


| Basic Information | |
|---|---|
| Family ID | F059200 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 134 |
| Average Sequence Length | 42 residues |
| Representative Sequence | GKVTAFIPEPSVEAGAPEGVGVDDAGNVYAGWTAKMAVRRYVK |
| Number of Associated Samples | 95 |
| Number of Associated Scaffolds | 134 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.75 % |
| % of genes near scaffold ends (potentially truncated) | 98.51 % |
| % of genes from short scaffolds (< 2000 bps) | 94.03 % |
| Associated GOLD sequencing projects | 92 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.42 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (69.403 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (31.343 % of family members) |
| Environment Ontology (ENVO) | Unclassified (44.030 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (54.478 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 19.72% Coil/Unstructured: 80.28% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.42 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 134 Family Scaffolds |
|---|---|---|
| PF04392 | ABC_sub_bind | 14.93 |
| PF03401 | TctC | 3.73 |
| PF04909 | Amidohydro_2 | 2.99 |
| PF09837 | DUF2064 | 2.24 |
| PF05935 | Arylsulfotrans | 2.24 |
| PF00355 | Rieske | 1.49 |
| PF10282 | Lactonase | 1.49 |
| PF07690 | MFS_1 | 1.49 |
| PF03466 | LysR_substrate | 1.49 |
| PF00120 | Gln-synt_C | 0.75 |
| PF01152 | Bac_globin | 0.75 |
| PF04199 | Cyclase | 0.75 |
| PF01436 | NHL | 0.75 |
| PF02615 | Ldh_2 | 0.75 |
| PF00596 | Aldolase_II | 0.75 |
| PF13570 | PQQ_3 | 0.75 |
| PF07238 | PilZ | 0.75 |
| PF02826 | 2-Hacid_dh_C | 0.75 |
| PF01315 | Ald_Xan_dh_C | 0.75 |
| PF13683 | rve_3 | 0.75 |
| PF00753 | Lactamase_B | 0.75 |
| PF02738 | MoCoBD_1 | 0.75 |
| PF08241 | Methyltransf_11 | 0.75 |
| PF12850 | Metallophos_2 | 0.75 |
| PF07883 | Cupin_2 | 0.75 |
| PF12974 | Phosphonate-bd | 0.75 |
| PF01068 | DNA_ligase_A_M | 0.75 |
| PF13343 | SBP_bac_6 | 0.75 |
| PF13193 | AMP-binding_C | 0.75 |
| PF00849 | PseudoU_synth_2 | 0.75 |
| COG ID | Name | Functional Category | % Frequency in 134 Family Scaffolds |
|---|---|---|---|
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 14.93 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 3.73 |
| COG0564 | Pseudouridine synthase RluA, 23S rRNA- or tRNA-specific | Translation, ribosomal structure and biogenesis [J] | 0.75 |
| COG1187 | Pseudouridylate synthase RsuA, specific for 16S rRNA U516 and 23S rRNA U2605 | Translation, ribosomal structure and biogenesis [J] | 0.75 |
| COG1423 | ATP-dependent RNA circularization protein, DNA/RNA ligase (PAB1020) family | Replication, recombination and repair [L] | 0.75 |
| COG1793 | ATP-dependent DNA ligase | Replication, recombination and repair [L] | 0.75 |
| COG1878 | Kynurenine formamidase | Amino acid transport and metabolism [E] | 0.75 |
| COG2055 | Malate/lactate/ureidoglycolate dehydrogenase, LDH2 family | Energy production and conversion [C] | 0.75 |
| COG2346 | Truncated hemoglobin YjbI | Inorganic ion transport and metabolism [P] | 0.75 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 69.40 % |
| Unclassified | root | N/A | 30.60 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2140918007|ConsensusfromContig174338 | Not Available | 615 | Open in IMG/M |
| 3300004633|Ga0066395_10190914 | All Organisms → cellular organisms → Bacteria | 1066 | Open in IMG/M |
| 3300005332|Ga0066388_101111878 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1339 | Open in IMG/M |
| 3300005332|Ga0066388_107388753 | Not Available | 552 | Open in IMG/M |
| 3300005332|Ga0066388_108088656 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300005332|Ga0066388_108251225 | Not Available | 520 | Open in IMG/M |
| 3300005434|Ga0070709_10900469 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 699 | Open in IMG/M |
| 3300005436|Ga0070713_100871224 | All Organisms → cellular organisms → Bacteria | 865 | Open in IMG/M |
