGRVGIAINQGSYSRKFNIEPPGEIFIPRKGAPIKFR* |
| Ga0137390_101902772 | 3300012363 | Vadose Zone Soil | GDSLLYIDSRGRVGIAVNEGNYSKKFDVTPPATIFIPRKGAPIKGK* |
| Ga0137390_111217591 | 3300012363 | Vadose Zone Soil | FIDSRDRVSIAVSQGSYSKKFSVEPPGTIFIPRKGPFFRPK* |
| Ga0137358_100415461 | 3300012582 | Vadose Zone Soil | YIDSRGRVGIAVNQGNYSKKFNIEPPGTIFIPRKGAPLKEK* |
| Ga0137358_103917651 | 3300012582 | Vadose Zone Soil | IDSRGHVSIAVNQGNYSKKFNVEPPGAIFIPRKGAPLKER* |
| Ga0137397_100098266 | 3300012685 | Vadose Zone Soil | VGDSLLYIDSRGRVGIAVNQGNYSKKFNIEPPGTIFIPRKGAPLKEK* |
| Ga0137397_112717512 | 3300012685 | Vadose Zone Soil | DSRGRVGIANNQGNYSKKFDVTPPGTIFIPRKGVPIKGK* |
| Ga0137396_109701542 | 3300012918 | Vadose Zone Soil | SRGRVGIAINQGSYSRKFNIEPPGKIFIPRKGAPIKFR* |
| Ga0137394_105874741 | 3300012922 | Vadose Zone Soil | VPVGDSLLYIDSRGRVGIAINEGNYSKKFGIMPPGTIFIPRKGTPLKGK* |
| Ga0137413_111783211 | 3300012924 | Vadose Zone Soil | DSRGRVGIAVNQGSYSKKFNIMPPEKIFISRKGVPVKFH* |
| Ga0137419_104857941 | 3300012925 | Vadose Zone Soil | GDSLLFIDSRGRVSIAVNQGNYSKKLNVEPPGTIFIPRKGAPLKER* |
| Ga0137419_107197381 | 3300012925 | Vadose Zone Soil | LFIDSRNRVSIAVNQGDYSRKFGVEPPGTIFIPRKGAFLKAR* |
| Ga0137419_113315152 | 3300012925 | Vadose Zone Soil | DLLLYIDSRGRVGIAVNEGNYSKKHDVTPPGTIFILRKGAPFKGK* |
| Ga0137419_113455992 | 3300012925 | Vadose Zone Soil | GDSLLFIDSRDRVSVAVNQGNYSRKFNVEPPATIFIPRRGAPIKGK* |
| Ga0137416_106062931 | 3300012927 | Vadose Zone Soil | ALLFIDSRGRVSIAVNQGNYSKKFNVEPPGTIFIPRKGAPFKER* |
| Ga0134079_100126551 | 3300014166 | Grasslands Soil | RVSIAVNQGNYSKKFNIEPPGAIFIPRKGAPLKEK* |
| Ga0181537_100383461 | 3300014201 | Bog | GRLGVAVNQGNYSKKFNVEPPVEIFIPRKGAPLKNK* |
| Ga0137405_13047034 | 3300015053 | Vadose Zone Soil | MDVPVGDSLLYQDSRGRIGIAVNQGNYSKRFGIEPPAKVFIPRKGAALGKKN* |
| Ga0137418_105376033 | 3300015241 | Vadose Zone Soil | DSRDRVSIAVNQGNYSKKFNVEPPGAIFIPRKGVPLKEK* |
| Ga0137418_113094192 | 3300015241 | Vadose Zone Soil | RGRVGIANNQGNYSKKFDITPPGTIFIPRKGAPLKGK* |
| Ga0137403_104693052 | 3300015264 | Vadose Zone Soil | EPLLYTDSRGRIGIAVNQGNYSKKFSIEPPGTIFVPRKGAALKR* |
| Ga0182036_101217453 | 3300016270 | Soil | LLYIDSRGRVAIAVNQGNYARKFGIAPPASLFIPKKAAALKSARH |
