


| Basic Information | |
|---|---|
| Family ID | F058844 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 134 |
| Average Sequence Length | 40 residues |
| Representative Sequence | LSDHKQEEAFRVIDRRPFTAEGELRKEVVEEQEREAKREA |
| Number of Associated Samples | 108 |
| Number of Associated Scaffolds | 134 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 97.39 % |
| % of genes near scaffold ends (potentially truncated) | 84.33 % |
| % of genes from short scaffolds (< 2000 bps) | 73.88 % |
| Associated GOLD sequencing projects | 104 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.33 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (81.343 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (26.866 % of family members) |
| Environment Ontology (ENVO) | Unclassified (27.612 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (55.224 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 20.59% β-sheet: 2.94% Coil/Unstructured: 76.47% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.33 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 134 Family Scaffolds |
|---|---|---|
| PF03819 | MazG | 58.21 |
| PF11737 | DUF3300 | 1.49 |
| PF08899 | DUF1844 | 1.49 |
| PF00180 | Iso_dh | 1.49 |
| PF13378 | MR_MLE_C | 1.49 |
| PF04235 | DUF418 | 1.49 |
| PF13432 | TPR_16 | 0.75 |
| PF11937 | DUF3455 | 0.75 |
| PF13302 | Acetyltransf_3 | 0.75 |
| PF03471 | CorC_HlyC | 0.75 |
| PF01212 | Beta_elim_lyase | 0.75 |
| PF13899 | Thioredoxin_7 | 0.75 |
| PF14534 | DUF4440 | 0.75 |
| PF06884 | DUF1264 | 0.75 |
| PF02518 | HATPase_c | 0.75 |
| PF02687 | FtsX | 0.75 |
| PF13480 | Acetyltransf_6 | 0.75 |
| PF07963 | N_methyl | 0.75 |
| PF13407 | Peripla_BP_4 | 0.75 |
| COG ID | Name | Functional Category | % Frequency in 134 Family Scaffolds |
|---|---|---|---|
| COG1167 | DNA-binding transcriptional regulator, MocR family, contains an aminotransferase domain | Transcription [K] | 1.49 |
| COG2311 | Uncharacterized membrane protein YeiB | Function unknown [S] | 1.49 |
| COG0075 | Archaeal aspartate aminotransferase or a related aminotransferase, includes purine catabolism protein PucG | Amino acid transport and metabolism [E] | 0.75 |
| COG0076 | Glutamate or tyrosine decarboxylase or a related PLP-dependent protein | Amino acid transport and metabolism [E] | 0.75 |
| COG0112 | Glycine/serine hydroxymethyltransferase | Amino acid transport and metabolism [E] | 0.75 |
| COG0156 | 7-keto-8-aminopelargonate synthetase or related enzyme | Coenzyme transport and metabolism [H] | 0.75 |
| COG0399 | dTDP-4-amino-4,6-dideoxygalactose transaminase | Cell wall/membrane/envelope biogenesis [M] | 0.75 |
| COG0436 | Aspartate/methionine/tyrosine aminotransferase | Amino acid transport and metabolism [E] | 0.75 |
| COG0520 | Selenocysteine lyase/Cysteine desulfurase | Amino acid transport and metabolism [E] | 0.75 |
| COG0626 | Cystathionine beta-lyase/cystathionine gamma-synthase | Amino acid transport and metabolism [E] | 0.75 |
| COG1003 | Glycine cleavage system protein P (pyridoxal-binding), C-terminal domain | Amino acid transport and metabolism [E] | 0.75 |
| COG1104 | Cysteine desulfurase/Cysteine sulfinate desulfinase IscS or related enzyme, NifS family | Amino acid transport and metabolism [E] | 0.75 |
| COG1921 | Seryl-tRNA(Sec) selenium transferase | Translation, ribosomal structure and biogenesis [J] | 0.75 |
| COG1982 | Arginine/lysine/ornithine decarboxylase | Amino acid transport and metabolism [E] | 0.75 |
| COG2008 | Threonine aldolase | Amino acid transport and metabolism [E] | 0.75 |
| COG2873 | O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependent | Amino acid transport and metabolism [E] | 0.75 |
| COG3033 | Tryptophanase | Amino acid transport and metabolism [E] | 0.75 |
| COG4992 | Acetylornithine/succinyldiaminopimelate/putrescine aminotransferase | Amino acid transport and metabolism [E] | 0.75 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 81.34 % |
| Unclassified | root | N/A | 18.66 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2189573002|GZIGXIF01B444I | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 532 | Open in IMG/M |