| 3300005554|Ga0066661_10245861 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1107 | Open in IMG/M |
| 3300005713|Ga0066905_100968747 | Not Available | 748 | Open in IMG/M |
| 3300005764|Ga0066903_101509109 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1269 | Open in IMG/M |
| 3300005764|Ga0066903_102172926 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1070 | Open in IMG/M |
| 3300005764|Ga0066903_102823085 | Not Available | 942 | Open in IMG/M |
| 3300005764|Ga0066903_103977327 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 793 | Open in IMG/M |
| 3300005764|Ga0066903_104730322 | All Organisms → cellular organisms → Bacteria | 724 | Open in IMG/M |
| 3300005764|Ga0066903_105162120 | All Organisms → cellular organisms → Bacteria | 691 | Open in IMG/M |
| 3300005764|Ga0066903_105627507 | Not Available | 659 | Open in IMG/M |
| 3300005764|Ga0066903_106318222 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 619 | Open in IMG/M |
| 3300006175|Ga0070712_101249404 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 647 | Open in IMG/M |
| 3300009137|Ga0066709_104016065 | Not Available | 535 | Open in IMG/M |
| 3300009162|Ga0075423_12177090 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
| 3300009792|Ga0126374_10035236 | All Organisms → cellular organisms → Bacteria | 2395 | Open in IMG/M |
| 3300009792|Ga0126374_11654407 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 531 | Open in IMG/M |
| 3300010043|Ga0126380_11479403 | Not Available | 600 | Open in IMG/M |
| 3300010048|Ga0126373_11666720 | Not Available | 702 | Open in IMG/M |
| 3300010154|Ga0127503_10122537 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 622 | Open in IMG/M |
| 3300010358|Ga0126370_10568467 | Not Available | 972 | Open in IMG/M |
| 3300010359|Ga0126376_10343812 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1319 | Open in IMG/M |
| 3300010360|Ga0126372_10266415 | Not Available | 1481 | Open in IMG/M |
| 3300010360|Ga0126372_10279064 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1454 | Open in IMG/M |
| 3300010360|Ga0126372_12030991 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 622 | Open in IMG/M |
| 3300010361|Ga0126378_10287309 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1745 | Open in IMG/M |
| 3300010361|Ga0126378_11494332 | Not Available | 766 | Open in IMG/M |
| 3300010362|Ga0126377_12248631 | Not Available | 621 | Open in IMG/M |
| 3300010362|Ga0126377_12568518 | Not Available | 585 | Open in IMG/M |
| 3300010366|Ga0126379_10576992 | All Organisms → cellular organisms → Bacteria | 1207 | Open in IMG/M |
| 3300010376|Ga0126381_102417558 | All Organisms → cellular organisms → Bacteria | 754 | Open in IMG/M |
| 3300010397|Ga0134124_12256931 | Not Available | 584 | Open in IMG/M |
| 3300010398|Ga0126383_11081104 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 891 | Open in IMG/M |
| 3300010398|Ga0126383_11561279 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 749 | Open in IMG/M |
| 3300010860|Ga0126351_1106389 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 657 | Open in IMG/M |
| 3300011271|Ga0137393_10971270 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 724 | Open in IMG/M |
| 3300012202|Ga0137363_10005465 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 7840 | Open in IMG/M |
| 3300012209|Ga0137379_10524539 | Not Available | 1092 | Open in IMG/M |
| 3300012469|Ga0150984_111807239 | Not Available | 511 | Open in IMG/M |
| 3300012924|Ga0137413_10168130 | All Organisms → cellular organisms → Bacteria | 1448 | Open in IMG/M |
| 3300012930|Ga0137407_10376721 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1311 | Open in IMG/M |
| 3300012944|Ga0137410_11024625 | Not Available | 704 | Open in IMG/M |
| 3300012944|Ga0137410_11577142 | Not Available | 575 | Open in IMG/M |
| 3300012960|Ga0164301_11007903 | Not Available | 655 | Open in IMG/M |
| 3300012961|Ga0164302_11249725 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae | 597 | Open in IMG/M |
