


| Basic Information | |
|---|---|
| Family ID | F058976 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 134 |
| Average Sequence Length | 47 residues |
| Representative Sequence | RITTFGLTYKPTWNTAFKGDYQLLRNAAGVGELEVLSLGVGYQF |
| Number of Associated Samples | 119 |
| Number of Associated Scaffolds | 134 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 2.24 % |
| % of genes near scaffold ends (potentially truncated) | 97.76 % |
| % of genes from short scaffolds (< 2000 bps) | 90.30 % |
| Associated GOLD sequencing projects | 108 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.58 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (99.254 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil (14.925 % of family members) |
| Environment Ontology (ENVO) | Unclassified (39.552 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (55.970 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 43.06% Coil/Unstructured: 56.94% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.58 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 134 Family Scaffolds |
|---|---|---|
| PF04205 | FMN_bind | 63.43 |
| PF02424 | ApbE | 11.19 |
| PF03401 | TctC | 0.75 |
| PF10431 | ClpB_D2-small | 0.75 |
| PF01979 | Amidohydro_1 | 0.75 |
| PF00113 | Enolase_C | 0.75 |
| PF00311 | PEPcase | 0.75 |
| COG ID | Name | Functional Category | % Frequency in 134 Family Scaffolds |
|---|---|---|---|
| COG1477 | FAD:protein FMN transferase ApbE | Posttranslational modification, protein turnover, chaperones [O] | 11.19 |
| COG0148 | Enolase | Carbohydrate transport and metabolism [G] | 0.75 |
| COG2352 | Phosphoenolpyruvate carboxylase | Energy production and conversion [C] | 0.75 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 0.75 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 99.25 % |
| Unclassified | root | N/A | 0.75 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000956|JGI10216J12902_115524105 | Not Available | 515 | Open in IMG/M |
| 3300002557|JGI25381J37097_1001333 | All Organisms → cellular organisms → Bacteria | 3902 | Open in IMG/M |
| 3300002560|JGI25383J37093_10086258 | All Organisms → cellular organisms → Bacteria | 942 | Open in IMG/M |
| 3300002560|JGI25383J37093_10166136 | All Organisms → cellular organisms → Bacteria → FCB group | 581 | Open in IMG/M |
| 3300002908|JGI25382J43887_10225334 | All Organisms → cellular organisms → Bacteria | 881 | Open in IMG/M |
| 3300002909|JGI25388J43891_1014679 | All Organisms → cellular organisms → Bacteria → FCB group | 1425 | Open in IMG/M |
| 3300002912|JGI25386J43895_10020754 | All Organisms → cellular organisms → Bacteria | 1931 | Open in IMG/M |
| 3300002915|JGI25387J43893_1057663 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 561 | Open in IMG/M |
| 3300004114|Ga0062593_100866085 | All Organisms → cellular organisms → Bacteria | 908 | Open in IMG/M |
| 3300004808|Ga0062381_10426976 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 513 | Open in IMG/M |
| 3300005172|Ga0066683_10722860 | All Organisms → cellular organisms → Bacteria → FCB group | 587 | Open in IMG/M |
| 3300005175|Ga0066673_10442302 | All Organisms → cellular organisms → Bacteria → FCB group | 764 | Open in IMG/M |
| 3300005180|Ga0066685_10920685 | All Organisms → cellular organisms → Bacteria → FCB group | 583 | Open in IMG/M |
| 3300005186|Ga0066676_10021390 | All Organisms → cellular organisms → Bacteria | 3388 | Open in IMG/M |
| 3300005441|Ga0070700_100802509 | All Organisms → cellular organisms → Bacteria | 758 | Open in IMG/M |
| 3300005444|Ga0070694_100397937 | All Organisms → cellular organisms → Bacteria | 1078 | Open in IMG/M |
| 3300005446|Ga0066686_10550547 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 784 | Open in IMG/M |
| 3300005467|Ga0070706_101143340 | All Organisms → cellular organisms → Bacteria → FCB group | 716 | Open in IMG/M |
| 3300005468|Ga0070707_102340124 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300005471|Ga0070698_100129174 | All Organisms → cellular organisms → Bacteria | 2483 | Open in IMG/M |
| 3300005536|Ga0070697_100180310 | All Organisms → cellular organisms → Bacteria | 1790 | Open in IMG/M |
| 3300005547|Ga0070693_100440618 | All Organisms → cellular organisms → Bacteria | 912 | Open in IMG/M |
| 3300005558|Ga0066698_10180452 | All Organisms → cellular organisms → Bacteria → FCB group | 1438 | Open in IMG/M |
| 3300005586|Ga0066691_10513936 | All Organisms → cellular organisms → Bacteria → FCB group | 715 | Open in IMG/M |
| 3300005887|Ga0075292_1034145 | All Organisms → cellular organisms → Bacteria → FCB group | 706 | Open in IMG/M |