| 3300001593|JGI12635J15846_10026891 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4642 | Open in IMG/M |
| 3300001661|JGI12053J15887_10317234 | All Organisms → cellular organisms → Bacteria | 759 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100838333 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 800 | Open in IMG/M |
| 3300002557|JGI25381J37097_1076164 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 548 | Open in IMG/M |
| 3300002907|JGI25613J43889_10034780 | All Organisms → cellular organisms → Bacteria | 1428 | Open in IMG/M |
| 3300005174|Ga0066680_10000267 | All Organisms → cellular organisms → Bacteria | 16081 | Open in IMG/M |
| 3300005175|Ga0066673_10328749 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 892 | Open in IMG/M |
| 3300005366|Ga0070659_100238884 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1503 | Open in IMG/M |
| 3300005518|Ga0070699_100286528 | All Organisms → cellular organisms → Bacteria | 1476 | Open in IMG/M |
| 3300005554|Ga0066661_10162393 | All Organisms → cellular organisms → Bacteria | 1371 | Open in IMG/M |
| 3300005556|Ga0066707_10311499 | All Organisms → cellular organisms → Bacteria | 1030 | Open in IMG/M |
| 3300005764|Ga0066903_105932466 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 640 | Open in IMG/M |
| 3300005921|Ga0070766_10378507 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 923 | Open in IMG/M |
| 3300006050|Ga0075028_100523051 | All Organisms → cellular organisms → Bacteria | 695 | Open in IMG/M |
| 3300006102|Ga0075015_100023597 | All Organisms → cellular organisms → Bacteria | 2749 | Open in IMG/M |
| 3300006796|Ga0066665_10628635 | All Organisms → cellular organisms → Bacteria | 858 | Open in IMG/M |
| 3300006804|Ga0079221_11078853 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 612 | Open in IMG/M |
| 3300006806|Ga0079220_10523775 | All Organisms → cellular organisms → Bacteria | 818 | Open in IMG/M |
| 3300006903|Ga0075426_10022506 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4501 | Open in IMG/M |
| 3300006954|Ga0079219_11983121 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
| 3300006954|Ga0079219_12372803 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 514 | Open in IMG/M |
| 3300009038|Ga0099829_11206967 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 626 | Open in IMG/M |
| 3300009088|Ga0099830_11386070 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
| 3300009088|Ga0099830_11568635 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 548 | Open in IMG/M |
| 3300009137|Ga0066709_100176559 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2774 | Open in IMG/M |
| 3300009137|Ga0066709_103900896 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300010335|Ga0134063_10442245 | All Organisms → cellular organisms → Bacteria | 643 | Open in IMG/M |
| 3300010341|Ga0074045_11080087 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 501 | Open in IMG/M |
| 3300010358|Ga0126370_10685840 | All Organisms → cellular organisms → Bacteria | 898 | Open in IMG/M |
| 3300010376|Ga0126381_101068490 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1166 | Open in IMG/M |
| 3300010376|Ga0126381_102951217 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 676 | Open in IMG/M |
| 3300010379|Ga0136449_104186501 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
| 3300011270|Ga0137391_10217818 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1659 | Open in IMG/M |
| 3300011271|Ga0137393_10059119 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3023 | Open in IMG/M |
| 3300011271|Ga0137393_10094207 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 2433 | Open in IMG/M |
| 3300011271|Ga0137393_11091459 | All Organisms → cellular organisms → Bacteria | 678 | Open in IMG/M |
| 3300011271|Ga0137393_11510090 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
| 3300012199|Ga0137383_10498507 | All Organisms → cellular organisms → Bacteria | 892 | Open in IMG/M |