| 3300012971|Ga0126369_10323884 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium altum | 1552 | Open in IMG/M |
| 3300012971|Ga0126369_11798601 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 701 | Open in IMG/M |
| 3300012971|Ga0126369_11924284 | Not Available | 680 | Open in IMG/M |
| 3300012984|Ga0164309_10926822 | Not Available | 712 | Open in IMG/M |
| 3300014489|Ga0182018_10732685 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300014883|Ga0180086_1074095 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 843 | Open in IMG/M |
| 3300015371|Ga0132258_11856946 | Not Available | 1518 | Open in IMG/M |
| 3300016270|Ga0182036_10493018 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 969 | Open in IMG/M |
| 3300016270|Ga0182036_10806827 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 765 | Open in IMG/M |
| 3300016341|Ga0182035_10031297 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 3439 | Open in IMG/M |
| 3300016341|Ga0182035_11916484 | Not Available | 538 | Open in IMG/M |
| 3300016357|Ga0182032_11776478 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300016357|Ga0182032_11813967 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300016371|Ga0182034_10143415 | All Organisms → cellular organisms → Bacteria | 1783 | Open in IMG/M |
| 3300016371|Ga0182034_11362176 | Not Available | 620 | Open in IMG/M |
| 3300016387|Ga0182040_10841352 | All Organisms → cellular organisms → Bacteria | 758 | Open in IMG/M |
| 3300016387|Ga0182040_11482735 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
| 3300016387|Ga0182040_11936630 | Not Available | 506 | Open in IMG/M |
| 3300017955|Ga0187817_10714615 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 639 | Open in IMG/M |
| 3300017975|Ga0187782_10613047 | All Organisms → cellular organisms → Bacteria | 837 | Open in IMG/M |
| 3300020199|Ga0179592_10091572 | All Organisms → cellular organisms → Bacteria | 1396 | Open in IMG/M |
| 3300020580|Ga0210403_10019273 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 5449 | Open in IMG/M |
| 3300021170|Ga0210400_11277611 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 589 | Open in IMG/M |
| 3300021377|Ga0213874_10055818 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1225 | Open in IMG/M |
| 3300021432|Ga0210384_11719997 | Not Available | 533 | Open in IMG/M |
| 3300021560|Ga0126371_12662154 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 606 | Open in IMG/M |
| 3300021861|Ga0213853_10739747 | All Organisms → cellular organisms → Bacteria | 1085 | Open in IMG/M |
| 3300021861|Ga0213853_10863525 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 596 | Open in IMG/M |
| 3300025905|Ga0207685_10846716 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 506 | Open in IMG/M |
| 3300025929|Ga0207664_10477947 | All Organisms → cellular organisms → Bacteria | 1114 | Open in IMG/M |
| 3300026067|Ga0207678_10306767 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 1364 | Open in IMG/M |
| 3300026355|Ga0257149_1002920 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1907 | Open in IMG/M |
| 3300027903|Ga0209488_10520740 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 870 | Open in IMG/M |
| 3300029990|Ga0311336_10895116 | Not Available | 768 | Open in IMG/M |
| 3300031543|Ga0318516_10587240 | All Organisms → cellular organisms → Bacteria | 636 | Open in IMG/M |
| 3300031545|Ga0318541_10019845 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 3202 | Open in IMG/M |
| 3300031546|Ga0318538_10436874 | All Organisms → cellular organisms → Bacteria | 709 | Open in IMG/M |
| 3300031561|Ga0318528_10467317 | All Organisms → cellular organisms → Bacteria | 677 | Open in IMG/M |
| 3300031573|Ga0310915_10390634 | All Organisms → cellular organisms → Bacteria | 988 | Open in IMG/M |
| 3300031573|Ga0310915_10805808 | All Organisms → cellular organisms → Bacteria | 660 | Open in IMG/M |
| 3300031640|Ga0318555_10414992 | All Organisms → cellular organisms → Bacteria | 729 | Open in IMG/M |