| 3300006028|Ga0070717_11380472 | All Organisms → cellular organisms → Bacteria → FCB group | 640 | Open in IMG/M |
| 3300006041|Ga0075023_100448328 | All Organisms → cellular organisms → Bacteria → FCB group | 569 | Open in IMG/M |
| 3300006579|Ga0074054_12034373 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300006755|Ga0079222_10845624 | All Organisms → cellular organisms → Bacteria → FCB group | 757 | Open in IMG/M |
| 3300006755|Ga0079222_12569391 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 512 | Open in IMG/M |
| 3300006796|Ga0066665_10484370 | All Organisms → cellular organisms → Bacteria | 1016 | Open in IMG/M |
| 3300006796|Ga0066665_11532991 | All Organisms → cellular organisms → Bacteria → FCB group | 521 | Open in IMG/M |
| 3300006804|Ga0079221_10040182 | All Organisms → cellular organisms → Bacteria | 2040 | Open in IMG/M |
| 3300006804|Ga0079221_11772957 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 505 | Open in IMG/M |
| 3300006845|Ga0075421_100070925 | All Organisms → cellular organisms → Bacteria | 4397 | Open in IMG/M |
| 3300006852|Ga0075433_10115476 | All Organisms → cellular organisms → Bacteria | 2382 | Open in IMG/M |
| 3300006854|Ga0075425_100910770 | All Organisms → cellular organisms → Bacteria | 1005 | Open in IMG/M |
| 3300006854|Ga0075425_101102512 | All Organisms → cellular organisms → Bacteria | 904 | Open in IMG/M |
| 3300006903|Ga0075426_10609189 | All Organisms → cellular organisms → Bacteria → FCB group | 816 | Open in IMG/M |
| 3300006954|Ga0079219_11803130 | All Organisms → cellular organisms → Bacteria → FCB group | 572 | Open in IMG/M |
| 3300007258|Ga0099793_10122308 | All Organisms → cellular organisms → Bacteria | 1218 | Open in IMG/M |
| 3300009012|Ga0066710_100454893 | All Organisms → cellular organisms → Bacteria | 1920 | Open in IMG/M |
| 3300009012|Ga0066710_102337187 | All Organisms → cellular organisms → Bacteria → FCB group | 776 | Open in IMG/M |
| 3300009090|Ga0099827_10120526 | All Organisms → cellular organisms → Bacteria → FCB group | 2112 | Open in IMG/M |
| 3300009100|Ga0075418_10136912 | All Organisms → cellular organisms → Bacteria → FCB group | 2604 | Open in IMG/M |
| 3300009137|Ga0066709_103236422 | All Organisms → cellular organisms → Bacteria → FCB group | 593 | Open in IMG/M |
| 3300009143|Ga0099792_10818243 | All Organisms → cellular organisms → Bacteria → FCB group | 611 | Open in IMG/M |
| 3300009822|Ga0105066_1052307 | All Organisms → cellular organisms → Bacteria → FCB group | 859 | Open in IMG/M |
| 3300010036|Ga0126305_10222917 | All Organisms → cellular organisms → Bacteria → FCB group | 1203 | Open in IMG/M |
| 3300010039|Ga0126309_10103233 | All Organisms → cellular organisms → Bacteria | 1471 | Open in IMG/M |
| 3300010114|Ga0127460_1068969 | All Organisms → cellular organisms → Bacteria → FCB group | 545 | Open in IMG/M |
| 3300010322|Ga0134084_10106969 | All Organisms → cellular organisms → Bacteria → FCB group | 899 | Open in IMG/M |
| 3300010322|Ga0134084_10377305 | All Organisms → cellular organisms → Bacteria → FCB group | 547 | Open in IMG/M |
| 3300010323|Ga0134086_10028363 | All Organisms → cellular organisms → Bacteria → FCB group | 1830 | Open in IMG/M |
| 3300010326|Ga0134065_10512331 | All Organisms → cellular organisms → Bacteria → FCB group | 502 | Open in IMG/M |
| 3300010333|Ga0134080_10168222 | All Organisms → cellular organisms → Bacteria → FCB group | 937 | Open in IMG/M |
| 3300010337|Ga0134062_10100500 | All Organisms → cellular organisms → Bacteria → FCB group | 1241 | Open in IMG/M |
| 3300010337|Ga0134062_10618335 | All Organisms → cellular organisms → Bacteria → FCB group | 560 | Open in IMG/M |
| 3300010356|Ga0116237_11525544 | All Organisms → cellular organisms → Bacteria → FCB group | 547 | Open in IMG/M |
| 3300010362|Ga0126377_11734971 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 699 | Open in IMG/M |
| 3300010371|Ga0134125_11459264 | All Organisms → cellular organisms → Bacteria → FCB group | 745 | Open in IMG/M |
| 3300010401|Ga0134121_10186240 | All Organisms → cellular organisms → Bacteria → FCB group | 1788 | Open in IMG/M |
| 3300011271|Ga0137393_10865280 | All Organisms → cellular organisms → Bacteria → FCB group | 772 | Open in IMG/M |
| 3300012040|Ga0137461_1251312 | All Organisms → cellular organisms → Bacteria → FCB group | 515 | Open in IMG/M |
| 3300012201|Ga0137365_10169522 | All Organisms → cellular organisms → Bacteria → FCB group | 1636 | Open in IMG/M |
| 3300012204|Ga0137374_10692971 | All Organisms → cellular organisms → Bacteria → FCB group | 766 | Open in IMG/M |
| 3300012209|Ga0137379_11411513 | All Organisms → cellular organisms → Bacteria → FCB group | 599 | Open in IMG/M |