| 3300012205|Ga0137362_10084164 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2658 | Open in IMG/M |
| 3300012205|Ga0137362_10245248 | All Organisms → cellular organisms → Bacteria | 1547 | Open in IMG/M |
| 3300012205|Ga0137362_10818860 | All Organisms → cellular organisms → Bacteria | 797 | Open in IMG/M |
| 3300012207|Ga0137381_10443648 | All Organisms → cellular organisms → Bacteria | 1133 | Open in IMG/M |
| 3300012361|Ga0137360_10260167 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1428 | Open in IMG/M |
| 3300012361|Ga0137360_11027448 | All Organisms → cellular organisms → Bacteria | 711 | Open in IMG/M |
| 3300012362|Ga0137361_10841569 | All Organisms → cellular organisms → Bacteria | 834 | Open in IMG/M |
| 3300012685|Ga0137397_11290462 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 520 | Open in IMG/M |
| 3300012918|Ga0137396_10696902 | All Organisms → cellular organisms → Bacteria | 749 | Open in IMG/M |
| 3300012923|Ga0137359_11739117 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 511 | Open in IMG/M |
| 3300012925|Ga0137419_10019444 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3929 | Open in IMG/M |
| 3300012925|Ga0137419_10188412 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1519 | Open in IMG/M |
| 3300012929|Ga0137404_10337363 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1316 | Open in IMG/M |
| 3300014150|Ga0134081_10047438 | All Organisms → cellular organisms → Bacteria | 1277 | Open in IMG/M |
| 3300017933|Ga0187801_10421396 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
| 3300017934|Ga0187803_10471575 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300017975|Ga0187782_11673262 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 503 | Open in IMG/M |
| 3300018007|Ga0187805_10351394 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 681 | Open in IMG/M |
| 3300018018|Ga0187886_1252347 | All Organisms → cellular organisms → Bacteria | 666 | Open in IMG/M |
| 3300018086|Ga0187769_11133938 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
| 3300020580|Ga0210403_10087121 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2523 | Open in IMG/M |
| 3300020581|Ga0210399_10768025 | All Organisms → cellular organisms → Bacteria | 789 | Open in IMG/M |
| 3300020581|Ga0210399_10965166 | All Organisms → cellular organisms → Bacteria | 688 | Open in IMG/M |
| 3300020582|Ga0210395_10806536 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 700 | Open in IMG/M |
| 3300020583|Ga0210401_10363235 | All Organisms → cellular organisms → Bacteria | 1309 | Open in IMG/M |
| 3300020583|Ga0210401_11514442 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 528 | Open in IMG/M |
| 3300021086|Ga0179596_10466353 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
| 3300021088|Ga0210404_10658535 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
| 3300021168|Ga0210406_10012341 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 8279 | Open in IMG/M |
| 3300021168|Ga0210406_11285754 | Not Available | 528 | Open in IMG/M |
| 3300021170|Ga0210400_10180508 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1711 | Open in IMG/M |
| 3300021170|Ga0210400_10539571 | All Organisms → cellular organisms → Bacteria | 962 | Open in IMG/M |
| 3300021170|Ga0210400_10911126 | Not Available | 717 | Open in IMG/M |
| 3300021401|Ga0210393_10491832 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 1002 | Open in IMG/M |
| 3300021403|Ga0210397_10080864 | All Organisms → cellular organisms → Bacteria | 2153 | Open in IMG/M |
| 3300021407|Ga0210383_10043240 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia | 3754 | Open in IMG/M |
| 3300021478|Ga0210402_11434123 | Not Available | 618 | Open in IMG/M |
| 3300021479|Ga0210410_10073412 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3000 | Open in IMG/M |
| 3300021479|Ga0210410_11026230 | All Organisms → cellular organisms → Bacteria | 714 | Open in IMG/M |
| 3300021479|Ga0210410_11124288 | All Organisms → cellular organisms → Bacteria | 676 | Open in IMG/M |