| 3300031680|Ga0318574_10027295 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2852 | Open in IMG/M |
| 3300031682|Ga0318560_10317728 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 840 | Open in IMG/M |
| 3300031682|Ga0318560_10422086 | Not Available | 722 | Open in IMG/M |
| 3300031708|Ga0310686_106827128 | Not Available | 1430 | Open in IMG/M |
| 3300031719|Ga0306917_10730425 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 777 | Open in IMG/M |
| 3300031724|Ga0318500_10529043 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi | 594 | Open in IMG/M |
| 3300031744|Ga0306918_10232106 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1402 | Open in IMG/M |
| 3300031763|Ga0318537_10337006 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
| 3300031771|Ga0318546_10292334 | All Organisms → cellular organisms → Bacteria | 1127 | Open in IMG/M |
| 3300031779|Ga0318566_10517921 | Not Available | 583 | Open in IMG/M |
| 3300031792|Ga0318529_10016653 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2862 | Open in IMG/M |
| 3300031792|Ga0318529_10374339 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 663 | Open in IMG/M |
| 3300031793|Ga0318548_10665069 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 505 | Open in IMG/M |
| 3300031795|Ga0318557_10245295 | All Organisms → cellular organisms → Bacteria | 820 | Open in IMG/M |
| 3300031859|Ga0318527_10162979 | All Organisms → cellular organisms → Bacteria | 938 | Open in IMG/M |
| 3300031859|Ga0318527_10500431 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 518 | Open in IMG/M |
| 3300031880|Ga0318544_10431178 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300031890|Ga0306925_12004175 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 546 | Open in IMG/M |
| 3300031893|Ga0318536_10140394 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1226 | Open in IMG/M |
| 3300031893|Ga0318536_10644515 | Not Available | 528 | Open in IMG/M |
| 3300031897|Ga0318520_10510955 | Not Available | 742 | Open in IMG/M |
| 3300031910|Ga0306923_10995165 | All Organisms → cellular organisms → Bacteria | 911 | Open in IMG/M |
| 3300031910|Ga0306923_11227732 | All Organisms → cellular organisms → Bacteria | 800 | Open in IMG/M |
| 3300031912|Ga0306921_10893343 | All Organisms → cellular organisms → Bacteria | 1009 | Open in IMG/M |
| 3300031912|Ga0306921_11138323 | All Organisms → cellular organisms → Bacteria | 872 | Open in IMG/M |
| 3300031912|Ga0306921_11628994 | Not Available | 700 | Open in IMG/M |
| 3300031941|Ga0310912_10889340 | Not Available | 686 | Open in IMG/M |
| 3300031941|Ga0310912_11410950 | Not Available | 526 | Open in IMG/M |
| 3300031941|Ga0310912_11505211 | Not Available | 506 | Open in IMG/M |
| 3300031942|Ga0310916_11245620 | Not Available | 614 | Open in IMG/M |
| 3300031954|Ga0306926_10148842 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 2898 | Open in IMG/M |
| 3300031954|Ga0306926_11397223 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 812 | Open in IMG/M |
| 3300031959|Ga0318530_10374760 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 590 | Open in IMG/M |
| 3300032039|Ga0318559_10571891 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 527 | Open in IMG/M |
| 3300032052|Ga0318506_10440177 | Not Available | 578 | Open in IMG/M |
| 3300032065|Ga0318513_10557026 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
| 3300032067|Ga0318524_10642925 | Not Available | 559 | Open in IMG/M |
| 3300032068|Ga0318553_10342957 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 782 | Open in IMG/M |
| 3300032068|Ga0318553_10436713 | Not Available | 686 | Open in IMG/M |
| 3300032090|Ga0318518_10271811 | All Organisms → cellular organisms → Bacteria | 870 | Open in IMG/M |
| 3300033289|Ga0310914_10711231 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 900 | Open in IMG/M |