| 3300012209|Ga0137379_11640410 | All Organisms → cellular organisms → Bacteria → FCB group | 541 | Open in IMG/M |
| 3300012210|Ga0137378_10118873 | All Organisms → cellular organisms → Bacteria → FCB group | 2437 | Open in IMG/M |
| 3300012355|Ga0137369_11152046 | All Organisms → cellular organisms → Bacteria → FCB group | 503 | Open in IMG/M |
| 3300012530|Ga0136635_10153727 | All Organisms → cellular organisms → Bacteria → FCB group | 763 | Open in IMG/M |
| 3300012683|Ga0137398_11271106 | All Organisms → cellular organisms → Bacteria → FCB group | 500 | Open in IMG/M |
| 3300012922|Ga0137394_11336918 | All Organisms → cellular organisms → Bacteria → FCB group | 578 | Open in IMG/M |
| 3300012927|Ga0137416_11807046 | All Organisms → cellular organisms → Bacteria → FCB group | 558 | Open in IMG/M |
| 3300012955|Ga0164298_10905171 | All Organisms → cellular organisms → Bacteria → FCB group | 642 | Open in IMG/M |
| 3300012984|Ga0164309_11815517 | All Organisms → cellular organisms → Bacteria → FCB group | 523 | Open in IMG/M |
| 3300012986|Ga0164304_10483034 | All Organisms → cellular organisms → Bacteria | 900 | Open in IMG/M |
| 3300013503|Ga0120127_10137984 | All Organisms → cellular organisms → Bacteria → FCB group | 575 | Open in IMG/M |
| 3300014056|Ga0120125_1069414 | All Organisms → cellular organisms → Bacteria | 794 | Open in IMG/M |
| 3300014154|Ga0134075_10368367 | All Organisms → cellular organisms → Bacteria → FCB group | 631 | Open in IMG/M |
| 3300014157|Ga0134078_10179494 | All Organisms → cellular organisms → Bacteria → FCB group | 851 | Open in IMG/M |
| 3300015054|Ga0137420_1019116 | All Organisms → cellular organisms → Bacteria → FCB group | 1227 | Open in IMG/M |
| 3300015357|Ga0134072_10050646 | All Organisms → cellular organisms → Bacteria → FCB group | 1154 | Open in IMG/M |
| 3300015357|Ga0134072_10149221 | All Organisms → cellular organisms → Bacteria → FCB group | 768 | Open in IMG/M |
| 3300015371|Ga0132258_10762362 | All Organisms → cellular organisms → Bacteria | 2438 | Open in IMG/M |
| 3300017659|Ga0134083_10303410 | All Organisms → cellular organisms → Bacteria → FCB group | 678 | Open in IMG/M |
| 3300018071|Ga0184618_10459521 | All Organisms → cellular organisms → Bacteria → FCB group | 535 | Open in IMG/M |
| 3300018082|Ga0184639_10544526 | All Organisms → cellular organisms → Bacteria → FCB group | 578 | Open in IMG/M |
| 3300018089|Ga0187774_11066756 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 569 | Open in IMG/M |
| 3300018468|Ga0066662_10815312 | All Organisms → cellular organisms → Bacteria → FCB group | 907 | Open in IMG/M |
| 3300018482|Ga0066669_10015807 | All Organisms → cellular organisms → Bacteria | 4043 | Open in IMG/M |
| 3300018482|Ga0066669_11468358 | All Organisms → cellular organisms → Bacteria → FCB group | 619 | Open in IMG/M |
| 3300019882|Ga0193713_1034111 | All Organisms → cellular organisms → Bacteria → FCB group | 1486 | Open in IMG/M |
| 3300021081|Ga0210379_10424765 | All Organisms → cellular organisms → Bacteria → FCB group | 588 | Open in IMG/M |
| 3300021413|Ga0193750_1060754 | All Organisms → cellular organisms → Bacteria → FCB group | 764 | Open in IMG/M |
| 3300022222|Ga0226658_10542967 | All Organisms → cellular organisms → Bacteria → FCB group | 514 | Open in IMG/M |
| 3300025922|Ga0207646_11932757 | All Organisms → cellular organisms → Bacteria → FCB group | 502 | Open in IMG/M |
| 3300026075|Ga0207708_10844390 | All Organisms → cellular organisms → Bacteria → FCB group | 790 | Open in IMG/M |
| 3300026277|Ga0209350_1061185 | All Organisms → cellular organisms → Bacteria → FCB group | 1075 | Open in IMG/M |
| 3300026297|Ga0209237_1141578 | All Organisms → cellular organisms → Bacteria | 958 | Open in IMG/M |
| 3300026297|Ga0209237_1232635 | All Organisms → cellular organisms → Bacteria → FCB group | 569 | Open in IMG/M |
| 3300026298|Ga0209236_1093891 | All Organisms → cellular organisms → Bacteria → FCB group | 1363 | Open in IMG/M |
| 3300026309|Ga0209055_1187157 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
| 3300026313|Ga0209761_1184387 | All Organisms → cellular organisms → Bacteria | 942 | Open in IMG/M |
| 3300026314|Ga0209268_1100644 | All Organisms → cellular organisms → Bacteria → FCB group | 791 | Open in IMG/M |
| 3300026314|Ga0209268_1121290 | All Organisms → cellular organisms → Bacteria → FCB group | 658 | Open in IMG/M |
| 3300026320|Ga0209131_1365090 | All Organisms → cellular organisms → Bacteria → FCB group | 537 | Open in IMG/M |
| 3300026327|Ga0209266_1113733 | All Organisms → cellular organisms → Bacteria → FCB group | 1160 | Open in IMG/M |