| 3300021559|Ga0210409_11729904 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300024288|Ga0179589_10357404 | All Organisms → cellular organisms → Bacteria | 664 | Open in IMG/M |
| 3300025409|Ga0208321_1031689 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 883 | Open in IMG/M |
| 3300025544|Ga0208078_1029713 | All Organisms → cellular organisms → Bacteria | 1205 | Open in IMG/M |
| 3300025905|Ga0207685_10714699 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300026309|Ga0209055_1074794 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 1407 | Open in IMG/M |
| 3300026310|Ga0209239_1021256 | All Organisms → cellular organisms → Bacteria | 3215 | Open in IMG/M |
| 3300026319|Ga0209647_1120005 | All Organisms → cellular organisms → Bacteria | 1206 | Open in IMG/M |
| 3300026342|Ga0209057_1090279 | All Organisms → cellular organisms → Bacteria | 1268 | Open in IMG/M |
| 3300026482|Ga0257172_1035654 | All Organisms → cellular organisms → Bacteria | 902 | Open in IMG/M |
| 3300026482|Ga0257172_1062409 | All Organisms → cellular organisms → Bacteria | 683 | Open in IMG/M |
| 3300026532|Ga0209160_1165680 | All Organisms → cellular organisms → Bacteria | 972 | Open in IMG/M |
| 3300026557|Ga0179587_10676861 | All Organisms → cellular organisms → Bacteria | 679 | Open in IMG/M |
| 3300026959|Ga0207852_1002483 | All Organisms → cellular organisms → Bacteria | 2202 | Open in IMG/M |
| 3300027090|Ga0208604_1014614 | Not Available | 746 | Open in IMG/M |
| 3300027381|Ga0208983_1085531 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
| 3300027535|Ga0209734_1111142 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300027660|Ga0209736_1047301 | All Organisms → cellular organisms → Bacteria | 1232 | Open in IMG/M |
| 3300027671|Ga0209588_1050581 | All Organisms → cellular organisms → Bacteria | 1344 | Open in IMG/M |
| 3300027727|Ga0209328_10221812 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
| 3300027826|Ga0209060_10573371 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 511 | Open in IMG/M |
| 3300027846|Ga0209180_10317196 | All Organisms → cellular organisms → Bacteria | 892 | Open in IMG/M |
| 3300027884|Ga0209275_10428378 | All Organisms → cellular organisms → Bacteria | 748 | Open in IMG/M |
| 3300027903|Ga0209488_10639535 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 768 | Open in IMG/M |
| 3300027905|Ga0209415_11057344 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 533 | Open in IMG/M |
| 3300028906|Ga0308309_10711714 | Not Available | 872 | Open in IMG/M |
| 3300029636|Ga0222749_10649057 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
| 3300031240|Ga0265320_10470913 | Not Available | 555 | Open in IMG/M |
| 3300031679|Ga0318561_10270197 | All Organisms → cellular organisms → Bacteria | 928 | Open in IMG/M |
| 3300031820|Ga0307473_10079702 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1674 | Open in IMG/M |
| 3300031823|Ga0307478_10300685 | All Organisms → cellular organisms → Bacteria | 1314 | Open in IMG/M |
| 3300031946|Ga0310910_11091238 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
| 3300032180|Ga0307471_100766528 | All Organisms → cellular organisms → Bacteria | 1131 | Open in IMG/M |
| 3300032180|Ga0307471_100802059 | All Organisms → cellular organisms → Bacteria | 1108 | Open in IMG/M |
| 3300032898|Ga0335072_10997095 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 769 | Open in IMG/M |
| 3300033289|Ga0310914_11109019 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 692 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 26.87% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 20.15% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 5.97% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.22% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 