


| Basic Information | |
|---|---|
| Family ID | F058950 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 134 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MVCLINYCALQDINLVDCMEIAYDQIKNRRGTLLPNGVFQKEV |
| Number of Associated Samples | 89 |
| Number of Associated Scaffolds | 134 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Viruses |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 91.04 % |
| Associated GOLD sequencing projects | 83 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.44 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Duplodnaviria (35.821 % of family members) |
| NCBI Taxonomy ID | 2731341 |
| Taxonomy | All Organisms → Viruses → Duplodnaviria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (27.612 % of family members) |
| Environment Ontology (ENVO) | Unclassified (49.254 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (62.687 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 29.58% β-sheet: 8.45% Coil/Unstructured: 61.97% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.44 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 134 Family Scaffolds |
|---|---|---|
| PF00149 | Metallophos | 23.88 |
| PF11753 | DUF3310 | 2.99 |
| PF00959 | Phage_lysozyme | 2.99 |
| PF09374 | PG_binding_3 | 2.99 |
| PF00182 | Glyco_hydro_19 | 2.24 |
| PF08291 | Peptidase_M15_3 | 1.49 |
| PF13392 | HNH_3 | 1.49 |
| PF03237 | Terminase_6N | 0.75 |
| PF03819 | MazG | 0.75 |
| COG ID | Name | Functional Category | % Frequency in 134 Family Scaffolds |
|---|---|---|---|
| COG3179 | Chitinase, GH19 family | Carbohydrate transport and metabolism [G] | 2.24 |
| COG3979 | Chitodextrinase | Carbohydrate transport and metabolism [G] | 2.24 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 82.09 % |
| Unclassified | root | N/A | 17.91 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002220|MLSBCLC_10427775 | Not Available | 738 | Open in IMG/M |
| 3300002408|B570J29032_109048952 | Not Available | 577 | Open in IMG/M |
| 3300002835|B570J40625_101409706 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
| 3300003277|JGI25908J49247_10117391 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 632 | Open in IMG/M |
| 3300004125|Ga0066182_10122496 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 633 | Open in IMG/M |
| 3300005581|Ga0049081_10018461 | Not Available | 2645 | Open in IMG/M |
| 3300005581|Ga0049081_10120975 | All Organisms → cellular organisms → Bacteria | 968 | Open in IMG/M |
| 3300005581|Ga0049081_10244359 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
| 3300005581|Ga0049081_10287784 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 569 | Open in IMG/M |
| 3300005582|Ga0049080_10078253 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1132 | Open in IMG/M |
| 3300005582|Ga0049080_10190553 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 679 | Open in IMG/M |
| 3300005582|Ga0049080_10314616 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 503 | Open in IMG/M |
| 3300006637|Ga0075461_10096870 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 930 | Open in IMG/M |
| 3300006802|Ga0070749_10025279 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3735 | Open in IMG/M |
| 3300006802|Ga0070749_10175462 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1236 | Open in IMG/M |
| 3300006802|Ga0070749_10412217 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 744 | Open in IMG/M |
| 3300006919|Ga0070746_10536073 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 509 | Open in IMG/M |
| 3300007229|Ga0075468_10212380 | Not Available | 560 | Open in IMG/M |
| 3300007234|Ga0075460_10261635 | Not Available | 574 | Open in IMG/M |
| 3300007363|Ga0075458_10009959 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3042 | Open in IMG/M |
| 3300007708|Ga0102859_1189133 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 610 | Open in IMG/M |
| 3300008116|Ga0114350_1007119 | Not Available | 5300 | Open in IMG/M |
| 3300008116|Ga0114350_1058223 | All Organisms → Viruses → Predicted Viral | 1370 | Open in IMG/M |
| 3300008266|Ga0114363_1129029 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 867 | Open in IMG/M |
| 3300008267|Ga0114364_1071164 | All Organisms → Viruses → Predicted Viral | 1170 | Open in IMG/M |
| 3300008450|Ga0114880_1032567 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2320 | Open in IMG/M |
| 3300008450|Ga0114880_1090565 | All Organisms → Viruses → Predicted Viral | 1202 | Open in IMG/M |
| 3300008450|Ga0114880_1090884 | All Organisms → Viruses → Predicted Viral | 1199 | Open in IMG/M |
| 3300008450|Ga0114880_1138478 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 892 | Open in IMG/M |
| 3300009082|Ga0105099_10349883 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 874 | Open in IMG/M |