| 3300026332|Ga0209803_1099860 | All Organisms → cellular organisms → Bacteria | 1188 | Open in IMG/M |
| 3300026335|Ga0209804_1089813 | All Organisms → cellular organisms → Bacteria → FCB group | 1427 | Open in IMG/M |
| 3300026342|Ga0209057_1113304 | All Organisms → cellular organisms → Bacteria | 1044 | Open in IMG/M |
| 3300026524|Ga0209690_1214338 | All Organisms → cellular organisms → Bacteria → FCB group | 608 | Open in IMG/M |
| 3300026538|Ga0209056_10111357 | All Organisms → cellular organisms → Bacteria | 2200 | Open in IMG/M |
| 3300026548|Ga0209161_10488001 | All Organisms → cellular organisms → Bacteria → FCB group | 544 | Open in IMG/M |
| 3300026551|Ga0209648_10239757 | All Organisms → cellular organisms → Bacteria → FCB group | 1351 | Open in IMG/M |
| 3300027716|Ga0209682_10079788 | All Organisms → cellular organisms → Bacteria | 812 | Open in IMG/M |
| 3300027778|Ga0209464_10381496 | All Organisms → cellular organisms → Bacteria → FCB group | 519 | Open in IMG/M |
| 3300027787|Ga0209074_10403692 | All Organisms → cellular organisms → Bacteria → FCB group | 573 | Open in IMG/M |
| 3300027882|Ga0209590_10268028 | All Organisms → cellular organisms → Bacteria | 1092 | Open in IMG/M |
| 3300027903|Ga0209488_10910914 | All Organisms → cellular organisms → Bacteria → FCB group | 616 | Open in IMG/M |
| 3300027909|Ga0209382_10064280 | All Organisms → cellular organisms → Bacteria | 4344 | Open in IMG/M |
| 3300027909|Ga0209382_10412897 | All Organisms → cellular organisms → Bacteria | 1501 | Open in IMG/M |
| 3300028796|Ga0307287_10255108 | All Organisms → cellular organisms → Bacteria → FCB group | 664 | Open in IMG/M |
| 3300028828|Ga0307312_10944933 | All Organisms → cellular organisms → Bacteria → FCB group | 571 | Open in IMG/M |
| 3300031720|Ga0307469_11985789 | All Organisms → cellular organisms → Bacteria → FCB group | 564 | Open in IMG/M |
| 3300031811|Ga0310125_10347857 | All Organisms → cellular organisms → Bacteria → FCB group | 728 | Open in IMG/M |
| 3300031820|Ga0307473_10065757 | All Organisms → cellular organisms → Bacteria | 1793 | Open in IMG/M |
| 3300031938|Ga0308175_100246447 | All Organisms → cellular organisms → Bacteria → FCB group | 1790 | Open in IMG/M |
| 3300031962|Ga0307479_10760437 | All Organisms → cellular organisms → Bacteria | 946 | Open in IMG/M |
| 3300031996|Ga0308176_11522867 | All Organisms → cellular organisms → Bacteria → FCB group | 712 | Open in IMG/M |
| 3300032004|Ga0307414_10343647 | All Organisms → cellular organisms → Bacteria → FCB group | 1278 | Open in IMG/M |
| 3300032004|Ga0307414_10733516 | All Organisms → cellular organisms → Bacteria → FCB group | 897 | Open in IMG/M |
| 3300032126|Ga0307415_101099943 | All Organisms → cellular organisms → Bacteria → FCB group | 744 | Open in IMG/M |
| 3300032174|Ga0307470_10068518 | All Organisms → cellular organisms → Bacteria → FCB group | 1905 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 14.93% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 14.18% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 11.94% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 9.70% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 7.46% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 5.97% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.22% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 4.48% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.99% |
| Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 2.24% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 2.24% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.49% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.49% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 1.49% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 1.49% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.49% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.75% |
| Freshwater Microbial Mat | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Microbial Mat | 0.75% |
| Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 0.75% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 0.75% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.75% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.75% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.75% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.75% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.75% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.75% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.75% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.75% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.75% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.75% |