4.48% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.48% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.99% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.99% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.99% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.99% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.24% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.49% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.49% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.49% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.49% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.49% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.49% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.49% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.75% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.75% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.75% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.75% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.75% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.75% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.75% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.75% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.75% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.75% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.75% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2189573002 | Grass soil microbial communities from Rothamsted Park, UK - FE1 (NaCl 30g/L 5ml) | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300002557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm | Environmental | Open in IMG/M |
| 3300002907 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014150 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300014165 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaG | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
| 3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
| 3300017934 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3 | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
| 3300018018 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_150 | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300020140 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300025409 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300025544 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-2 deep-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026309 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes) | Environmental | Open in IMG/M |
| 3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026319 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026342 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 (SPAdes) | Environmental | Open in IMG/M |
| 3300026482 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-16-B | Environmental | Open in IMG/M |
| 3300026490 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-A | Environmental | Open in IMG/M |
| 3300026532 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300026959 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027090 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF016 (SPAdes) | Environmental | Open in IMG/M |
| 3300027381 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027535 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027660 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027727 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027826 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Host-Associated | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FE1_07617410 | 2189573002 | Grass Soil | VAENNQEDNFRVIDRRPFTSEGELRPDVVAEQEKESHREEIK |
| JGI12635J15846_100268911 | 3300001593 | Forest Soil | LSDHKQDDSFRVIDRRPFTSEGVIRPEVVEEKEREAALHPPPRPATETKASPAG |
| JGI12053J15887_103172341 | 3300001661 | Forest Soil | LSENKHEESSFRVIDRRPFTAEGELRKEVVEQEERDAARDA |
| JGIcombinedJ26739_1008383332 | 3300002245 | Forest Soil | LPEDKHEEAFRVIDRRPFTAEGDIRKDVVEAEERKAEREAQLEAAR |
| JGI25381J37097_10761641 | 3300002557 | Grasslands Soil | LSDHKQEEAFRVIDRRPFTAEGELRKEVVEEQEREAKREA |
| JGI25613J43889_100347802 | 3300002907 | Grasslands Soil | VSDHKPEEAFRVIDRRPFTAEGELRKEVVEEEEREAKREAAKIP |
| Ga0066680_1000026713 | 3300005174 | Soil | LSDHKQDDTFRVIDRRPFTSEGELRKDVVEEQEREAKVARAP |