| 3300033289|Ga0310914_10869960 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 800 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 31.34% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 15.67% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 15.67% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 10.45% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.72% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.99% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.99% |
| Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 1.49% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.75% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.75% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.75% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.75% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil | 0.75% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.75% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.75% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.75% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.75% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.75% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.75% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.75% |
| Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.75% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.75% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.75% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.75% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.75% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2140918007 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Active_all | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010154 | Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010860 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-2 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300014489 | Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG | Environmental | Open in IMG/M |
| 3300014883 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT760_16_10D | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Host-Associated | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300021861 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026355 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-02-A | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300029990 | I_Fen_N2 coassembly | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031763 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
| 3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
| 3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
| 3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
| 3300031859 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25 | Environmental | Open in IMG/M |
| 3300031880 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
| 3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
| 3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
| 3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
| 3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
| 3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
| 3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| A_all_C_00941670 | 2140918007 | Soil | GKVTAFIPTPSAEATPEGVGFDDAGNVFGSWTGKMMVRRWTKN |
| Ga0066395_101909142 | 3300004633 | Tropical Forest Soil | KDGKVTAFIPEPSAEAGAPEGVGVDDAGNVYGSWTGKMAVRRFTKS* |
| Ga0066388_1011118783 | 3300005332 | Tropical Forest Soil | KVTAFIPEPSVEAGAPEGVGVDDAGNVYAGWTAKMAVRRYVRQ* |
| Ga0066388_1073887531 | 3300005332 | Tropical Forest Soil | GSAKDGRVTAFIPTPSAEIATLEGVGFDDAGNVFGSWTGKMVVRRWTKN* |
| Ga0066388_1080886563 | 3300005332 | Tropical Forest Soil | KVTAFIPEPSVEAGAPEGVGVDDAGNVYAGWTAKMAVRRYARQ* |
| Ga0066388_1082512252 | 3300005332 | Tropical Forest Soil | KDGKVTAFIPEPSAEIGSPEGIGVDDAGTVYAGWTGKMAVRRFVKQ* |
| Ga0070709_109004693 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | DGKVTAFIPEPSAEAGAPEGVGVDDTGNVYGGWVAKMAVRQFVKE* |
| Ga0070713_1008712242 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | KVTAFIPEASAEAQAPEGVGVDDAGNVYGGWTGKMAVRRFVKG* |
| Ga0066661_102458612 | 3300005554 | Soil | IGSAKDGKVIAFIPQLSAEVGSPEGVGVDDAGNVYAGWVAKTAVRRFVKQ* |