| Anaerobic Digestor Sludge | Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge | 0.75% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm | Environmental | Open in IMG/M |
| 3300002560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm | Environmental | Open in IMG/M |
| 3300002908 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002909 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm | Environmental | Open in IMG/M |
| 3300002912 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002915 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004808 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare1Fresh | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005887 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_403 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006041 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 | Environmental | Open in IMG/M |
| 3300006579 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009822 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_30_40 | Environmental | Open in IMG/M |
| 3300010036 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26 | Environmental | Open in IMG/M |
| 3300010039 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56 | Environmental | Open in IMG/M |
| 3300010114 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010356 | AD_USDEca | Engineered | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012040 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT746_2 | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012530 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ85 (21.06) | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300013503 | Permafrost microbial communities from Nunavut, Canada - A23_5cm_12M | Environmental | Open in IMG/M |
| 3300014056 | Permafrost microbial communities from Nunavut, Canada - A20_5cm_0M | Environmental | Open in IMG/M |
| 3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
| 3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
| 3300018082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2 | Environmental | Open in IMG/M |
| 3300018089 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019882 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3a2 | Environmental | Open in IMG/M |
| 3300021081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redo | Environmental | Open in IMG/M |
| 3300021413 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c1 | Environmental | Open in IMG/M |
| 3300022222 | Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.BULKMAT1 (v2) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026277 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026297 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026298 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026309 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes) | Environmental | Open in IMG/M |
| 3300026313 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026314 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 (SPAdes) | Environmental | Open in IMG/M |
| 3300026320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026327 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 (SPAdes) | Environmental | Open in IMG/M |
| 3300026332 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes) | Environmental | Open in IMG/M |
| 3300026335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes) | Environmental | Open in IMG/M |
| 3300026342 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 (SPAdes) | Environmental | Open in IMG/M |
| 3300026524 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027716 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare2Fresh (SPAdes) | Environmental | Open in IMG/M |
| 3300027778 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare1Fresh (SPAdes) | Environmental | Open in IMG/M |
| 3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028796 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141 | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031811 | Marine microbial communities from Western Arctic Ocean, Canada - CB11b_Tmax_Bot8 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
| 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Host-Associated | Open in IMG/M |
| 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Host-Associated | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI10216J12902_1155241051 | 3300000956 | Soil | KPVYNVVFKGDYQVRRNRAGVGEDEQLALGVGYEF* |
| JGI25381J37097_10013331 | 3300002557 | Grasslands Soil | RITTLGLTYKPTWNTAFKGDYQWFRNAGGAGEHEVLSLGVGYQF* |