| 3300009131|Ga0115027_10932839 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 674 | Open in IMG/M |
| 3300009151|Ga0114962_10183169 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1235 | Open in IMG/M |
| 3300009158|Ga0114977_10422205 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 740 | Open in IMG/M |
| 3300009164|Ga0114975_10080476 | All Organisms → cellular organisms → Bacteria | 1895 | Open in IMG/M |
| 3300009169|Ga0105097_10409612 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 754 | Open in IMG/M |
| 3300009180|Ga0114979_10244219 | All Organisms → cellular organisms → Bacteria | 1077 | Open in IMG/M |
| 3300009183|Ga0114974_10077447 | All Organisms → Viruses → Predicted Viral | 2170 | Open in IMG/M |
| 3300009183|Ga0114974_10212089 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1177 | Open in IMG/M |
| 3300009449|Ga0115558_1274236 | Not Available | 676 | Open in IMG/M |
| 3300010354|Ga0129333_11343162 | Not Available | 589 | Open in IMG/M |
| 3300010370|Ga0129336_10515108 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 644 | Open in IMG/M |
| 3300010374|Ga0114986_1001179 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6895 | Open in IMG/M |
| 3300010374|Ga0114986_1106528 | Not Available | 508 | Open in IMG/M |
| 3300010885|Ga0133913_12234084 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1347 | Open in IMG/M |
| 3300010885|Ga0133913_13213117 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1079 | Open in IMG/M |
| 3300012286|Ga0157137_104933 | All Organisms → cellular organisms → Bacteria | 902 | Open in IMG/M |
| 3300013005|Ga0164292_10808719 | Not Available | 592 | Open in IMG/M |
| 3300013010|Ga0129327_10251407 | Not Available | 904 | Open in IMG/M |
| 3300013372|Ga0177922_10502133 | Not Available | 719 | Open in IMG/M |
| 3300013372|Ga0177922_11255001 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → Campylobacterales → Campylobacteraceae → Campylobacter → Campylobacter coli | 736 | Open in IMG/M |
| 3300014711|Ga0134314_103935 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 995 | Open in IMG/M |
| 3300016776|Ga0182046_1340050 | Not Available | 605 | Open in IMG/M |
| 3300016776|Ga0182046_1486213 | All Organisms → Viruses → Predicted Viral | 1195 | Open in IMG/M |
| 3300017701|Ga0181364_1015429 | All Organisms → Viruses → Predicted Viral | 1273 | Open in IMG/M |
| 3300017701|Ga0181364_1020981 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1075 | Open in IMG/M |
| 3300017722|Ga0181347_1099726 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → Campylobacterales → Campylobacteraceae → Campylobacter → Campylobacter coli | 829 | Open in IMG/M |
| 3300017722|Ga0181347_1125159 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 716 | Open in IMG/M |
| 3300017722|Ga0181347_1171525 | Not Available | 583 | Open in IMG/M |
| 3300017723|Ga0181362_1085296 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 635 | Open in IMG/M |
| 3300017747|Ga0181352_1028044 | All Organisms → Viruses → Predicted Viral | 1712 | Open in IMG/M |
| 3300017754|Ga0181344_1172286 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 613 | Open in IMG/M |
| 3300017761|Ga0181356_1135532 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 774 | Open in IMG/M |
| 3300017761|Ga0181356_1249606 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 506 | Open in IMG/M |
| 3300017777|Ga0181357_1094846 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1134 | Open in IMG/M |
| 3300017777|Ga0181357_1168703 | Not Available | 797 | Open in IMG/M |
| 3300017777|Ga0181357_1172572 | All Organisms → cellular organisms → Bacteria | 785 | Open in IMG/M |
| 3300017777|Ga0181357_1313811 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| 3300017778|Ga0181349_1247344 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 597 | Open in IMG/M |
| 3300017780|Ga0181346_1050518 | All Organisms → Viruses → Predicted Viral | 1683 | Open in IMG/M |
| 3300017780|Ga0181346_1077238 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1316 | Open in IMG/M |
| 3300017780|Ga0181346_1210107 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → Campylobacterales → Campylobacteraceae → Campylobacter → Campylobacter coli | 698 | Open in IMG/M |
| 3300017784|Ga0181348_1095253 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1167 | Open in IMG/M |
| 3300017784|Ga0181348_1248722 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 616 | Open in IMG/M |
| 3300017785|Ga0181355_1217984 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 743 | Open in IMG/M |
| 3300017785|Ga0181355_1279431 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 633 | Open in IMG/M |
| 3300017785|Ga0181355_1323956 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 573 | Open in IMG/M |