| Ga0187819_100728502 | 3300017943 | Freshwater Sediment | VGDTLLYIDSRGRVGIAINQGNYSKKFNIEPPGTIFIPRKGVALKSK |
| Ga0187770_106443751 | 3300018090 | Tropical Peatland | DSRDRVSIAVNQASYAKKFNIEPPGTLFIPRKGSPIKGK |
| Ga0066662_113894271 | 3300018468 | Grasslands Soil | YIDSRGRVGIALSQGNYSRKFSITPPGTISIPRKGAPIKGK |
| Ga0193726_11729281 | 3300020021 | Soil | DSRGRVGIANNEGNYAKKFKFSPPGMIFIPRKGGTR |
| Ga0179592_102168321 | 3300020199 | Vadose Zone Soil | YVDSRGRVGIAVNQGSYSKKFNIMPPEKIFISRKGVPVKFR |
| Ga0210407_110319932 | 3300020579 | Soil | RGRVSIAVNQGNYSKKFGVEPPGTISIPRKGVPTKGR |
| Ga0210407_114207132 | 3300020579 | Soil | TLLYIDSRGRLGLAVNQGNYSEKFNVRPPGTVFVPRKGASKSKP |
| Ga0210399_115469081 | 3300020581 | Soil | SRGRVGIANNEGNYAKKFDITPPGTVFIPRKGAPLKGK |
| Ga0215015_102254132 | 3300021046 | Soil | LYIDSRGRVGIANNEGNYSKKFGITPPGTIFIPRRGAPIQGRS |
| Ga0210400_110981432 | 3300021170 | Soil | LYIDSRGRVGIAVNQDNYSRKFSIAPPAKILIPRKGLPFKAR |
| Ga0210394_105588991 | 3300021420 | Soil | SRGRVSIAVNQGNYSKKFNVEPPGTIFIPRKGTPIRDR |
| Ga0210384_105654561 | 3300021432 | Soil | DSRGRVGIANNEGNYAKKFDVNPPGTIFIPRKGAARKDK |
| Ga0210391_106722121 | 3300021433 | Soil | LYIDSRGRVGLAVNQGNYSEKFNVRPPGAILIPRKASR |
| Ga0210410_1000088729 | 3300021479 | Soil | VGIAINQGSYTKKFNIAPPEKIFIPRKGTPMKVVRRPAA |
| Ga0126371_134116022 | 3300021560 | Tropical Forest Soil | RVGIAINQGDYSKKFNITPPGTIFIPRKSAFTRTK |
| Ga0242654_103062311 | 3300022726 | Soil | DSRGRVAIAVNQGNYSKKFNIEPPGAIFIPRKGAPLKEK |
| Ga0179589_102691291 | 3300024288 | Vadose Zone Soil | SRGRVGIAVNQGSYSKKFNIMPPEKIFISRKGVPVKFH |
| Ga0209802_12771971 | 3300026328 | Soil | SLLFIDSRNRVSIAVNQGDYSRKFGVEPPGTIFIPRKGAFLKVR |
| Ga0257158_10054143 | 3300026515 | Soil | SRDRVSIAINQGNYSKKFSVEPHGTIFIPRKGAPLKEK |
| Ga0209157_10173531 | 3300026537 | Soil | RNRVSIAVNQGDYSRKFGVEPPGTIFIPRKGVFLKVR |
| Ga0209056_103578883 | 3300026538 | Soil | GDSLLFIDSRDRVSIAVNQGNYSKKFNVEPPGAIFIPRKGAPLKEK |
| Ga0179587_111822292 | 3300026557 | Vadose Zone Soil | DRVSVAVNQGNYSRKFNVEPPATVFIPRRAAPIKGK |
| Ga0209010_10317383 | 3300027370 | Forest Soil | ATLLYIDSRGRVGLAVNQGNYSEKFNIRPPGAILIPRKTSG |
| Ga0209008_11558211 | 3300027545 | Forest Soil | VAVGDSLLYINSRGRLGVAVNQGDYSKKFNITPPAEIFIPRKGAAIKK |
| Ga0209220_11235322 | 3300027587 | Forest Soil | LLFIDSRGRVSIAVNQGNYSKKFNVEPPGTIFIPRKGAPLKER |