| JGI25383J37093_100862583 | 3300002560 | Grasslands Soil | PAGTARDETLARRITTFGLSYKPTYNTAFKGDYQLLRNKAGSGEADVLSLGIAYQF* |
| JGI25383J37093_101661361 | 3300002560 | Grasslands Soil | RSLARRITTLGVTYKPTWNSAFKGDYQLLRNAAGAGESEVLSLGVGYQF* |
| JGI25382J43887_102253341 | 3300002908 | Grasslands Soil | AGTARDETLARRITTLGLSYKPTYNTAFKGDYQLLRNKAGTGEADVLSLGIGYQF* |
| JGI25388J43891_10146791 | 3300002909 | Grasslands Soil | DRSLARRITTFGVTYKPTWNTAFKGDYALLRNAAGVGESEVLSLGVGYQF* |
| JGI25386J43895_100207541 | 3300002912 | Grasslands Soil | PAGTARDETLARRITTFGLSYKPTYNTAFKGDYQLLRNEAGTGATDVLSLGIGYQF* |
| JGI25387J43893_10576632 | 3300002915 | Grasslands Soil | ASVPAGVTRDRSLARRITTFGVTYKPTWNTAFKGDYQLLRNAAGVGESEVLSLGVGYQF* |
| Ga0062593_1008660851 | 3300004114 | Soil | TTFGLAYKPLYNVVFKGDYQLQRTQSGLAEGELLSLGVGYQF* |
| Ga0062381_104269761 | 3300004808 | Wetland Sediment | RITTFGLSYKPLYNVVLKGDYQLHRNKAGVGEADVLALGIGYQF* |
| Ga0066683_107228601 | 3300005172 | Soil | RRITTFGVTYKPTWNTAFKGDYALLRNAAGVGESEVLSLGLGYQF* |
| Ga0066673_104423023 | 3300005175 | Soil | GVTRDRSLARRITTLGLTYKPTWNTAFKGDYRLLRNAGGAGESEVLSLGVGYQF* |
| Ga0066685_109206852 | 3300005180 | Soil | TTFGLSYKPTYNTAFKGDYQLLRNKAGAGEAEVVSLGIGYQF* |
| Ga0066676_100213906 | 3300005186 | Soil | DETLARRITTFGLSYKPTYNTAFKGDYQLLRNEAGTGATDVLSLGIGYQF* |
| Ga0070700_1008025093 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | TVRNEEFARRITTFGLVYKPTWNTAFKGDYEIRRTAAGTAENETLRLGMGYQF* |
| Ga0070694_1003979373 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | GLVYKPTWNTAFKGDYEIRRTAAGTAENETLRLGMGYQF* |
| Ga0066686_105505472 | 3300005446 | Soil | GVTKDETLNRRITTIGLTYKPTWNTAFKSDYQLVRNVAGAGEYDVLSLGVGYQF* |
| Ga0070706_1011433403 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | GFARRVTTLGLTFKPTWNTAFKGDYTLLRTAAGTGEGEILRLGVGYQF* |
| Ga0070707_1023401242 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | QASVPGGVTRDRTLARRITTFGLTYKPTWNTAFKGDYQLLRNAAGVGEFEVLSLGVGYQF |
| Ga0070698_1001291741 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | TQASVPAGVTRDRSLARRITTFGVTYKPTWNTAFKGDYARLRNAAGLGEFEVLSLGVGYQF* |
| Ga0070697_1001803101 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | TARDETLARRITTFGLCFKPTYNTAFKGDYQLLRNRAGVGETDVLSLGIGYQF* |
| Ga0070693_1004406183 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | VPTGTVRNEEFARRITTFGLVYKPTWNTAFKGDYEIRRTAAGTAENETLRLGMGYQF* |
| Ga0066698_101804521 | 3300005558 | Soil | ATRDRSLARRITTLGVTYKPTWNTAFKGDYQLLRNAAGAGEFEVLSLGVGYQF* |
| Ga0066691_105139363 | 3300005586 | Soil | DPSLARRITTMGLTYKPTWNVAFKGDYQLVRNAAGVGEYDVLSLGVGYQF* |
| Ga0075292_10341452 | 3300005887 | Rice Paddy Soil | GLSYKPVYNVVFKGDYQLRRNRAGVGEDEQLSLGVGYQF* |
| Ga0070717_113804722 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | TFGLTYKPTWNTAFKGDYQLVRNAGGVGEYEVLSLGVGYQF* |
| Ga0075023_1004483282 | 3300006041 | Watersheds | TWKPVWNVALKADYQLHRTRAGTGAFEVASLGVGYQF* |
| Ga0074054_120343732 | 3300006579 | Soil | FGLTYKPLWNVAFKADYQLRDNQAGVGENEVLALGVGYQF* |
| Ga0079222_108456243 | 3300006755 | Agricultural Soil | RISTFGVTYKPTWNTAFKGDYQLVRNAAGSGEHDVLSLGIGFQF* |
| Ga0079222_125693911 | 3300006755 | Agricultural Soil | TTFGLAYKPLYNVVFKGDYQLQRTGSGLAEGELLSLGIGYQF* |
| Ga0066665_104843703 | 3300006796 | Soil | TLARRITTFGLSYKPTYNTAFKGDYQLLRNEAGTGATDVLSLGIGYQF* |
| Ga0066665_115329912 | 3300006796 | Soil | SVPIGIAKHDSLARRITTIGLSYKPTYNTVFKGDYQVLRNRARVGEAEVLSLGLGYQF* |
| Ga0079221_100401821 | 3300006804 | Agricultural Soil | TLGLTYKPSWNTAFKGDYEIVRNTAGVGEREVLSLGIGFQF* |
| Ga0079221_117729571 | 3300006804 | Agricultural Soil | RITTMGLTYKPTWNVAFKGDYQLVRNAAGVGEYDVLNLGVGYQF* |
| Ga0075421_1000709257 | 3300006845 | Populus Rhizosphere | RRITTFGLSYKPVYNVVFKGDYQIRRNRAAAGEDEQLSLGVGYQF* |
| Ga0075433_101154761 | 3300006852 | Populus Rhizosphere | PLFNVAFKGDYEVRRTAASGGVGAGETLRLGIGYQF* |
| Ga0075425_1009107701 | 3300006854 | Populus Rhizosphere | FGLTYKPTWNTAFKGDYEVRRTAAGGGLGEGETLRLGVGYQF* |
| Ga0075425_1011025121 | 3300006854 | Populus Rhizosphere | RDDALARRIATFGLTYKPVYNVVFKGDYQVRRNRAGVGEDEQLALGVGYEF* |
| Ga0075426_106091891 | 3300006903 | Populus Rhizosphere | TQASVPAGVTRDRSLARRITTFGLTYKPTWNTAFKGDYQLFRNAAGVGEFEVLSLGVGYQF* |
| Ga0079219_118031302 | 3300006954 | Agricultural Soil | DRAFARRITTLGLTYKPTWNTAFKGDYQLVRNAAGNGDYDVLSLGVGYQF* |
| Ga0099793_101223081 | 3300007258 | Vadose Zone Soil | ASVPAGVTRDRTLARRITTFGLTYKPTWNTAFKGDYQLLRNAAGVGEFAVLSLGVGYQF* |
| Ga0066710_1004548934 | 3300009012 | Grasslands Soil | GLSYKPTYNTVFKGDYQVLRNKARVGEAEVLSLGLGYQF |
| Ga0066710_1023371873 | 3300009012 | Grasslands Soil | ATRDRSLARRITTLGVTYKPTWNTAFKGDYQLLRNAAGAGEFEVLSLGVGYQF |
| Ga0099827_101205264 | 3300009090 | Vadose Zone Soil | FGLSYKPTYNTAFKGDYQLLRNEAGTGEADVLSLGIGYQF* |