| Ga0066673_103287492 | 3300005175 | Soil | MSDHKQDDSFRVIDRRPFTSEGELRKDVVEEQQREAKAEAAKAPP |
| Ga0070659_1002388841 | 3300005366 | Corn Rhizosphere | LPDQKQPDDGFRVIDRRPFTAEGELRQDVVEQEERQARQEEVSK |
| Ga0070699_1002865283 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | LTDHKHEDSFRVIDRRPFTAEGELRKEAMEEKEREAKREERLHPVA |
| Ga0070730_108250111 | 3300005537 | Surface Soil | VSEHKQDEGFKVIDRRPFTAEGEMRKEVVEEQEREAQRE |
| Ga0066661_101623933 | 3300005554 | Soil | LSDHKPEEAFRVIDRRPFTAEGELRKEVVEQEEREAKREAAK |
| Ga0066707_103114992 | 3300005556 | Soil | LSDHKQDEAFRVIDRRPFTAEGELRKEVVEQEEREAKREAAKVPATP |
| Ga0066903_1059324662 | 3300005764 | Tropical Forest Soil | VADHTEDGFKVVDRRPFTADGELRPEVVEEQEREAKRE |
| Ga0070766_103785072 | 3300005921 | Soil | LTDHKQEESFRVIDRRPFTAEGELRPEAMEEKEREAK |
| Ga0075028_1005230511 | 3300006050 | Watersheds | LPDQKPHEDSFRVIDRRLFTPEGELRQEAVELEEREARREA |
| Ga0075015_1000235974 | 3300006102 | Watersheds | VSEHKQEEAFRVIDRRPFTAEGDLRKEVVEEEERE |
| Ga0066665_106286351 | 3300006796 | Soil | LSDHKPEEAFRVIDRRPFTAEGELRKEVVEQEEREAKREAAKV |
| Ga0079221_110788533 | 3300006804 | Agricultural Soil | LAEHKSDESFKVIDRRPFTAEGELRKEAIEEKEREERAHKAAEPPQ |
| Ga0079220_105237752 | 3300006806 | Agricultural Soil | MSDHKDHKQDDSFRVIDRRPFTSEGELRKDVVEEQE |
| Ga0075426_100225066 | 3300006903 | Populus Rhizosphere | LSDHKPEEAFRVIDRRPFTAEGELRKEVVEQEEREAK |
| Ga0079219_119831211 | 3300006954 | Agricultural Soil | MSDHKQDDSFRVIDRRPFTSEGELRKDVVEEQERE |
| Ga0079219_123728032 | 3300006954 | Agricultural Soil | LSDHKQEDTFRVIDRRPFTSEGELRKDVVEEQEREAKRE |
| Ga0099829_112069671 | 3300009038 | Vadose Zone Soil | LSEKKPEESFRVIDRRPFTSEGELRKEVVEEAEREAKREAAMRPIA |
| Ga0099829_117982731 | 3300009038 | Vadose Zone Soil | VAEKKPEESFRVIDRRPFTTDGELREEFVAEQQREAQQEAKKAAE |
| Ga0099830_113860701 | 3300009088 | Vadose Zone Soil | LSDHNQDEAFRVIDRRPCTAEGELRKEVVEEEEREAKREA |
| Ga0099830_115686351 | 3300009088 | Vadose Zone Soil | LADERHEESFKVIDRRPFTAEGEVRKEIVEQEKRE |
| Ga0066709_1001765594 | 3300009137 | Grasslands Soil | LSDHKQEDTFRVIDRRPFTSEGELRKDVVEEQEREAKVEAAKTPR |
| Ga0066709_1039008962 | 3300009137 | Grasslands Soil | LSEHKQEEAFRVIDRRPFTAEGELRKEVVEEAEREAKREAAKIP |
| Ga0134063_104422452 | 3300010335 | Grasslands Soil | LSDHKQDDSFRVIDRRPFTSEGELRKDVVEEQEREAKVAATKASPA |
| Ga0074045_110800871 | 3300010341 | Bog Forest Soil | VRINPVADQNPEGTFRVIDRRPFTSEGELRPDVVQEQEREAKVEA |
| Ga0126370_106858401 | 3300010358 | Tropical Forest Soil | LADRKHEDTFRVIDRRPFTSEGELRKDVLEEQEREAKR |
| Ga0126381_1010684902 | 3300010376 | Tropical Forest Soil | VADHTEDGFKVVDRRPFTADGELRPEVVEEQEREA |
| Ga0126381_1029512171 | 3300010376 | Tropical Forest Soil | VADHTEDGFKVVDRRPFTADGELRPEVVEEQEREAKREE |
| Ga0136449_1041865011 | 3300010379 | Peatlands Soil | LSDHKQSDNKQESAFRVIDRRPFTAEGELRHEAVEEEQREARKE |
| Ga0137391_102178181 | 3300011270 | Vadose Zone Soil | LSDHKQEEAFRVIDRRPFTAEGELRKEVVEEEEREAKRE |
| Ga0137393_100591191 | 3300011271 | Vadose Zone Soil | VSDHKPEEAFRVIDRRPFTAEGELRKEVVEEEEREAKREAAKIPA |
| Ga0137393_100942073 | 3300011271 | Vadose Zone Soil | VSDRKPEEAFRVIDRRPFTAEGELRKEVVEEEEREAKREAAKIPA |
| Ga0137393_110914592 | 3300011271 | Vadose Zone Soil | LSDHKQDEAFRVIDRRPFTAEGELRKEVVEEQEREARREATVHP |
| Ga0137393_115100902 | 3300011271 | Vadose Zone Soil | LSDHKQEDSFRVIDRRPFTSEGELRKEIAEEVERE |
| Ga0137383_104985071 | 3300012199 | Vadose Zone Soil | VSDHKPEEAFRIIDRRPFTAEGELRKEVVEEEEREAKREAAKIP |
| Ga0137362_1000023821 | 3300012205 | Vadose Zone Soil | VAEKKPEESFRVIDRRPFTTDGELREEFVAEQQREAQREAKK |
| Ga0137362_100841641 | 3300012205 | Vadose Zone Soil | LSDHKQEVEFRVIDRRPFTAEGELRKEVVEEAEREAKREA |
| Ga0137362_102452484 | 3300012205 | Vadose Zone Soil | LSDHKPEEAFRVIDRRPFTPEGELRKEVVEEEEREAKREAAKIPAAPPQ |
| Ga0137362_108188602 | 3300012205 | Vadose Zone Soil | LSDHKQEDSFRVIDRRPFTSEGELRKEIAEEVEREAKREA |
| Ga0137381_104436481 | 3300012207 | Vadose Zone Soil | LSDHKQEDSFRVIDRRPFTSEGELRKEIAEEVEREA |
| Ga0137360_102601673 | 3300012361 | Vadose Zone Soil | VSDHKPEEAFRVIDRRPFTAEGELRKEVVEEEEREAKREAAKVP |
| Ga0137360_110274481 | 3300012361 | Vadose Zone Soil | LSDHKQEEAFRVIDRRPFTAEGELRKEVVEEEERE |