| 3300018415|Ga0181559_10386480 | Not Available | 770 | Open in IMG/M |
| 3300020550|Ga0208600_1053716 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 599 | Open in IMG/M |
| 3300020551|Ga0208360_1030254 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 704 | Open in IMG/M |
| 3300021579|Ga0213918_1009641 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1200 | Open in IMG/M |
| 3300021962|Ga0222713_10774770 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 538 | Open in IMG/M |
| 3300022179|Ga0181353_1024706 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1587 | Open in IMG/M |
| 3300022179|Ga0181353_1098851 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → Campylobacterales → Campylobacteraceae → Campylobacter → Campylobacter coli | 719 | Open in IMG/M |
| 3300022179|Ga0181353_1146618 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 546 | Open in IMG/M |
| 3300022190|Ga0181354_1031426 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1736 | Open in IMG/M |
| 3300022190|Ga0181354_1157379 | Not Available | 706 | Open in IMG/M |
| 3300022407|Ga0181351_1140267 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 882 | Open in IMG/M |
| 3300022925|Ga0255773_10061840 | Not Available | 2155 | Open in IMG/M |
| 3300022929|Ga0255752_10402753 | Not Available | 538 | Open in IMG/M |
| 3300025429|Ga0208500_1032275 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa | 642 | Open in IMG/M |
| 3300025635|Ga0208147_1007897 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 3003 | Open in IMG/M |
| 3300025655|Ga0208795_1155898 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
| 3300025818|Ga0208542_1115624 | Not Available | 757 | Open in IMG/M |
| 3300027488|Ga0255084_1094059 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → Campylobacterales → Campylobacteraceae → Campylobacter → Campylobacter coli | 504 | Open in IMG/M |
| 3300027492|Ga0255093_1018476 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1546 | Open in IMG/M |
| 3300027503|Ga0255182_1134602 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 550 | Open in IMG/M |
| 3300027529|Ga0255077_1014740 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1399 | Open in IMG/M |
| 3300027579|Ga0255068_118142 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 775 | Open in IMG/M |
| 3300027593|Ga0255118_1068827 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 584 | Open in IMG/M |
| 3300027608|Ga0208974_1035343 | All Organisms → Viruses → Predicted Viral | 1490 | Open in IMG/M |
| 3300027659|Ga0208975_1029643 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1754 | Open in IMG/M |
| 3300027659|Ga0208975_1194454 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 545 | Open in IMG/M |
| 3300027759|Ga0209296_1193174 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 878 | Open in IMG/M |
| 3300027764|Ga0209134_10059887 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → Campylobacterales → Campylobacteraceae → Campylobacter → Campylobacter coli | 1273 | Open in IMG/M |
| 3300027764|Ga0209134_10089388 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1048 | Open in IMG/M |
| 3300027772|Ga0209768_10034348 | All Organisms → Viruses → Predicted Viral | 2752 | Open in IMG/M |
| 3300027798|Ga0209353_10110281 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1239 | Open in IMG/M |
| 3300027798|Ga0209353_10119205 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1187 | Open in IMG/M |
| 3300027798|Ga0209353_10385048 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 579 | Open in IMG/M |
| 3300027836|Ga0209230_10486510 | Not Available | 701 | Open in IMG/M |
| 3300028025|Ga0247723_1033377 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1597 | Open in IMG/M |
| 3300028025|Ga0247723_1034588 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1558 | Open in IMG/M |
| 3300028025|Ga0247723_1035825 | All Organisms → Viruses → Predicted Viral | 1518 | Open in IMG/M |
| 3300028025|Ga0247723_1042834 | All Organisms → Viruses → Predicted Viral | 1336 | Open in IMG/M |
| 3300028025|Ga0247723_1043858 | All Organisms → cellular organisms → Bacteria | 1314 | Open in IMG/M |
| 3300031673|Ga0307377_10831987 | Not Available | 636 | Open in IMG/M |
| 3300031857|Ga0315909_10299802 | All Organisms → Viruses → Predicted Viral | 1202 | Open in IMG/M |
| 3300031857|Ga0315909_10303796 | All Organisms → Viruses → Predicted Viral | 1191 | Open in IMG/M |
| 3300031857|Ga0315909_10361517 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1056 | Open in IMG/M |
| 3300031857|Ga0315909_10953909 | Not Available | 523 | Open in IMG/M |
| 3300031857|Ga0315909_10992136 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 508 | Open in IMG/M |