| Ga0066905_1009687473 | 3300005713 | Tropical Forest Soil | GKVTAFIPEPSVEAGAPEGVGTDDAGNVYAGWTAKMAVRRYVKQ* |
| Ga0066903_1015091093 | 3300005764 | Tropical Forest Soil | PEPSVEAGAPEGVGVDDAGNVYAGWTAKMAVRRYVK* |
| Ga0066903_1021729263 | 3300005764 | Tropical Forest Soil | IGSAKDGKVNAFIPLTSTEIAAPEGVGVDETGNVYGGWTGKMAARRWNKS* |
| Ga0066903_1028230853 | 3300005764 | Tropical Forest Soil | IPTPSAEATPEGVGFDDAGNVFGSWTGKMMVRRWTKN* |
| Ga0066903_1039773271 | 3300005764 | Tropical Forest Soil | FIPTPNADIATPEGVGFDDAGNVYGGWTGKMAVRRWTKN* |
| Ga0066903_1047303221 | 3300005764 | Tropical Forest Soil | PEPSVEAGAPEGVGVDDAGNIYAGWTAKMAVRRYVK* |
| Ga0066903_1051621202 | 3300005764 | Tropical Forest Soil | FIPATSPETGSPEGVGVDDAGNVYGGWVAKMAVRRFVKQ* |
| Ga0066903_1056275071 | 3300005764 | Tropical Forest Soil | PEPSVEAGAPEGVGVDDAGNVYASWTAKMAVRRYVKQ* |
| Ga0066903_1063182221 | 3300005764 | Tropical Forest Soil | PSAEIATPEGVGFDDAGNVYGSWTGKMAVRRWTKS* |
| Ga0070712_1012494041 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | AFIPEPSVEAGAPEGVGVDDAGNVYAGWTAKMAVRRYVKQ* |
| Ga0066709_1040160651 | 3300009137 | Grasslands Soil | SVKDGKVAAFIPEPSTEMGAPEGIGVDDAGTVYAGWTGKMNFRRFVKQ* |
| Ga0075423_121770902 | 3300009162 | Populus Rhizosphere | SVKDGKVTAFIPEPSVEAGAAEGVGVDDAGNVYAGWTAKMAVRRYVK* |
| Ga0126374_100352364 | 3300009792 | Tropical Forest Soil | SVKDGKITAFIPEPSVEAGAPEGIGVDDAGNVYAGWTAKMAVRRYVK* |
| Ga0126374_116544072 | 3300009792 | Tropical Forest Soil | IPEPSAEASAPEGVGTDDAGNVYAGWTAKMAVRRYVKQ* |
| Ga0126380_114794031 | 3300010043 | Tropical Forest Soil | TAFIPTPSAESPEGVGFDDAGNVFGSWTGKMAVRRWTKS* |
| Ga0126373_116667202 | 3300010048 | Tropical Forest Soil | EPSVEAGAPEGIGVDDAGNVYAGWTAKMAVRRYVK* |
| Ga0127503_101225371 | 3300010154 | Soil | KVTAFIPEPSAEIAAPEGVGVDDAGNVYGGWTGKMNLRRFTKS* |
| Ga0126370_105684671 | 3300010358 | Tropical Forest Soil | KDGKVTAFIPQTSPETGSPEGVGVDDEGNVYASWVAKMNVRRYVKR* |
| Ga0126376_103438121 | 3300010359 | Tropical Forest Soil | NAEIATPEGVGFDDAGNVYGSWTGKMAVRRWTKG* |
| Ga0126372_102664151 | 3300010360 | Tropical Forest Soil | IPTPNAEIETPEGVGFDDAGNVYGGWTGKMAVRRWTKG* |
| Ga0126372_102790643 | 3300010360 | Tropical Forest Soil | TAFIPEPSVEAGAPEGVGVDDAGNVYAGWTAKMAVRRYVKQ* |
| Ga0126372_120309912 | 3300010360 | Tropical Forest Soil | APEAGAPEGVGVDDGGNVYAGWVAKMNVRRYVKRQ* |
| Ga0126378_102873093 | 3300010361 | Tropical Forest Soil | EPSVEAGAAEGIGVDDAGDVYAGWTAKMAVRRYVKQ* |
| Ga0126378_114943322 | 3300010361 | Tropical Forest Soil | FIPEPSVEAGAAEGIGVDDAGDVYAGWTAKMAVRRYVKQWACGAAL* |
| Ga0126377_122486312 | 3300010362 | Tropical Forest Soil | GSAKDGKVTAFIPTPSAEIATPEGVGFDDAGNVYGSWTGKMAVRRFTKS* |
| Ga0126377_125685182 | 3300010362 | Tropical Forest Soil | GKVTAFIPTPEAESPEGVGFDDAGNVYGSWTGKMAVRRWTKG* |
| Ga0126379_105769921 | 3300010366 | Tropical Forest Soil | IPATSPEVGSPEGVGVDDAGNVYGGWVAKTAVRRFVK* |
| Ga0126381_1024175581 | 3300010376 | Tropical Forest Soil | DGKVTAFIPEPSVEAGAAEGIGVDDAGDVYAGWTAKMAVRRYVKQ* |
| Ga0134124_122569311 | 3300010397 | Terrestrial Soil | KDGKVTAFIPEPSAEMGDPEGVGVDDAGVVYAGWTGKMALRRFVK* |
| Ga0126383_110811041 | 3300010398 | Tropical Forest Soil | FIPTPSAESPEGVGFDDAGNVFGSWTGKMAVRRWTKG* |
| Ga0126383_115612792 | 3300010398 | Tropical Forest Soil | KDGKVTAFIPEVEIGAPEGVGVDDAGNVYGGWTAKMTVRRFVKN* |
| Ga0126351_11063891 | 3300010860 | Boreal Forest Soil | KDGKVTAFIPEPSAEIQAPEGVGVDDAGNVYGGWTGKMTLRRFTKS* |
| Ga0137393_109712701 | 3300011271 | Vadose Zone Soil | NAQIATPEGVGVDNAGNVYGGWTGKMAVRRWTKG* |
| Ga0137363_100054651 | 3300012202 | Vadose Zone Soil | SAKDGKVTAFIPTPEAESPEGVGFDDAGNVYGSWTGKMEVRRWTKG* |
| Ga0137379_105245393 | 3300012209 | Vadose Zone Soil | GKVTAFIPTANAEIATPEGVGVDNAGNVYGGWTGKMAVRRWTKG* |
| Ga0150984_1118072391 | 3300012469 | Avena Fatua Rhizosphere | EASAEAQAPEGVGVDDAGNVYGGWTDKQAFRRFVK* |
| Ga0137413_101681302 | 3300012924 | Vadose Zone Soil | GKVTAFIPQLSAEAGAPEGVGVDDAGNVYAGWVEKKAVRKFVKQ* |
| Ga0137407_103767212 | 3300012930 | Vadose Zone Soil | NAEIATPEGVGVDSAGNVYGGWTGKMAVRRWTKG* |
