


| Basic Information | |
|---|---|
| Family ID | F058482 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 135 |
| Average Sequence Length | 43 residues |
| Representative Sequence | RQGTAWSRYLICPNCGKRHDPKNRLLQMGYHREGYWKVDEC |
| Number of Associated Samples | 120 |
| Number of Associated Scaffolds | 135 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.76 % |
| % of genes near scaffold ends (potentially truncated) | 96.30 % |
| % of genes from short scaffolds (< 2000 bps) | 92.59 % |
| Associated GOLD sequencing projects | 115 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.40 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (82.963 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (14.815 % of family members) |
| Environment Ontology (ENVO) | Unclassified (21.481 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (57.037 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 18.84% Coil/Unstructured: 81.16% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.40 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 135 Family Scaffolds |
|---|---|---|
| PF00076 | RRM_1 | 67.41 |
| PF00056 | Ldh_1_N | 9.63 |
| PF02866 | Ldh_1_C | 8.15 |
| PF00762 | Ferrochelatase | 1.48 |
| PF00072 | Response_reg | 0.74 |
| PF13340 | DUF4096 | 0.74 |
| PF00005 | ABC_tran | 0.74 |
| PF01734 | Patatin | 0.74 |
| PF04055 | Radical_SAM | 0.74 |
| COG ID | Name | Functional Category | % Frequency in 135 Family Scaffolds |
|---|---|---|---|
| COG0039 | Malate/lactate dehydrogenase | Energy production and conversion [C] | 17.78 |
| COG1486 | Alpha-galactosidase/6-phospho-beta-glucosidase, family 4 of glycosyl hydrolase | Carbohydrate transport and metabolism [G] | 9.63 |
| COG0276 | Protoheme ferro-lyase (ferrochelatase) | Coenzyme transport and metabolism [H] | 1.48 |
| COG1752 | Predicted acylesterase/phospholipase RssA, containd patatin domain | General function prediction only [R] | 0.74 |
| COG3621 | Patatin-like phospholipase/acyl hydrolase, includes sporulation protein CotR | General function prediction only [R] | 0.74 |
| COG4667 | Predicted phospholipase, patatin/cPLA2 family | Lipid transport and metabolism [I] | 0.74 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 82.96 % |
| Unclassified | root | N/A | 17.04 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001593|JGI12635J15846_10598122 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
| 3300004091|Ga0062387_100163089 | All Organisms → cellular organisms → Bacteria | 1300 | Open in IMG/M |
| 3300004092|Ga0062389_100956377 | All Organisms → cellular organisms → Bacteria | 1040 | Open in IMG/M |
| 3300004092|Ga0062389_104458303 | Not Available | 527 | Open in IMG/M |
| 3300004635|Ga0062388_102944224 | Not Available | 502 | Open in IMG/M |
| 3300005176|Ga0066679_11068137 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 500 | Open in IMG/M |
| 3300005454|Ga0066687_10424891 | All Organisms → cellular organisms → Bacteria | 773 | Open in IMG/M |
| 3300005458|Ga0070681_10395218 | Not Available | 1293 | Open in IMG/M |
| 3300005541|Ga0070733_10945860 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
| 3300005542|Ga0070732_10018988 | All Organisms → cellular organisms → Bacteria | 3857 | Open in IMG/M |
| 3300005569|Ga0066705_10198178 | Not Available | 1256 | Open in IMG/M |
| 3300005602|Ga0070762_11251962 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 514 | Open in IMG/M |
| 3300005610|Ga0070763_10729833 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
| 3300005614|Ga0068856_101602383 | Not Available | 664 | Open in IMG/M |
| 3300005712|Ga0070764_10518435 | All Organisms → cellular organisms → Bacteria | 719 | Open in IMG/M |
| 3300005874|Ga0075288_1075779 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
| 3300005921|Ga0070766_10386260 | All Organisms → cellular organisms → Bacteria | 914 | Open in IMG/M |
| 3300005993|Ga0080027_10132820 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 948 | Open in IMG/M |
| 3300005994|Ga0066789_10431278 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
| 3300006050|Ga0075028_100987208 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
| 3300006059|Ga0075017_100537364 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 889 | Open in IMG/M |
| 3300006162|Ga0075030_101489616 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300006163|Ga0070715_10423222 | All Organisms → cellular organisms → Bacteria | 746 | Open in IMG/M |
| 3300006173|Ga0070716_100257920 | All Organisms → cellular organisms → Bacteria | 1191 | Open in IMG/M |
| 3300006173|Ga0070716_100754651 | All Organisms → cellular organisms → Bacteria | 749 | Open in IMG/M |
| 3300006358|Ga0068871_101531170 | Not Available | 630 | Open in IMG/M |
| 3300006796|Ga0066665_11703319 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300006804|Ga0079221_11209928 | Not Available | 587 | Open in IMG/M |
| 3300006806|Ga0079220_10966670 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 671 | Open in IMG/M |
| 3300007258|Ga0099793_10310541 | Not Available | 767 | Open in IMG/M |
| 3300009090|Ga0099827_11117280 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 684 | Open in IMG/M |
| 3300009093|Ga0105240_10986910 | Not Available | 901 | Open in IMG/M |
| 3300009098|Ga0105245_13078524 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 517 | Open in IMG/M |
| 3300009525|Ga0116220_10219432 | All Organisms → cellular organisms → Bacteria | 826 | Open in IMG/M |
| 3300009633|Ga0116129_1214510 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300009683|Ga0116224_10173532 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1035 | Open in IMG/M |