| 3300031857|Ga0315909_10994083 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → Campylobacterales → Campylobacteraceae → Campylobacter → Campylobacter coli | 507 | Open in IMG/M |
| 3300031951|Ga0315904_10644142 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → Campylobacterales → Campylobacteraceae → Campylobacter → Campylobacter coli | 902 | Open in IMG/M |
| 3300031963|Ga0315901_11214339 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 510 | Open in IMG/M |
| 3300031999|Ga0315274_11040460 | All Organisms → cellular organisms → Bacteria | 832 | Open in IMG/M |
| 3300032050|Ga0315906_10107481 | All Organisms → Viruses → Predicted Viral | 2765 | Open in IMG/M |
| 3300032092|Ga0315905_10000900 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 32464 | Open in IMG/M |
| 3300032093|Ga0315902_10494831 | All Organisms → Viruses → Predicted Viral | 1066 | Open in IMG/M |
| 3300032116|Ga0315903_10450929 | All Organisms → Viruses → Predicted Viral | 1031 | Open in IMG/M |
| 3300032116|Ga0315903_10724783 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 739 | Open in IMG/M |
| 3300032118|Ga0315277_11265674 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 649 | Open in IMG/M |
| 3300034062|Ga0334995_0556232 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → Campylobacterales → Campylobacteraceae → Campylobacter → Campylobacter coli | 676 | Open in IMG/M |
| 3300034109|Ga0335051_0562286 | Not Available | 524 | Open in IMG/M |
| 3300034200|Ga0335065_0699007 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → Campylobacterales → Campylobacteraceae → Campylobacter → Campylobacter coli | 579 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 27.61% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 9.70% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 8.21% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 7.46% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 6.72% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 4.48% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 3.73% |
| Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 3.73% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 2.99% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 2.99% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 2.99% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 2.24% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 2.24% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 1.49% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 1.49% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 1.49% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 1.49% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 1.49% |
| Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 0.75% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 0.75% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.75% |
| Surface Water | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Surface Water | 0.75% |
| Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 0.75% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.75% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.75% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 0.75% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.75% |
| Hydrocarbon Resource Environments | Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Hydrocarbon Resource Environments | 0.75% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002220 | Wastewater microbial communities from Syncrude, Ft. McMurray, Alberta - West In Pit SyncrudeMLSB2011 | Engineered | Open in IMG/M |
| 3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300003277 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD | Environmental | Open in IMG/M |
| 3300004125 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SD (version 2) | Environmental | Open in IMG/M |
| 3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
| 3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
| 3300006637 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006919 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 | Environmental | Open in IMG/M |
| 3300007229 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007234 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007363 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007708 | Estuarine microbial communities from the Columbia River estuary - metaG 1371B-02 | Environmental | Open in IMG/M |
| 3300008116 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA | Environmental | Open in IMG/M |
| 3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008267 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-100-LTR | Environmental | Open in IMG/M |
| 3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
| 3300009082 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015 | Environmental | Open in IMG/M |