| Ga0137410_110246252 | 3300012944 | Vadose Zone Soil | AFIPTLNAEIATPEGVGVDNAGNVYGGWTGKMAVRRWTKS* |
| Ga0137410_115771422 | 3300012944 | Vadose Zone Soil | AFIPTLNAEIATPEGVGVDNAGNVYGGWTGKMAVRRWTKG* |
| Ga0164301_110079033 | 3300012960 | Soil | SAEAGEPEGVGMHNTGNVYGGWVAKMAVRQFVKE* |
| Ga0164302_112497252 | 3300012961 | Soil | SVKDGKVTAFIPEPSVEAGAPEGVGVDDAGNVYAGWTAKMAVRRYVKQ* |
| Ga0126369_103238842 | 3300012971 | Tropical Forest Soil | TLNAEIATPEGVGFDDAGNVYGSWTGKMAVRRFTKS* |
| Ga0126369_117986012 | 3300012971 | Tropical Forest Soil | AFVPLPSGEGSPEGVGFDDAGNLYGSWTGKMMVRRWTKG* |
| Ga0126369_119242841 | 3300012971 | Tropical Forest Soil | KVTAFIPEPSAEAGTPEGVGVDDAGNVYGGYTAKMTVRRFVKG* |
| Ga0164309_109268222 | 3300012984 | Soil | SAKDGKVTVFIPTPSAEIATPEGVGFDDTGNVYGSWTGKMAVRRWTKS* |
| Ga0182018_107326851 | 3300014489 | Palsa | MAFIPTPNTEIATPEGVGFDDAGNVYGSWTGKMAVRRWTKS* |
| Ga0180086_10740951 | 3300014883 | Soil | GSAKDGKVTAFIPTPSAEIATPEGVGFDDSGNVYGSWTGKMAVRRWTKN* |
| Ga0132258_118569461 | 3300015371 | Arabidopsis Rhizosphere | FIPTANDASPEGVGFDDAGNVFASWTGKMMVRRWTKG* |
| Ga0182036_104930183 | 3300016270 | Soil | AAFIPEPSVEAGAPEGIGVDDAGNVYAGWTAKMAVRRYVK |
| Ga0182036_108068272 | 3300016270 | Soil | RIGSAKDGKVNAFIPLTSTDIAAPEGVGFDETGNVYGGWTGKMAARRWNKS |
| Ga0182035_100312971 | 3300016341 | Soil | AFIPEPSVEAGAAEGVGVDDAGNVYAGWTAKMAVRRYVKQ |
| Ga0182035_119164842 | 3300016341 | Soil | PSVEAGAPEGVGVDDAGNVYASWTAKMAVRRYVKQ |
| Ga0182032_117764782 | 3300016357 | Soil | KDGKVTAFIPEPSVEAGAPEGIGVDDAGNVYAGWTAKMAVRRYVKQ |
| Ga0182032_118139671 | 3300016357 | Soil | GKVTAFIPEPSVEAGAPEGVGVDDAGNLYAGWTAKMAVRRYVKQ |
| Ga0182034_101434152 | 3300016371 | Soil | GSAKDGKVTSFIPTPNADIATPEGVGFDDAGNVYGGWTGKMAVRRWTKG |
| Ga0182034_113621761 | 3300016371 | Soil | DGKVTAFIPTPSAEIATPEGVGFDDAGNVYGSWTGKMAVRRWTKS |
| Ga0182040_108413521 | 3300016387 | Soil | VKDGKVTAFIPEPSVEAGAPEGIGVDDAGNVYAGWTAKMAVRRYVQ |
| Ga0182040_114827351 | 3300016387 | Soil | KVTAFIPEPSVEAGAPEGIGVDDAGNVYAGWTAKMAVRRYVK |
| Ga0182040_119366302 | 3300016387 | Soil | GSAKDGKVTSFIPTPNADIATPEGVGFDDAGNVYGSWTGKMAVRRWTKG |
| Ga0187817_107146151 | 3300017955 | Freshwater Sediment | VTAFIPTPNAEIATPEGVGFDDAGNVYGSWTGKMAVRRWTKS |
| Ga0187782_106130472 | 3300017975 | Tropical Peatland | GKVTAFIPTPNAEIATPEGVGFDDAGNVYGSWTGKMAVRRWTKN |
| Ga0179592_100915722 | 3300020199 | Vadose Zone Soil | KVTAFIPTANAEIATPEGVGVDNAGNVYGGWTGKMAVRRWTKN |
| Ga0210403_100192731 | 3300020580 | Soil | PTAPDGAGAEGVGVDDAGNVFGSWTDKMTVRRFAKQ |
| Ga0210400_112776112 | 3300021170 | Soil | EPSVEAGAPEGIGVDDAGNVYAGWTAKMAVRRYVK |
| Ga0213874_100558181 | 3300021377 | Plant Roots | DGKVTAFIPEPNADMGGAEGVGVDDAGNVYGGWTNKMALIKYAK |
| Ga0210384_117199971 | 3300021432 | Soil | KVTAFITDTSAPDGAGAEAVGVDDAGNVYGGWTDKMTVKRFSK |
| Ga0126371_126621541 | 3300021560 | Tropical Forest Soil | KDGKVTSFIPTPNADIATPEGVGFDDAGNVYGSWTGKMAVRRWTKS |
| Ga0213853_107397471 | 3300021861 | Watersheds | KDGKVTAFITDTSAPDGAGAEAVGVDDAGNVYGGWTDKMTVKRFSK |
| Ga0213853_108635252 | 3300021861 | Watersheds | FIPTPNAEIATPEGVGVDDAGNVYGGWTGKMAVRRFTKG |
| Ga0207685_108467162 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | SAKDGKVTAFIPEPSAEAGTPEGVGVDDAGNVYGGYTAKMTVRRFVKG |
| Ga0207664_104779471 | 3300025929 | Agricultural Soil | FIPMPSAETGAPEGVGIDNVGNVYGGWVAKMNVRRFVKP |
| Ga0207678_103067671 | 3300026067 | Corn Rhizosphere | PSAEVETPEGVGFDDAGNVYGSWTGKTAVRRWTKG |
| Ga0257149_10029205 | 3300026355 | Soil | MGKVTAFIPTPEAESPEGVGFDDAGNVYGSWTGKMAVRRWTKG |
| Ga0209488_105207402 | 3300027903 | Vadose Zone Soil | AKDGKVTAFIPEPSAEAGTPEGVGVDDAGNVYGGYTAKMTVRRFVKG |
| Ga0311336_108951162 | 3300029990 | Fen | VGTKDGKVTAFIPEPSPEVGSPEGVGVDEAGNVYGGYTSKMAVRRFTKG |
| Ga0318516_105872402 | 3300031543 | Soil | TAFIPEPSVEAGAPEGVGVDDAGNVYAGWTAKMAVRRYVK |
| Ga0318541_100198451 | 3300031545 | Soil | TAFIPEPSVEAGAAEGIGVDDAGDVYAGWTAKMAVRRYVKQ |
| Ga0318538_104368742 | 3300031546 | Soil | AVIAGPSAEAEAPEGVGVDDSGNVYAGWTGKMAVRRFVKQ |
| Ga0318528_104673172 | 3300031561 | Soil | PEPSVEAGAPEGIGVDDAGNVYAGWTAKMAVRRYVK |