| Ga0137360_114767852 | 3300012361 | Vadose Zone Soil | VAEKKSHEESFRVIDRRPFTTDGELREEFVAEQARETQQEVK |
| Ga0137361_108415692 | 3300012362 | Vadose Zone Soil | LPDHKKEEVFRVIDRRPFTAEGELRKEVVEEEEREA |
| Ga0137397_112904622 | 3300012685 | Vadose Zone Soil | LSDHKQDDGFRVIDRRPFTSEGELRKEIVEEEEREAKREAAQR |
| Ga0137395_102845272 | 3300012917 | Vadose Zone Soil | VAEKKPEESFRVIDRRPFTTDGELREEFVAEQQREAQREA |
| Ga0137396_106969022 | 3300012918 | Vadose Zone Soil | LSDHKPEEEFRVIDRRPFTADGELRKEVVEEEEREA |
| Ga0137359_117391172 | 3300012923 | Vadose Zone Soil | LPDHKREEAFRVIDRRPFTAEGELRKEVVEEEEREAKRE |
| Ga0137419_100194446 | 3300012925 | Vadose Zone Soil | LPDNKHSEHKQEETFRVIDRRPFTSEGELRKEVVEEEE |
| Ga0137419_101884122 | 3300012925 | Vadose Zone Soil | LSDRKPEEAFRVIDRRPFTAEGELRKEVVEEQER* |
| Ga0137404_103373632 | 3300012929 | Vadose Zone Soil | LSDHKQEEAFRVIDRRPFTAEGELRKEVVEEAEREAKREAA* |
| Ga0134081_100474382 | 3300014150 | Grasslands Soil | LSDHKPEEAFRVIDRRPFTAEGELRKEVVEQEEREAKREAAKVPATP |
| Ga0181523_102349653 | 3300014165 | Bog | VAENNEGFKVIDRRPFTAEGEIRKEVVEEQEREAKREE |
| Ga0182041_114978132 | 3300016294 | Soil | VADHNEDTGFKVIDRRPFTAEGEVRKEVVEEQEREAKRE |
| Ga0187814_104576692 | 3300017932 | Freshwater Sediment | VADNKDEGFKVIDRRPFTAEGEIRKELVEEQEREARRE |
| Ga0187801_104213962 | 3300017933 | Freshwater Sediment | VSDHKQEEAFRVIDRRPFTAEGDLRKEVVEEEERE |
| Ga0187803_104715752 | 3300017934 | Freshwater Sediment | VGDQNSEGTFRVIDRRPFTSEGELRQDVVAEQEREAKS |
| Ga0187777_104251172 | 3300017974 | Tropical Peatland | VADHNEDSGFKVIDRRPFTAEGTVRKEVVEEQEREAKREE |
| Ga0187782_116732621 | 3300017975 | Tropical Peatland | VADQNSEGTFRVIDRRPFTSEGELRPDVVQEQEREAKIEAAKERPVP |
| Ga0187805_103513942 | 3300018007 | Freshwater Sediment | LSEHKQEESFRVIDRRPFTSEGELRQDVVREEEREAQKE |
| Ga0187886_12523472 | 3300018018 | Peatland | VADQNPEGTFRVIDRRPFTSEGDLRPDVVQEQEREA |
| Ga0187769_111339382 | 3300018086 | Tropical Peatland | VADQNPEGTFRVIDRRPFTSEGELRPDVVQEQEREAKSEA |
| Ga0187771_107155051 | 3300018088 | Tropical Peatland | VPDHNDEGFKVIDPRPLTAEGEIRKEVVEEQETEAKRGE |
| Ga0179590_10259211 | 3300020140 | Vadose Zone Soil | VSEHKQDEGFKVIDRRPFTAEGEMRKEVVEEQEREA |
| Ga0210403_100871214 | 3300020580 | Soil | LSDPKHEDSFRVIDRRPFTAEGELRKEVVEEEEREA |
| Ga0210399_107680251 | 3300020581 | Soil | VAENNQEDNFRVIDRRPFTSEGELRPDVVAEQEKES |
| Ga0210399_109651661 | 3300020581 | Soil | LLRIVPLTDHKQEDSFRVIDRRPFTAEGELRPEAMEEKERE |
| Ga0210395_108065361 | 3300020582 | Soil | LAEHKDHKHEEAFRVIDRRPFTAEGELRKEVVDEKEREAKREAAKAPVSP |
| Ga0210401_103632353 | 3300020583 | Soil | VAENNQEDNFRVIDRRPFTSEGELRPDVVAEQEKE |
| Ga0210401_115144421 | 3300020583 | Soil | LSDPKHEDSFRVIDRRPFTAKGELRKEVVEEEEREAKREAARH |
| Ga0179596_100341303 | 3300021086 | Vadose Zone Soil | VAEKKPAEESFRVIDRRPFTTEGELREEFAAEKAR |
| Ga0179596_104663531 | 3300021086 | Vadose Zone Soil | LSDHKQEEAFRVIDRRPFTAEGELRKEVVEEAEREAKREAAKIPAAPPEA |
| Ga0210404_106585352 | 3300021088 | Soil | LSDPKQEDSFRVIDRRPFTAEGELRKEVVEEEEREAQREA |
| Ga0210406_100123411 | 3300021168 | Soil | LSDQKHEESFRVIDRRPFTAEGELRKEVVEAEERETKREAALHPPAPA |
| Ga0210406_112857541 | 3300021168 | Soil | VAENKENNEDSSFKVIDRRPFTSEGELRPDVVQEQ |
| Ga0210400_101805081 | 3300021170 | Soil | LPEDKQEVSFRVIDRRPFTAEGEIRKDVVEAEERKAEREA |
| Ga0210400_105395711 | 3300021170 | Soil | LSDHKQEEAFRVIDRRPFTAEGELRKEVVEEEEREAKR |
| Ga0210400_109111262 | 3300021170 | Soil | LSDHKKEEAFRVIDRRPFTAEGELRKEVVEEQEREAKREAT |
| Ga0210393_104918321 | 3300021401 | Soil | LTDHKQEDSFRVIDRRPFTAEGELRKEAMEEKEREAK |
| Ga0210397_100808641 | 3300021403 | Soil | LSENKQEESFRVIDKRPFTAEGELRQEVVEQEEREA |
| Ga0210383_100432405 | 3300021407 | Soil | LPDHKQEDSFRVIDRRPFTAEGELRKEVVEQEEREAERE |
| Ga0210402_114341232 | 3300021478 | Soil | LSDHKKEEAFRVIDRRPFTAEGELRKEVVEEEEREAKREAAQR |
| Ga0210410_100734124 | 3300021479 | Soil | LSDQKQEESFRVIDRRPFTAEGELRPEAVIAEEREAKREA |
| Ga0210410_110262302 | 3300021479 | Soil | LTDHKQEDSFRVIDRRPFTAEGELRPEAMEEKEREAKREERLHP |
| Ga0210410_111242882 | 3300021479 | Soil | LPDDKHEEKHEESFKVIDRRPFTADGELRQEAIAEEAREAKREA |