| 3300009131 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1 | Environmental | Open in IMG/M |
| 3300009151 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG | Environmental | Open in IMG/M |
| 3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
| 3300009164 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG | Environmental | Open in IMG/M |
| 3300009169 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
| 3300009180 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG | Environmental | Open in IMG/M |
| 3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
| 3300009449 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110426 | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300010370 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNA | Environmental | Open in IMG/M |
| 3300010374 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S-1-Day17 | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300012286 | Freshwater microbial communities from Ausable River, Ontario, Canada - S47 | Environmental | Open in IMG/M |
| 3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
| 3300013010 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.8_DNA | Environmental | Open in IMG/M |
| 3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
| 3300014711 | Surface water microbial communities from Bangladesh - BaraHaldiaSW0111 | Environmental | Open in IMG/M |
| 3300016776 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011505AT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017701 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.S.N | Environmental | Open in IMG/M |
| 3300017722 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017723 | Freshwater viral communities from Lake Michigan, USA - Su13.ND.MM110.S.N | Environmental | Open in IMG/M |
| 3300017747 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.S.N | Environmental | Open in IMG/M |
| 3300017754 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.D | Environmental | Open in IMG/M |
| 3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300018415 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011508AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300020550 | Freshwater microbial communities from Lake Mendota, WI - 08OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020551 | Freshwater microbial communities from Lake Mendota, WI - 27JUL2010 deep hole epilimnion ns (SPAdes) | Environmental | Open in IMG/M |
| 3300021579 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 2-17 MG | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300022179 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N | Environmental | Open in IMG/M |
| 3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
| 3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300022925 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG | Environmental | Open in IMG/M |
| 3300022929 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG | Environmental | Open in IMG/M |
| 3300025429 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE17Sep08 (SPAdes) | Environmental | Open in IMG/M |
| 3300025635 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025655 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025818 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027488 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepA_8d | Environmental | Open in IMG/M |
| 3300027492 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepA_8d | Environmental | Open in IMG/M |
| 3300027503 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_UVDOM_RepA_8d | Environmental | Open in IMG/M |
| 3300027529 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepC_8h | Environmental | Open in IMG/M |
| 3300027579 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepC_8h | Environmental | Open in IMG/M |
| 3300027593 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Atlam_RepB_8h | Environmental | Open in IMG/M |
| 3300027608 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027659 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027764 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MLB.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027772 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027798 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027836 | Freshwater and sediment microbial communities from Lake Ontario - Sta 18 epilimnion Metagenome (SPAdes) | Environmental | Open in IMG/M |
| 3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
| 3300031673 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-3 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
| 3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