| Ga0075418_101369121 | 3300009100 | Populus Rhizosphere | RITTFGLVYKPTWNTAFKGDYEIRRTAAGTAEGETLRFGMGYQF* |
| Ga0066709_1032364222 | 3300009137 | Grasslands Soil | ARRITTFGVTYKPTWNTAFKGDYALLRNAAGVGESEVLSLGLGYQF* |
| Ga0099792_108182431 | 3300009143 | Vadose Zone Soil | FGLTYKPTWNTAFKMDYQLLRNAAAFDEHDVLSLGMGFQF* |
| Ga0105066_10523071 | 3300009822 | Groundwater Sand | ITTLGLSYKPTWNTVFKGDYQLNRNAAQSGEYEVFSLGVGYQF* |
| Ga0126305_102229173 | 3300010036 | Serpentine Soil | VGLSYKPLYNVIFKGDYQLLRNKGGVGENEIASLGVGYQF* |
| Ga0126309_101032331 | 3300010039 | Serpentine Soil | DESLARRITTFGLSYKPVYNVVFKGDYQLQRTRAELAQGEVLSLGVGYQF* |
| Ga0127460_10689692 | 3300010114 | Grasslands Soil | VTRDRALARRITTFGVTYKPTWNTAFKGDYALLRNAAGVSESEVLSLGVGYQF* |
| Ga0134084_101069691 | 3300010322 | Grasslands Soil | QASVPIGIAKNDSLGRRITTVGLSYKPTYNTVFKGDYQVLRNKARVGEAEVLSLGLGYQF |
| Ga0134084_103773052 | 3300010322 | Grasslands Soil | AGVTRDASLARRITTLGLTYKPTWNTVFKGDYQLVRNAGRVGEHEVLSLGVGYQF* |
| Ga0134086_100283631 | 3300010323 | Grasslands Soil | LARRITTFGLSYKPTYNTAFKGDYQLLRNEAGTGATDVLSLGIGYQF* |
| Ga0134065_105123312 | 3300010326 | Grasslands Soil | GVTYKPTWNTAFKGDYQLLRNAAGAGEFEVLSLGVGYQF* |
| Ga0134080_101682221 | 3300010333 | Grasslands Soil | ITTFGVTYKPTWNTAFKGDYALLRNAAGVGESEVLSLGLGYQF* |
| Ga0134062_101005001 | 3300010337 | Grasslands Soil | TRDRTLVRRITTVGVTYKPTWNVAFKGDYRLLRNAAGAGESEVLSLGVGYQF* |
| Ga0134062_106183352 | 3300010337 | Grasslands Soil | LSYKPTYNTVFKGDYQVLRNKARVGEAEVLSLGLGYQF* |
| Ga0116237_115255442 | 3300010356 | Anaerobic Digestor Sludge | VGLSYKPLWNVVFKADYQLFRNRAGAAESEAVSLGVGYQF* |
| Ga0126377_117349711 | 3300010362 | Tropical Forest Soil | VVRDDALARRITTFGLSYKPVYNVIFKGDYQLRRNRAGVGQDEQLALGVGYQF* |
| Ga0134125_114592641 | 3300010371 | Terrestrial Soil | RRITTFGLSYKPVYNVVFKGDYQLRRNRAAVGQDEQLSLGVGYQF* |
| Ga0134121_101862401 | 3300010401 | Terrestrial Soil | YKPTWNTAFKGDYARLRNAAGLGEFEVLSLGVGYQF* |
| Ga0137393_108652801 | 3300011271 | Vadose Zone Soil | YKPTWNTAFKGDYQLLRNAAGAGEFEVLNLGVGYQF* |
| Ga0137461_12513121 | 3300012040 | Soil | RRITTFGLAYKPTWNTVFKGDYEVRRTAAATGEGETLRLGVGYQF* |
| Ga0137365_101695221 | 3300012201 | Vadose Zone Soil | TFGVTYKPTWNTAFKGDYALLHNAADVGESEVLSLGVGYQF* |
| Ga0137374_106929713 | 3300012204 | Vadose Zone Soil | YDTQADVPAGTTRDRGFARRVTTLGLAYKPTWNTIFKGDYTVLRTAAGTGQGETLRLGMGYQF* |
| Ga0137379_114115132 | 3300012209 | Vadose Zone Soil | SLARRITTFGITYKPTWNTAFKGDYALLRNAAGVGESEVLSLGVGYQF* |
| Ga0137379_116404101 | 3300012209 | Vadose Zone Soil | ITYKPTWNTAFKGDYALLRNAAGVGESEVLSLGVGYQF* |
| Ga0137378_101188735 | 3300012210 | Vadose Zone Soil | TRDRTLARRITTVGVTYKPTWNVAFKGDYRLLRNAAGAGELEVLSLGVGYQF* |
| Ga0137369_111520462 | 3300012355 | Vadose Zone Soil | VTTLGLAYKPTWNTIFKGDYTVLRTAAGTGQGETLRLGMGYQF* |
| Ga0136635_101537272 | 3300012530 | Polar Desert Sand | YKPVYNVVFKGDYQLRRNRAKVGEDEQLSLGVGYQF* |
| Ga0137398_112711061 | 3300012683 | Vadose Zone Soil | LTYKPTYNTVFKGDYQLLRNRSGIGEVNVLSLGIGYQF* |
| Ga0137394_113369182 | 3300012922 | Vadose Zone Soil | TTLGFTYKPTWNTAFKGDYQLLRNAAGAGESEVLSLGVGYQF* |
| Ga0137416_118070462 | 3300012927 | Vadose Zone Soil | RITTFGLTYKPTWNTAFKGDYQLLRNAAGVGELEVLSLGVGYQF* |
| Ga0164298_109051711 | 3300012955 | Soil | RITTFGLTYKPLYNVAFKGDYQLRRNKAAVDEGEVFSLGVGYQF* |
| Ga0164309_118155172 | 3300012984 | Soil | VVRDDALARRITTVGLSYKPVYNVVFKGDYQIRRNAGAVGEDEQLALGVGYQF* |
| Ga0164304_104830343 | 3300012986 | Soil | LTYKPVYNVVFKGDYQLRRNRAGVGQDEQLALGVGYQF* |
| Ga0120127_101379841 | 3300013503 | Permafrost | LGLSYKPVYNVVFKGDYQLQRNQAGVGEGQLFSLGAGYQF* |
| Ga0120125_10694142 | 3300014056 | Permafrost | TRNDALAQRVTTFGLTYKPLYNVAFKGDYQLRRNKAGLGEDEVLALGIAYQF* |
| Ga0134075_103683671 | 3300014154 | Grasslands Soil | RDRSLARRLTTLGLTYKPTWNTAFKGDYQIVRNAAGVGEHEVLSLGVGYQF* |
| Ga0134078_101794941 | 3300014157 | Grasslands Soil | PAGLPRDRTLARRITTVGVTYKPTWNVAFKGDYRLLRNAAGAGESEVLSLGVGYQF* |
| Ga0137420_10191161 | 3300015054 | Vadose Zone Soil | VTRDRSLARRITTFGLTYKPTWNTAFKGDYQLLRNAAGVGEFAVLSLGVGYQF* |
| Ga0134072_100506463 | 3300015357 | Grasslands Soil | GLTYKPTWNTAFKGDYQLVRNAGGVGEHEVLSLGVGYQF* |
| Ga0134072_101492213 | 3300015357 | Grasslands Soil | AGVTRDRSLARRITTFGVTYKPTWNTAFKGDYALLRNAAGVGESEVLSLGVGYQF* |
| Ga0132258_107623625 | 3300015371 | Arabidopsis Rhizosphere | VTRDDALARRTTTVGLTYKPVYNVVFKGDYQIRRNRAAVGEDEQLSLGVGYQF* |
| Ga0134083_103034103 | 3300017659 | Grasslands Soil | VTYKPTWNTAFKGDYRLLRNAAGAGESEVLSLGVGYQF |
| Ga0184618_104595212 | 3300018071 | Groundwater Sediment | PDGVTRNDALARRVTTFGLTYKPMYNVAFKGDYQLRRNKAGLGEDEGLALGVGYQF |
| Ga0184639_105445261 | 3300018082 | Groundwater Sediment | DASLARRITTVGLSYKPTYNVVFKGDYQLLRNKAGVGEAEVLSLGIGYQF |