| Ga0310915_103906341 | 3300031573 | Soil | SNADIATPEGVGFDDAGNVYGSWTGKMAVRRWTKG |
| Ga0310915_108058081 | 3300031573 | Soil | GKVTAFIPEPSVEAGAPEGIGVDDAGNVYAGWTAKMAVRRYVK |
| Ga0318555_104149922 | 3300031640 | Soil | DGKVTAFIPEPSATAGAPEGVGVDDAGNVYAGWTEKMAVRRFLKQ |
| Ga0318574_100272956 | 3300031680 | Soil | VTAFIPEPSVEAGAPEGIGVDDAGNVYAGWTAKMAVRRYVK |
| Ga0318560_103177281 | 3300031682 | Soil | IPEPSVEAGAPEGIGVDDAGNVYAGWTAKMAVRRYVK |
| Ga0318560_104220862 | 3300031682 | Soil | VTAFIPEPSAEAGAPEGVSVDDAGNVYAGWTAKMAVRRYVK |
| Ga0310686_1068271282 | 3300031708 | Soil | AKDGKVTAFIPEAADIKAAPEGVGVDDAGNVYGGWTAKQAVRRFVKG |
| Ga0306917_107304252 | 3300031719 | Soil | KDGKVTAFIPEPSVEAGAPEGIGVDDAGNVYAGWTAKMAVRRYVK |
| Ga0318500_105290432 | 3300031724 | Soil | PEPSVEAGAPEGVGVDDAGNVYAGWTAKMAVRRYVK |
| Ga0306918_102321061 | 3300031744 | Soil | GSVKDGKVAAFIPEPSVEAGAPEGIGVDDAGNVYAGWTAKMAVRRYVK |
| Ga0318537_103370062 | 3300031763 | Soil | KVTAFIPEPSVEAGAPEGVGVDDAGNLYAGWTAKMAVRRYVKQ |
| Ga0318546_102923341 | 3300031771 | Soil | DRKVTAFIPEPSVEAGAAEGVGVDDAGNVYAGWTAKMAVRRYVKQ |
| Ga0318566_105179211 | 3300031779 | Soil | PEPSATAGAPEGVGVDDAGNVYAGWTEKMAVRRFLKQ |
| Ga0318529_100166534 | 3300031792 | Soil | KDGKVTAFIPEPSVEAGAAEGVGVDDAGNVYAGWTAKMAVRRYVKQ |
| Ga0318529_103743391 | 3300031792 | Soil | GKVTAFIPEPSVEAGAPEGIGVDDAGNVYAGWTAKMAVRRYVQ |
| Ga0318548_106650692 | 3300031793 | Soil | IPEPSVEASAPEGVGTDDAGNVYAGWTAKMAVRRYVKQ |
| Ga0318557_102452951 | 3300031795 | Soil | KDGKVTAFIAGPSAEAEAPEGVGVDDSGNVYAGWTGKMAVRRFVKQ |
| Ga0318527_101629792 | 3300031859 | Soil | RVKDGKVTAFIAGPSAEAEAPEGVGVDDSGNVYAGWTGKMAVRRFVKQ |
| Ga0318527_105004311 | 3300031859 | Soil | VKDGKVTAFIPEPSVEAGVPEGIGVDDAGNVYAGWTAKMAVRRYVK |
| Ga0318544_104311781 | 3300031880 | Soil | IKDGKVTAFIPEPSVEAGAPEGIGVDDTGNVYAGWTAKMAVRRYVK |
| Ga0306925_120041751 | 3300031890 | Soil | DGKVTAFIPEPSPEAGAPEGVGVDDAGNVYAGWTAKMAVRRYVKQ |
| Ga0318536_101403942 | 3300031893 | Soil | KVTAFIAGPSAEAEAPEGVGVDDSGNVYAGWTGKMAVRRFVKQ |
| Ga0318536_106445151 | 3300031893 | Soil | FIPEPSLEAGAPEGVGVDDAGNVYAGWTAKMAVRRYVK |
| Ga0318520_105109552 | 3300031897 | Soil | TAFIPEPSVEAGAPEGIGVDDAGNVYAGWTAKMAVRRYVQ |
| Ga0306923_109951652 | 3300031910 | Soil | KVTAFIPEPSVEAGAAEGVGVDDAGNVYAGWTAKMAVRRYVK |
| Ga0306923_112277322 | 3300031910 | Soil | TPNADIATPEGVGFDDAGNVYGSWTGKMAVRRWTKG |
| Ga0306921_108933431 | 3300031912 | Soil | SFIPTPSAEVATPEGVGFDDAGNVYGSWTGKMAVRRWTKG |
| Ga0306921_111383233 | 3300031912 | Soil | AFIPEPSVEAGAPEGIGVDDAGNVYAGWTAKMAVRRYMK |
| Ga0306921_116289942 | 3300031912 | Soil | AFIPEPSVEAGAPEGIGVDDAGNVYAGWTAKMAVRRYVK |
| Ga0310912_108893401 | 3300031941 | Soil | KDGKVTSFIPTSNADIATPEGVGFDDAGNVYGSWTGKMAVRRWTKG |
| Ga0310912_114109501 | 3300031941 | Soil | EQSIEAGAPEGVGVDDAGNVYAGWTAKMAVRRYVK |
| Ga0310912_115052111 | 3300031941 | Soil | FIPEPSVEAGAPEGVGVDDAGNVYAGWTAKMAVRRYVK |
| Ga0310916_112456201 | 3300031942 | Soil | TAFIPEVEIGAPEGVGVDDAGNVYGGWTGKMTVRRFVKN |
| Ga0306926_101488423 | 3300031954 | Soil | AFIPEPSAEAGAPEGVSVDDAGNVYAGWTAKMAVRRYVK |
| Ga0306926_113972233 | 3300031954 | Soil | KVTAFIPEPSVGAGVPEGVGVDDAGNVYAGWTAKMAVRRYVKE |
| Ga0318530_103747602 | 3300031959 | Soil | GSVKDGKVTAFIPEPSVEAGAPEGVGVDDAGNVYAGWTAKMAVRRYVK |
| Ga0318559_105718911 | 3300032039 | Soil | IPEPSVEAGVAEGIGVDDAGDVYAGWTAKMAVRRYVKQ |
| Ga0318506_104401772 | 3300032052 | Soil | IPEPSLEAGAPEGVGVDDAGNVYAGWTAKMAVRRYVK |
| Ga0318513_105570261 | 3300032065 | Soil | IPEPSVEAGAPEGVGVDDAGNLYAGWTAKMAVRRYVKQ |
| Ga0318524_106429251 | 3300032067 | Soil | NGKVTAFIPEPSVEAGVPEGIGVDDAGNVYAGWTAKMAVRRYVK |
| Ga0318553_103429571 | 3300032068 | Soil | KVTAFIPEPSVEAGTPEGIGVDDAGNVYAGWTAKMAVRRYVK |
| Ga0318553_104367132 | 3300032068 | Soil | GKVTAFIPEPSAEAGAPEGVSVDDAGNVYAGWTAKMAVRRYVK |
| Ga0318518_102718112 | 3300032090 | Soil | VKDGKVTAFIPEPSVEAGAAEGVGVDDAGNVYAGWTAKMAVRRYVKQ |
| Ga0310914_107112313 | 3300033289 | Soil | KVTAFIPEPSVEAGAAEGVGVDDAGNVYAGWTAKMAVRRYVKQ |
| Ga0310914_108699602 | 3300033289 | Soil | GKVTAFIPEPSVEAGAPEGVGVDDAGNVYAGWTAKMAVRRYVK |
| ⦗Top⦘ |