| 3300031999 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20 | Environmental | Open in IMG/M |
| 3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
| 3300032092 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121 | Environmental | Open in IMG/M |
| 3300032093 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117 | Environmental | Open in IMG/M |
| 3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
| 3300032118 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_15 | Environmental | Open in IMG/M |
| 3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
| 3300034109 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME26Aug2009-rr0158 | Environmental | Open in IMG/M |
| 3300034200 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2013-rr0190 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| MLSBCLC_104277752 | 3300002220 | Hydrocarbon Resource Environments | VTLVNACALADVDAVDCFAGSYDEIKHRKGTLMPNGVFVKEV* |
| B570J29032_1090489524 | 3300002408 | Freshwater | VGDVMVCLINYCALQDINLVDCMEIAYDQIKNRKGTLLPNGVFQKETT* |
| B570J40625_1014097063 | 3300002835 | Freshwater | DSVGDVMVCLINYCALQDINLVDCMEIAYDQIKNRRGTLLPNGVFQKDT* |
| JGI25908J49247_101173913 | 3300003277 | Freshwater Lake | LINYCALQDINLVDCMEIAYDQIKNRRGTLLPNGVFQKDT* |
| Ga0066182_101224961 | 3300004125 | Freshwater Lake | LINYCALQDINLVDCMEVAYDQIKNRKGILLPNGVFQKTLE* |
| Ga0049081_100184616 | 3300005581 | Freshwater Lentic | IHLVDCMEVAYDQIKNRRGTLLPNGVFRKTFDHL* |
| Ga0049081_101209755 | 3300005581 | Freshwater Lentic | LQDIELVSCLEVAYDAIKNRKGTLLPSGVYVKEAA* |
| Ga0049081_102443591 | 3300005581 | Freshwater Lentic | GDVMVCLINYCALQDIQLVDCMEVAYDQIKNRKGILLPNGVFQKDTT* |
| Ga0049081_102877843 | 3300005581 | Freshwater Lentic | INYCALQDIHLVDCMEVAYDQIKNRRGTLLPNGVFQKEM* |
| Ga0049080_100782534 | 3300005582 | Freshwater Lentic | EAIVDSVGDVMVCLINYCVLQDINLVQCMEIAYDQIKNRRGILLPNGVFQKDT* |
| Ga0049080_101905531 | 3300005582 | Freshwater Lentic | GIVDSVGDVMVCLINYCALQDIHLVDCMEIAYDQIKNRRGTLLPNGVFQKDT* |
| Ga0049080_103146161 | 3300005582 | Freshwater Lentic | NYCALQDIQLVDCMEVAYDQIKNRKGILLPNGVFQKDTT* |
| Ga0075461_100968701 | 3300006637 | Aqueous | EGIVDAVGDVMVCLVNYCAIKDINLVDCMQVAYDSIKHRRGVLLPNGVFVKNDGVSSE* |
| Ga0070749_100252791 | 3300006802 | Aqueous | AVGDVMVCLINYCALQDINLVDCMEIAYDQIKHRKGTLMASGVFVKEV* |
| Ga0070749_101754623 | 3300006802 | Aqueous | YCAIKDINLVDCMQVAYDSIKHRRGVLLPNGVFVKNDGVSSE* |
| Ga0070749_104122171 | 3300006802 | Aqueous | NDEEGIVDAVGDVMVCLVNYCAIKDINLVDCMRVAYDSIKHRRGVLLPNGVFVKNDGVSSE* |
| Ga0070746_105360732 | 3300006919 | Aqueous | CLVNYCAIKDINLVDCMQVAYDSIKHRRGVLLPNGVFVKNDGVSSE* |
| Ga0075468_102123802 | 3300007229 | Aqueous | YCAIKDIDLVSCMDAAYSQIKDRKGTLLPNGVFVKE* |
| Ga0075460_102616352 | 3300007234 | Aqueous | DATIKNDEEGIVDAVGDVMVCLVNYCAIKDISLVDSMYVAYDTIKHRRGVLLPNGVFVKNDGVSSE* |
| Ga0075458_100099598 | 3300007363 | Aqueous | INYCALQDINLVDCMEIAYDQIKHRKGTLMASGVFVKEV* |
| Ga0102859_11891332 | 3300007708 | Estuarine | ALQDINLIVCMYSAFREIQDRKGTLLTNGVFVKE* |
| Ga0114350_100711912 | 3300008116 | Freshwater, Plankton | DVMVCLINYCALQDINLVNCMEVAYDQIKNRKGILLPNGVFKRDAT* |
| Ga0114350_10582231 | 3300008116 | Freshwater, Plankton | DVMVCLINYCALQDINLVNCMEVAYDQIKNRKGILLPNGVFQRDTT* |
| Ga0114363_11290291 | 3300008266 | Freshwater, Plankton | INYCALQDIHLVDCMEVAYDQIKNRRGTLLPNGVFQKEI* |
| Ga0114364_10711642 | 3300008267 | Freshwater, Plankton | VMVCLINYCALQDIQLVDCMEVAYDQIKNRKGILLPNGVFQKDTT* |
| Ga0114880_10325675 | 3300008450 | Freshwater Lake | VMVCLINYCALQDIHLVDCMEVAYDQIKNRRGTLLPNGVFQKEV* |
| Ga0114880_10905651 | 3300008450 | Freshwater Lake | DAVGDVMVCLINYCALQDIHLVDCMEVAYDQIKNRRGTLLPNGVFQKDII* |
| Ga0114880_10908842 | 3300008450 | Freshwater Lake | DVMVCLINYCALQDINLVDCMEIAYDQIKNRKGTLLPNGVFQKDST* |
| Ga0114880_11384781 | 3300008450 | Freshwater Lake | AVGDVMVCLINYCALQDIHLVDCMEVAYDQIKNRRGTLLPNGVFQKEI* |
| Ga0105099_103498832 | 3300009082 | Freshwater Sediment | MVCLVNYCALQDINLVDCMEVAYDQIKNRKGTLLPNGVFKKDAT* |
| Ga0115027_109328391 | 3300009131 | Wetland | EAIVDAVGDVMVCLVNYCALQDINLVDCMEVAYDQIKNRRGTLLPNGLFVKETI* |
| Ga0114962_101831696 | 3300009151 | Freshwater Lake | CALRDINLVSCMEVAYDQIKNRKGILLPNGVFVKE* |
| Ga0114977_104222053 | 3300009158 | Freshwater Lake | VGDVMVCLINYCALKDIHLVDCMEVAYDQIKNRKGTLLPNGLFVNDST* |
| Ga0114975_100804765 | 3300009164 | Freshwater Lake | VMVCLINYCALKDISLVKCLEGAYEEIKDRKGTLMPNGVFVKD* |
| Ga0105097_104096121 | 3300009169 | Freshwater Sediment | INYCALQDINLVDCMELAYSQIKDRKGTLLPNGVFVKE* |
| Ga0114979_102442191 | 3300009180 | Freshwater Lake | DREAIVDSVGDVMVCLINYCALQDINLVNCMEVAYDQIKNRRGIMSKEGIFHKD* |
| Ga0114974_100774476 | 3300009183 | Freshwater Lake | DEDAIVDSVGDVMVCLINYCVLQDINLVKCMEIAYDQIKNRGGILLPNGVFQKET* |
| Ga0114974_102120893 | 3300009183 | Freshwater Lake | DSVGDVMVCLINYCALQDINLVDCMEVAYDQIKNRRGTLLPNGVFQKDIT* |