| Ga0210409_117299042 | 3300021559 | Soil | LADQKKEDSFRVIDRRPFTSEGDLRKEVVEEKEREARQEA |
| Ga0179589_103574042 | 3300024288 | Vadose Zone Soil | LSDHKQEEAFRVIDRRPFTAEGELRKEVVEEAEREAKREA |
| Ga0208321_10316892 | 3300025409 | Peatland | VADQNPEGTFRVIDRRPFTSEGELRPDVVQEQERE |
| Ga0208078_10297132 | 3300025544 | Arctic Peat Soil | LPEDKQEEAFRVIDRRPFTAEGEIRKDVVEAEERKAEREAQLEAARAAGVDVSFDM |
| Ga0207685_107146991 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | VPDHRPEDSFRVIDRRPFTNDGELRQEIVAEQERE |
| Ga0209055_10747941 | 3300026309 | Soil | LSDHKPEEAFRVIDRRPFTAEGELRKEVVEQEEREAKREAAKVPATPSEAP |
| Ga0209239_10212561 | 3300026310 | Grasslands Soil | LSDHKQEEAFRVIDRRPFTAEGELRKEVVEEKEREARRE |
| Ga0209647_11200052 | 3300026319 | Grasslands Soil | LSDQKQEDSFRVIDRRPFTSEGELRKEVVEEKEREATREAVHPAPSAST |
| Ga0209057_10902792 | 3300026342 | Soil | LSDHKPEEAFRVIDRRPFTAEGELRKEVVEQEEREAKREAA |
| Ga0257172_10356542 | 3300026482 | Soil | LSDHKQEVEFRVIDRRPFTAEGELRKEVVEEAEREAKREAAKIPAAPTE |
| Ga0257172_10624092 | 3300026482 | Soil | LSDHKQEEAFRVIDRRPFTAEGELRKEVVEEAEREAKREAAKIPAA |
| Ga0257153_10129712 | 3300026490 | Soil | VSEHKQDEGFKVIDRRPFTAEGEMRKEVVEEQEREAQ |
| Ga0209160_11656801 | 3300026532 | Soil | LADEKHEESFKVIDRRPFTAEGEVRKEIVEQEKREQEAA |
| Ga0179587_103837531 | 3300026557 | Vadose Zone Soil | VSEHKQDEGFKVIDRRPFTAEGEIRKEVVEEQEREA |
| Ga0179587_106768611 | 3300026557 | Vadose Zone Soil | VAEHKQEEAFRVIDRRPFTAEGDLRKEVVEEEEREAKREAAKHPAAPPE |
| Ga0207852_10024834 | 3300026959 | Tropical Forest Soil | VADQTEDGFKVVDRRPFTAEGELRREVVEEQEREAKREE |
| Ga0208604_10146141 | 3300027090 | Forest Soil | VAENNQEDNFRVIDRRPFTSEGELRPDVVAEQEKESH |
| Ga0208983_10855312 | 3300027381 | Forest Soil | LSDHKQEEAFRVIDRRPFTAEGELRKEVVEEAERE |
| Ga0209734_11111422 | 3300027535 | Forest Soil | LSEYKEEDTFRVIDRRPFTAEGELRKDVAENEERE |
| Ga0209736_10473012 | 3300027660 | Forest Soil | LSEYKEEDTFRVIDRRPFTAEGELRKDVAENEEREARREAELHPP |
| Ga0209588_10505813 | 3300027671 | Vadose Zone Soil | VSDHKPEEAFRVIDRRPFTAEGELRKEVVEEEERE |
| Ga0209328_102218121 | 3300027727 | Forest Soil | LPDQKQEDSFRVIDRRPFTAEGELRKDVVDSQEREAHREAALHPPTPAP |
| Ga0209060_105733712 | 3300027826 | Surface Soil | SHLSDNKQEDSFRVIDRRPFTSEGELRQEVVEEEKREAAREA |
| Ga0209180_103171961 | 3300027846 | Vadose Zone Soil | VSDHKPEEAFRVIDRRPFTAEGELRKEVVEEEEREA |
| Ga0209283_102116052 | 3300027875 | Vadose Zone Soil | VAEKKPAEESFRVIDRRPFTTEGELREEFVAEKAREAQLEAKKE |
| Ga0209275_104283782 | 3300027884 | Soil | LSDHKQEDSFRVIDRRPFTAEGELRKEVVEQEEREAEREAAVR |
| Ga0209380_108733491 | 3300027889 | Soil | VAENKDEGFKVIDRRPFTAEGDIRKEVVEEQEREAKREEV |
| Ga0209488_106395352 | 3300027903 | Vadose Zone Soil | LSDHKQDDGFRVIDRRPFTSEGELRKEIVEQEEREAKR |
| Ga0209415_110573443 | 3300027905 | Peatlands Soil | VADQNPEGTFRVIDRRPFTSEGELRPDVVQEQEREAKVEAA |
| Ga0308309_107117141 | 3300028906 | Soil | VAENKENNEDSSFKVIDRRPFTSEGELRPDVVKEQEREA |
| Ga0222749_106490571 | 3300029636 | Soil | LPDQKQEDSFRVIDRRPFTAEGELRQEVVEQEEREAQREAFRPPIPPA |
| Ga0265320_104709132 | 3300031240 | Rhizosphere | LTDHKQEDKDSFRVIDRRPFTSEGEPRKEAMEERERE |
| Ga0318561_102701972 | 3300031679 | Soil | LSDHKQDDTFRVIDRRPFTSEGELRKDVVEEQEREARV |
| Ga0307473_100797021 | 3300031820 | Hardwood Forest Soil | LSDHKQDDTFRVIDRRPFTSEGELRKDVAEEQEREAQVARAPAEQ |
| Ga0307478_103006851 | 3300031823 | Hardwood Forest Soil | LSDPKEHKHEEAFRVIDRRPFTSEGELRKEVVAEAE |
| Ga0307478_116017561 | 3300031823 | Hardwood Forest Soil | VAEKKPEESFRVIDRRPFTTDGELREEFVAEQQRE |
| Ga0310910_110912381 | 3300031946 | Soil | VSEQKPEDSFRVIDRRPFTNEGELRREIVEEQEREARQEAKK |
| Ga0307471_1007665281 | 3300032180 | Hardwood Forest Soil | LPEDKQEEAFRVIDRRPFTAEGDIRKDVVEAEERKAEREAQLEAARHPAP |
| Ga0307471_1008020592 | 3300032180 | Hardwood Forest Soil | LSDHKQEEAFRVIDRRPFTAEGELRKEVVEEEEREAK |
| Ga0307472_1004614931 | 3300032205 | Hardwood Forest Soil | VAEKKPEESFRVIDRRPFTTEGELREEFVAEQQREA |
| Ga0306920_1000968705 | 3300032261 | Soil | VADHTEDGFKVVDRRPFTADGELRPEVVEEQEREAK |
| Ga0335072_109970951 | 3300032898 | Soil | VADNKDEGFKVIDRRPFTAEGEIRKEVVEEQEREAR |
| Ga0310914_111090191 | 3300033289 | Soil | VADHTEDGFKVVDRRPFTADGELRPEVVEEQEREAKREEVKEK |
| ⦗Top⦘ |