| Ga0187774_110667562 | 3300018089 | Tropical Peatland | NPAYDRSVATFGLTFLPISNVVFKGDYQLLRNKAGLNEADVFRLGVGYQF |
| Ga0066662_108153123 | 3300018468 | Grasslands Soil | DRSLARRITTLGVTYKPTWNTAFKGDYQLLRNAAGAGESEVLSLGVGYQF |
| Ga0066669_100158077 | 3300018482 | Grasslands Soil | VTYKPTWNTAFKGDYRLLRNAAGAGEGEVLSLGVGYQF |
| Ga0066669_114683582 | 3300018482 | Grasslands Soil | VPAGLPRDRTLARRITTVGVTYKPTWNVAFKGDYRLLRNAASAGESEVLSLGVGYQF |
| Ga0193713_10341114 | 3300019882 | Soil | YKPTFNTVFKGDYQLLRNGSGAGEGEVLSLGVGYQF |
| Ga0210379_104247652 | 3300021081 | Groundwater Sediment | GLAYKPTWNTVFKGDYEIRRTAAGTGEGETLRLGVGYQF |
| Ga0193750_10607543 | 3300021413 | Soil | SYKPVYNVVFKGDYQLRRNRAGVGEDDQLSLGVGYQF |
| Ga0226658_105429671 | 3300022222 | Freshwater Microbial Mat | GTATNDGYARRNTAVGLSYKPLWNVVFKGDYQLFRNRAARGESEMVSLGVGYQF |
| Ga0207646_119327572 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | KPTWNTAFKGDYEVRRTAAGGGVGEGETLRLGIGYQF |
| Ga0207708_108443903 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | PTGTVRNEEFARRITTFGLVYKPTWNTAFKGDYEIRRTAAGTAENETLRLGMGYQF |
| Ga0209350_10611851 | 3300026277 | Grasslands Soil | GVTYKPTWNTAFKGDYQLLRNAAGAGEFEVLSLGVGYQF |
| Ga0209237_11415781 | 3300026297 | Grasslands Soil | LSYKPTYNTAFKGDYQLLRNKAGAGEAEVVSLGIGYQF |
| Ga0209237_12326352 | 3300026297 | Grasslands Soil | AGLTRDRTLARRITTVGVTYKPTWNVAFKGDYRLLRNAAGAGESEVLSLGVGYQF |
| Ga0209236_10938914 | 3300026298 | Grasslands Soil | RRITTFGVTYKPTWNTAFKGDYALLRNAAGVGESEVLSLGVGYQF |
| Ga0209055_11871572 | 3300026309 | Soil | MGLTYKPTWNVAFKGDYQLVRNAAGVGEYDVLSLGVGYQF |
| Ga0209761_11843871 | 3300026313 | Grasslands Soil | PAGTARDETLARRITTFGLSYKPTYNTAFKGDYQLLRNKAGSGEADVLSLGIAYQF |
| Ga0209268_11006441 | 3300026314 | Soil | GVTRDRSLARRVTTLGVTYKPTWNTAFKGDYQLVRNAAGAGESEVLSLGVGYQF |
| Ga0209268_11212902 | 3300026314 | Soil | ARRITTMGLTYKPTWNVAFKGDYQLVRNAAGVGEYDVLSLGVGYQF |
| Ga0209131_13650901 | 3300026320 | Grasslands Soil | TYKPTWNTAFKGDYQLLRNAAGVGELEVLSLGVGYQF |
| Ga0209266_11137333 | 3300026327 | Soil | VTTLGVTYKPTWNTAFKGDYQLVRNAAGAGESEVLSLGVGYQF |
| Ga0209803_10998601 | 3300026332 | Soil | YDTQASVPAGVTRDRSLARRVTTLGVTYKPTWNTAFKGDYQLLRNAAGAGESEVLSLGVGYQF |
| Ga0209804_10898134 | 3300026335 | Soil | SVPAGVTRDRSLARRITTVGVTYKPTWNTAFKGDYRLLRNAAGAGEGEVLSLGVGYQF |
| Ga0209057_11133041 | 3300026342 | Soil | LARRITTFGLTYKPTWNTAFKGDCQLVRNAGGVGEHDVLSLGVGYQF |
| Ga0209690_12143382 | 3300026524 | Soil | VGVTRDRTLARRITTFGLTYKPTWNTAFKGDYQLLRNAAGVGEFEVLSLGVGYQF |
| Ga0209056_101113571 | 3300026538 | Soil | LARRITTFGLSYKPTYNTAFKGDYQLLRNKAGAGEAEVVSLGIGYQF |
| Ga0209161_104880012 | 3300026548 | Soil | RITTFGLSYKPTYNTAFKGDYQLLRNKAGAGEAEVVSLGIGYQF |
| Ga0209648_102397571 | 3300026551 | Grasslands Soil | FGVTYKPTWNTAFKGDYALLRNAAGAGESEVLSLGVGYQF |
| Ga0209682_100797881 | 3300027716 | Wetland Sediment | AGVVRDEALARRITTVGLSYKPVYNVVFKGDYQLRRNRAGVGEDEQLGLGVGYQF |
| Ga0209464_103814962 | 3300027778 | Wetland Sediment | RITTFGLSYKPLYNVVLKGDYQLHRNKAGVGEADVLALGIGYQF |
| Ga0209074_104036922 | 3300027787 | Agricultural Soil | RDAALARRITTLGLTYKPTWNTAFKGDYQLVRNVAGVGEHEVLSLGVGYQF |
| Ga0209590_102680283 | 3300027882 | Vadose Zone Soil | RRVTTFGLSYKPLYNVIFKGDYQLRRNQAGLGENEVLALGVGYEF |
| Ga0209488_109109141 | 3300027903 | Vadose Zone Soil | PAGIAPNPALARRITTFGLTYKPTWNTAFKMDYQLLRNAAAFDEHDVLSLGMGFQF |
| Ga0209382_100642801 | 3300027909 | Populus Rhizosphere | RRITTFGLSYKPVYNVVFKGDYQIRRNRAAAGEDEQLSLGVGYQF |
| Ga0209382_104128971 | 3300027909 | Populus Rhizosphere | LGLSYKPTWNTVFKGDYTVLRTAAGTGEGETLRLGVGYQF |
| Ga0307287_102551081 | 3300028796 | Soil | GVVKDETLARRITTFGLSYKPIYNVVLKGDYQLQRNKAGVGEGELLALGVGYQF |
| Ga0307312_109449332 | 3300028828 | Soil | TFGLSYKPIYNVVFKGDYQLQRNKAGIGEGELLSLGVGYQF |
| Ga0307469_119857892 | 3300031720 | Hardwood Forest Soil | GLTYKPLWNVAFKADYQLRDNQAGVGENEVLALGVGYQF |
| Ga0310125_103478571 | 3300031811 | Marine | TTLGMTWKPAYNVAFKADYQVRRNRGGVGEDEVLSLGVGYSF |
| Ga0307473_100657574 | 3300031820 | Hardwood Forest Soil | DRTLDRRVTTFGLTYKPTWNTAFKGDYQVLRNAAGTGEGEVLSLGIGFQF |
| Ga0308175_1002464474 | 3300031938 | Soil | YKPVYNVVFKGDYQLRRNRAGVGQDEQLSLGVGYQF |
| Ga0307479_107604371 | 3300031962 | Hardwood Forest Soil | LGLTYKPTWNTAFKGDYQLVRNAAGLAEHEVLSLGIGYQF |
| Ga0308176_115228672 | 3300031996 | Soil | ARRITTFGLSYKPVYNVVFKGDYQLRRNRAGVGQDEQLSLGVGYQF |
| Ga0307414_103436474 | 3300032004 | Rhizosphere | KPVYNVVFKGDYQLQRTKAGLAEGEVLSLGVGYQF |
| Ga0307414_107335163 | 3300032004 | Rhizosphere | VVRDESLARRITTFGLSYKPVYNVVFKGDYQLRRTKAGLAEGELLSLGVGYQF |
| Ga0307415_1010999432 | 3300032126 | Rhizosphere | VPAGVVKDESLARRITTMGLSYKPVYNVVFKGDYQLQRTAGDGGEGEVLSLGVGYQF |
| Ga0307470_100685181 | 3300032174 | Hardwood Forest Soil | LARRLTTFGLTYKPTWNTAFKGDYQFVRNAAGVGEHEVLSLGIGYQF |
| ⦗Top⦘ |