| Ga0115558_12742362 | 3300009449 | Pelagic Marine | AIKDIDLVSCMDAAYGQIKDRKGTLLPNGVFVKE* |
| Ga0129333_113431621 | 3300010354 | Freshwater To Marine Saline Gradient | NLCALEKTSLRECLEGAWEEIKDRRGILLPNGVFVKEVME* |
| Ga0129336_105151081 | 3300010370 | Freshwater To Marine Saline Gradient | LVCMVNMCALLDINMVNCMEIAYDQIKHRKGTMLPSGVFVKEA* |
| Ga0114986_10011791 | 3300010374 | Deep Subsurface | QDLNLVDCMEVAYDQIKNRKGTLLPNGLFVREPT* |
| Ga0114986_11065283 | 3300010374 | Deep Subsurface | LVNYCALQDLNLVDCMEVAYDQIKNRKGILLPNGLFVKDST* |
| Ga0133913_122340847 | 3300010885 | Freshwater Lake | LIIYCALLDINLVDCMEYAYKEIKNRKGTLLPNGVFLKELP* |
| Ga0133913_132131172 | 3300010885 | Freshwater Lake | GDVMVCLINYCALQDIHLVDCMEVAYDQIKNRRGTLLPNGVFQKEV* |
| Ga0157137_1049331 | 3300012286 | Freshwater | QDINLVDCMEVAYDQIKNRRGTLLPNGLFVKETI* |
| Ga0164292_108087191 | 3300013005 | Freshwater | CALQDIQLVDCMEVAYDQIKNRKGILLPNGVFQKDTT* |
| Ga0129327_102514073 | 3300013010 | Freshwater To Marine Saline Gradient | VNYCAIKDIDLVSCMDAAYSQIKDRKGTLLPNGVFVKE* |
| Ga0177922_105021333 | 3300013372 | Freshwater | VMVCLINYCALQDINLVDCMEIAYDQIKNRRGTLLPNGDFQKDT* |
| Ga0177922_112550013 | 3300013372 | Freshwater | NYCVLQDINLVQCMEIAYDQIKNRKGILLPNGVFQKES* |
| Ga0134314_1039353 | 3300014711 | Surface Water | AVGDVMVCLVNYCALADIDLVECMYVAYDQIKHRKGTLLPNGIFVKEV* |
| Ga0182046_13400502 | 3300016776 | Salt Marsh | VDAVGDVMVCLVNYCAIKDINLVDAMYVAYDSIKHRRGVLLPNGVFVKNDGVSSE |
| Ga0182046_14862132 | 3300016776 | Salt Marsh | INVCALLDIDPVDCLQVAYDQIKHRKGTLLPNGVFVKE |
| Ga0181364_10154297 | 3300017701 | Freshwater Lake | VYCALQDINLVDCMELAYEEIKDRKGTLLSNGVFVKDEA |
| Ga0181364_10209814 | 3300017701 | Freshwater Lake | VGDVMVCLINYCALQDINLVDCMEVAYDQIKNRKGILLPNGVFQKTLD |
| Ga0181347_10997263 | 3300017722 | Freshwater Lake | LQDINLVDCMEVAYDQIKNRKGILLPNGVFQKTLE |
| Ga0181347_11251591 | 3300017722 | Freshwater Lake | CLINYCALQDINLVDCMEVAYDQIKNRKGTLLPNGVFQKTLD |
| Ga0181347_11715251 | 3300017722 | Freshwater Lake | DVMVCLINYCALQDINLVDCMEIAYDQIKNRRGTLLPNGVFQKDT |
| Ga0181362_10852962 | 3300017723 | Freshwater Lake | VGDVMVCLINYCALQDINLVDCMEIAYDQIKNRRGTLLPNGVFQKDT |
| Ga0181352_10280444 | 3300017747 | Freshwater Lake | ALQDLNLVDCMEVAYDQIKNRRGTLLPNGLFVKETI |
| Ga0181344_11722863 | 3300017754 | Freshwater Lake | DVMVCLINYCVLQDINLVQCMEIAYDQIKNRKGILLPNGVFQKEN |
| Ga0181356_11355323 | 3300017761 | Freshwater Lake | CALQDINLVDCMEIAYDQIKNRRGTLLPNGVFQKDST |
| Ga0181356_12496061 | 3300017761 | Freshwater Lake | CLIVYCALQDINLVDCMELAYEEIKDRKGTLLANGVFVKDEA |
| Ga0181357_10948462 | 3300017777 | Freshwater Lake | MVCLINYCALQDIQLVDCMEVAYDQIKNRKGILLPNGVFQKDTT |
| Ga0181357_11687033 | 3300017777 | Freshwater Lake | LINYCVLQDINLVQCMEIAYDQIKNRKGILLPNGVFQKEN |
| Ga0181357_11725721 | 3300017777 | Freshwater Lake | VGDVMVCLINYCALQDINLVDCMEIAYDQIKNKRGIMSKEGIFNKD |
| Ga0181357_13138111 | 3300017777 | Freshwater Lake | DAVGDVMVCLINYCALQDIHLVDCMEVAYDQIKNRRGTLLPNGVFQKEI |
| Ga0181349_12473441 | 3300017778 | Freshwater Lake | LINYCALQDINLVDCMEIAYDQIKNRKGILLPNGVFQKTLD |
| Ga0181346_10505184 | 3300017780 | Freshwater Lake | VGDVMVCLINYCALKDIHLVDCMEVAYDQIKNRGGILLPNGVFQRDTT |
| Ga0181346_10772383 | 3300017780 | Freshwater Lake | CALQDIHLVDCMEVAYDQIKNRRGTLLPNGVFQKEIT |
| Ga0181346_12101073 | 3300017780 | Freshwater Lake | GDVMVCLINYCALQDIQLVDCMEVAYDQIKNRKGILLPNGVFQKDTT |
| Ga0181348_10952531 | 3300017784 | Freshwater Lake | VCLINYCALQDINLVDCMEVAYDQIKNRKGILLPNGVFQKTLE |
| Ga0181348_12487221 | 3300017784 | Freshwater Lake | LQDINLVDCMELAYEEIKDRKGTLLANGVFVKDEA |
| Ga0181355_12179842 | 3300017785 | Freshwater Lake | YCALQDINLVDCMEVAYDQIKNRRGTLLPNGVFKKETT |
| Ga0181355_12794314 | 3300017785 | Freshwater Lake | LINYCALQDINLVDCMEVAYDQIKNRKGTLLPNGVFQKTLD |
| Ga0181355_13239564 | 3300017785 | Freshwater Lake | DVMVCLINYCALQDLNLVNCMEVAYDQIKNRRGTVLPNGVFQKEI |
| Ga0181559_103864801 | 3300018415 | Salt Marsh | DISLVDAMYVAYDTIKHRRGVLLPNGVFVKNDGVSSE |
| Ga0208600_10537161 | 3300020550 | Freshwater | SVGDVMVCLINYCALQDINLVDCMEVAYDQIKNRKGILLPNGVFQKTLE |
| Ga0208360_10302543 | 3300020551 | Freshwater | DVMVCLINYCALQDINLVDCMEVAYDQIKNRKGTLLPNGVFQKTLD |
| Ga0213918_10096411 | 3300021579 | Freshwater | LVNYCALQDINLVDCMKVAYDQIKHRRGTLMPNGVFIKEA |
| Ga0222713_107747701 | 3300021962 | Estuarine Water | AIVDSVGDVMVCLINYCALQDINLVNCMEVAYDQIKNRRGTLLPNGVFQKEI |
| Ga0181353_10247064 | 3300022179 | Freshwater Lake | ERGVLQDINLVQCMEIAYDQIKNRKGILLPNGVFQKEP |
| Ga0181353_10988511 | 3300022179 | Freshwater Lake | SKEAIVDAVGDVMVCLINYCALQDIHLVDCMEVAYDQIKNRRGTLLPNGVFQKEV |
| Ga0181353_11466181 | 3300022179 | Freshwater Lake | SVGDVMVCLVNYCALQDINLVDCMEVAYDQIKNRRGTLLPNGVFKKD |
| Ga0181354_10314261 | 3300022190 | Freshwater Lake | VCLINYCVLQDINLVQCMEIAYDQIKNRKGILLPNGVFQKES |
| Ga0181354_11573793 | 3300022190 | Freshwater Lake | ALQDINLVDCMEVAYDQIKNRKGILLPNGVFQKTLD |