| Ga0209733_11157541 | 3300027591 | Forest Soil | DSLLFIDSRGRVSIAVNQGNYSRKFSVEPPGTIFIPRKGAPLKER |
| Ga0209388_10767852 | 3300027655 | Vadose Zone Soil | VGDSLLYVDSRGRVGIANNQGNYSKKFDVTPPATIFIPRKGSPIKGK |
| Ga0209388_12331061 | 3300027655 | Vadose Zone Soil | GDSLLYVDSRGRVGIANNQGNYSKKFDVTPPATIFIPRKGVPIKGK |
| Ga0209139_103182142 | 3300027795 | Bog Forest Soil | YIDSRGRLGVAVNQGDYSKKFNIKPPGEIFVPRKGAAIKGR |
| Ga0209701_103684771 | 3300027862 | Vadose Zone Soil | MDVPVGESLLYVDSRGRVGIAINQGNYSKKFNLAPPGTIFIPRKGAPLKGK |
| Ga0209701_105562652 | 3300027862 | Vadose Zone Soil | RGRVGIAISQGNYARKFNINPPGTIFIPRKGTPIKGK |
| Ga0209590_102579272 | 3300027882 | Vadose Zone Soil | DSRGRVGIALSQGNYSRKFSITPPGTISIPRKGTPIKGK |
| Ga0137415_110646931 | 3300028536 | Vadose Zone Soil | RVGIAVNQGSYSKKFNIMPPEKIFISRKGVPVKFR |
| Ga0311354_108812333 | 3300030618 | Palsa | GDTLLYIDSRGRVGLAVNQGNYSEKFNVRPPGTIVIPRKASR |
| Ga0311354_118456781 | 3300030618 | Palsa | LYIDSRGRLGLAVNQGNYSEKFNIRPPGTIFVPRKGAPKNKP |
| Ga0302324_1000870921 | 3300031236 | Palsa | GRLGLAVNQGNYSEKFNIRPPGTIFVPRKGAPKNKP |
| Ga0307474_116424621 | 3300031718 | Hardwood Forest Soil | GIAVNQGNYAKKFNVGVPGTIFIPGKHTPIPSVKR |
| Ga0318509_108467812 | 3300031768 | Soil | MDVPVGDALLYVDSRGRMAVAVNQGNYSRKHDVFPPASVFIPKKNAAKQGR |
| Ga0307473_103221842 | 3300031820 | Hardwood Forest Soil | GVGDALLYIDSRGRVGIAINQGNYSRKFNIVPPVSIFIPKKGASKKSK |
| Ga0318520_100500271 | 3300031897 | Soil | DPLLYLDSRGRVGIAVNQGNYSKQFAVTPPGTIFIPRKGLALKSK |
| Ga0307479_101902493 | 3300031962 | Hardwood Forest Soil | PVGASLLYVDSRGRVGIAVNQGNYSKKFSVEPPATLFIPRKNGAMRSK |
| Ga0307479_107129892 | 3300031962 | Hardwood Forest Soil | MDVLVGGTLLYLDSRGRVGIAVNQGDYSKKFDIKPPVTIFIPRKGAPIKGK |
| Ga0318525_106553181 | 3300032089 | Soil | RGRVGIAVNQGNYSKQFAVTPPGTIFIPRKGLALKSK |
| Ga0318577_100850951 | 3300032091 | Soil | LYLDSRGRVGIAVNQGNYSKQFAVTPPGTIFIPRKGLALKSK |
| Ga0307470_115120791 | 3300032174 | Hardwood Forest Soil | ESLLYVDSRGRVGIAVNQGSYSKKFNIAPPEKIFIPRKGVPKFR |
| Ga0307471_1001562762 | 3300032180 | Hardwood Forest Soil | RVGIANNQGNYSKKFDVAPSASIFIPRKGAPIKGK |
| Ga0307471_1031874872 | 3300032180 | Hardwood Forest Soil | GSVGIAINQGSYARKFNVTPPEKIFIPRKGAFVKFR |
| ⦗Top⦘ |