| Ga0181351_11402673 | 3300022407 | Freshwater Lake | RGDVMVCLINYCALQDINLVDCMEVAYDQIKNRKGILLPNGVFQKTLD |
| Ga0255773_100618405 | 3300022925 | Salt Marsh | NVCALLDIDPVDCLQVAYDQIKHRKGTLLPNNGVFVKE |
| Ga0255752_104027531 | 3300022929 | Salt Marsh | LINVCALLDIDPVDCLQVAYDQIKHRKGTLLPNNGVFVKE |
| Ga0208500_10322753 | 3300025429 | Freshwater | VMVCLVNYCALQDIDLVSCMYAAYVEIKDRKGTLMPNGVFVKE |
| Ga0208147_10078978 | 3300025635 | Aqueous | INYCALQDINLVDCMEIAYDQIKHRKGTLMASGVFVKEV |
| Ga0208795_11558981 | 3300025655 | Aqueous | VMVCLINYCALQDINIVDCMNEAYDQIKNRKGTLLANGVFVKES |
| Ga0208542_11156242 | 3300025818 | Aqueous | IKNDEEGIVDAVGDVMVCLVNYCAIKDINLVDCMRVAYDSIKHRRGVLLPNGVFVKNDGVSSE |
| Ga0255084_10940592 | 3300027488 | Freshwater | ALQDLNLVDCMEVAYDQIKNRRGTLLPSGVFQKEAT |
| Ga0255093_10184761 | 3300027492 | Freshwater | AVGDVMVCLVNYCALQDLNLVDCMEVAYDQIKNRRGTLLPSGVFQKEAT |
| Ga0255182_11346022 | 3300027503 | Freshwater | NYCALQDIDLVSCMQVAYDQIKHRKGTLLPSGVFVKE |
| Ga0255077_10147403 | 3300027529 | Freshwater | VGDVMVCLVNYCALQDLNLVDCMEVAYDQIKNRRGTLLPSGVFQKEAT |
| Ga0255068_1181422 | 3300027579 | Freshwater | DAVGDVMVCLVNYCALQDLNLVDCMEVAYDQIKNRRGTLLPSGVFQKEAT |
| Ga0255118_10688274 | 3300027593 | Freshwater | INYCALQDIHLVDCMEVAYDQIKNRRGTLLPNGVFQKEI |
| Ga0208974_10353431 | 3300027608 | Freshwater Lentic | CALQDIHLVDCMEVAYDQIKNRRGTLLPNGVFRKTFDHL |
| Ga0208975_10296431 | 3300027659 | Freshwater Lentic | CALQDINLVDCMEVAYDQIKNRKGILLPNGVFRKDPDTI |
| Ga0208975_11944541 | 3300027659 | Freshwater Lentic | CVLQDINLVQCMEIAYDQIKNRKGILLPNGVFQKEI |
| Ga0209296_11931741 | 3300027759 | Freshwater Lake | GDVMVCLINYCALQDINLVDCMEIAYDQIKNRKGILLPNGVFQKTLD |
| Ga0209134_100598871 | 3300027764 | Freshwater Lake | INYCALQDINLVDCMEIAYDQIKNRRGTLLPNGVFQKDT |
| Ga0209134_100893883 | 3300027764 | Freshwater Lake | YCVLQDINLVQCMEIAYDQIKNRKGILLPNGVFQKEP |
| Ga0209768_100343481 | 3300027772 | Freshwater Lake | AVGDVMVCLINYCALKDIHLVDCMEVAYDQIKNRGGILLPNGVFQRDTT |
| Ga0209353_101102811 | 3300027798 | Freshwater Lake | INYCVLQDINLVNCMEVAYDQIKNRKGILLPNGVFQKEI |
| Ga0209353_101192052 | 3300027798 | Freshwater Lake | MVCLINYCALQDINLVDCMEIAYDQIKNRRGTLLPNGVFQKEV |
| Ga0209353_103850481 | 3300027798 | Freshwater Lake | NYCALQDIDLVRCMKFAYAEIKDRKGMLLPNGVFVKQ |
| Ga0209230_104865101 | 3300027836 | Freshwater And Sediment | VMVCLINYCVLQDINLVQCMEIAYDQIKNRKGILLPNGVFQKEP |
| Ga0247723_10333771 | 3300028025 | Deep Subsurface Sediment | DVMVCLINYCALQDIHLVDCMEIAYDQIKNRRGTLLPNGVFQKDT |
| Ga0247723_10345881 | 3300028025 | Deep Subsurface Sediment | AIVDSVGDVMVCLINYCALQDINLVNCMEIAYDQIKNRRGTLLSNGVFKKE |
| Ga0247723_10358251 | 3300028025 | Deep Subsurface Sediment | AVGDVMVCLINYCALQDIQLVDCMEVAYDQIKNRKGILLPNGVFQKDTT |
| Ga0247723_10428343 | 3300028025 | Deep Subsurface Sediment | VGDVMVCLVNYCALQDLNLVDCMEVAYDQIKNRRGTLLPSGVFQKDAT |
| Ga0247723_10438581 | 3300028025 | Deep Subsurface Sediment | EEIMDGVGDVMTALVIYCALQDINLVNCMEIAFDQIKSRKGVLLPNGLFVREIT |
| Ga0307377_108319871 | 3300031673 | Soil | DATIKNDEEGIVDAVGDVMVCLVNYCAIKDINLVDCMRVAYDAIKHRRGVLLPNGVFVKNDGVSSE |
| Ga0315909_102998023 | 3300031857 | Freshwater | LINYCALQDINLVDCMEIAYDQIKNRKGTLLPNGVFQKDST |
| Ga0315909_103037963 | 3300031857 | Freshwater | DSVGDVMVCLINYCALQDINLVNCMEVAYDQIKNRKGILLPNGVFQRDTT |
| Ga0315909_103615172 | 3300031857 | Freshwater | NYCVLQDINLVNCMEVAYDQIKNRKGILLPNGVFQRDAT |
| Ga0315909_109539093 | 3300031857 | Freshwater | NYCALQDINLVDCMEIAYDQIKNRKGTLLPNGVFQKDT |
| Ga0315909_109921361 | 3300031857 | Freshwater | VGDVMVCLINYCALQDINLVDCMEIAYDQIKNRRGTLLPNGVFQKEV |
| Ga0315909_109940831 | 3300031857 | Freshwater | LINYCALQDIHLVDCMEVAYDQIKNRRGTLLPNGVFQKEV |
| Ga0315904_106441421 | 3300031951 | Freshwater | GDVMVCLINYCALQDIHLVDCMEIAYDQIKNRRGTLLPNGVFQKDT |
| Ga0315901_112143393 | 3300031963 | Freshwater | GDVMVCLINYCALQDINLVDCMEVAYDQIKNRKGTLLPNGVFQKTLD |
| Ga0315274_110404603 | 3300031999 | Sediment | LVTLILYCALQDIDLVTCIESAYGEIQHRKGTLLPNGVFVKE |
| Ga0315906_101074811 | 3300032050 | Freshwater | DVMVCLINYCALQDINLVNCMEVAYDQIKNRKGILLPNGVFKRDAT |
| Ga0315905_100009001 | 3300032092 | Freshwater | ALQDLNLVDCMEVAYDQIKNRKGTLLPNGLFVKESI |
| Ga0315902_104948311 | 3300032093 | Freshwater | CLINYCALQDIHLVDCMEVAYDQIKNRRGTLLPNGVFQKEV |
| Ga0315903_104509291 | 3300032116 | Freshwater | VMVCLINYCALQDIHLVDCMEVAYDQIKNRRGTLLPNGVFQKEV |
| Ga0315903_107247831 | 3300032116 | Freshwater | KEAIVDAVGDVMVCLINYCALQDIHLVDCMEVAYDQIKNRRGTLLPNGVFQKTFDHL |
| Ga0315277_112656741 | 3300032118 | Sediment | AGIADGVGDVMVCLINYCALQDIHLVECMYAAYAEIKHRKGTLLPNGVFVKE |
| Ga0334995_0556232_544_675 | 3300034062 | Freshwater | VCLINYCALQDIQLVDCMEVAYDQIKNRKGILLPNGVFQKDTT |
| Ga0335051_0562286_3_116 | 3300034109 | Freshwater | MCALLDIDMVDCLEGSWNQIKNRKGTLLPSGVFVKEN |
| Ga0335065_0699007_3_146 | 3300034200 | Freshwater | GDVMVCLVNYCALQDLNLVDCMEVAYDQIKNRRGTLLPNGVFQKDAT |
| ⦗Top⦘ |