| 3300009759|Ga0116101_1091122 | All Organisms → cellular organisms → Bacteria | 700 | Open in IMG/M |
| 3300009792|Ga0126374_10298420 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1079 | Open in IMG/M |
| 3300010048|Ga0126373_12192808 | Not Available | 614 | Open in IMG/M |
| 3300010303|Ga0134082_10204117 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 810 | Open in IMG/M |
| 3300010358|Ga0126370_10980000 | Not Available | 770 | Open in IMG/M |
| 3300010376|Ga0126381_100393306 | All Organisms → cellular organisms → Bacteria | 1929 | Open in IMG/M |
| 3300010376|Ga0126381_104203894 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 558 | Open in IMG/M |
| 3300010397|Ga0134124_12319320 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
| 3300010399|Ga0134127_11874286 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 676 | Open in IMG/M |
| 3300010401|Ga0134121_11490764 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 691 | Open in IMG/M |
| 3300010876|Ga0126361_10179850 | All Organisms → cellular organisms → Bacteria | 787 | Open in IMG/M |
| 3300011271|Ga0137393_10850959 | All Organisms → cellular organisms → Bacteria | 779 | Open in IMG/M |
| 3300012202|Ga0137363_11472640 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 571 | Open in IMG/M |
| 3300012350|Ga0137372_11028565 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
| 3300012927|Ga0137416_11307863 | Not Available | 655 | Open in IMG/M |
| 3300012972|Ga0134077_10286177 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 689 | Open in IMG/M |
| 3300014160|Ga0181517_10304038 | All Organisms → cellular organisms → Bacteria | 838 | Open in IMG/M |
| 3300014489|Ga0182018_10768096 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300014493|Ga0182016_10320273 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 941 | Open in IMG/M |
| 3300015052|Ga0137411_1375971 | All Organisms → cellular organisms → Bacteria | 2365 | Open in IMG/M |
| 3300015358|Ga0134089_10199701 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 804 | Open in IMG/M |
| 3300017924|Ga0187820_1217650 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 602 | Open in IMG/M |
| 3300017924|Ga0187820_1220526 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 599 | Open in IMG/M |
| 3300017933|Ga0187801_10517982 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300017943|Ga0187819_10756516 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300017955|Ga0187817_10890902 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
| 3300017995|Ga0187816_10332622 | All Organisms → cellular organisms → Bacteria | 669 | Open in IMG/M |
| 3300018085|Ga0187772_10117653 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1729 | Open in IMG/M |
| 3300019787|Ga0182031_1161345 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 801 | Open in IMG/M |
| 3300019887|Ga0193729_1036668 | All Organisms → cellular organisms → Bacteria | 2045 | Open in IMG/M |
| 3300020580|Ga0210403_10405181 | All Organisms → cellular organisms → Bacteria | 1113 | Open in IMG/M |
| 3300020583|Ga0210401_11487153 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300021088|Ga0210404_10556932 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 650 | Open in IMG/M |
| 3300021088|Ga0210404_10693978 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 580 | Open in IMG/M |
| 3300021171|Ga0210405_11076205 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
| 3300021178|Ga0210408_11521828 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300021401|Ga0210393_10292308 | All Organisms → cellular organisms → Bacteria | 1323 | Open in IMG/M |
| 3300021405|Ga0210387_11226589 | All Organisms → cellular organisms → Bacteria | 650 | Open in IMG/M |
| 3300021405|Ga0210387_11387389 | Not Available | 605 | Open in IMG/M |
| 3300021407|Ga0210383_10816793 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 797 | Open in IMG/M |
| 3300021420|Ga0210394_11262262 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
| 3300021420|Ga0210394_11672369 | Not Available | 534 | Open in IMG/M |
| 3300021432|Ga0210384_11416190 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
| 3300021432|Ga0210384_11790264 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300021559|Ga0210409_10836998 | All Organisms → cellular organisms → Bacteria | 793 | Open in IMG/M |
| 3300021559|Ga0210409_11228037 | All Organisms → cellular organisms → Bacteria | 625 | Open in IMG/M |
| 3300021560|Ga0126371_13247398 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 550 | Open in IMG/M |
| 3300022714|Ga0242671_1008041 | All Organisms → cellular organisms → Bacteria | 1216 | Open in IMG/M |
| 3300024330|Ga0137417_1049890 | All Organisms → cellular organisms → Bacteria | 753 | Open in IMG/M |
| 3300025906|Ga0207699_10743897 | Not Available | 719 | Open in IMG/M |
| 3300025915|Ga0207693_11315787 | Not Available | 540 | Open in IMG/M |
| 3300025935|Ga0207709_11194985 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 626 | Open in IMG/M |
| 3300025939|Ga0207665_10336267 | All Organisms → cellular organisms → Bacteria | 1137 | Open in IMG/M |
| 3300026481|Ga0257155_1049432 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
| 3300026547|Ga0209156_10238216 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 851 | Open in IMG/M |
| 3300026551|Ga0209648_10799872 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 515 | Open in IMG/M |
| 3300026557|Ga0179587_10190665 | All Organisms → cellular organisms → Bacteria | 1295 | Open in IMG/M |
| 3300027528|Ga0208985_1107915 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 533 | Open in IMG/M |
| 3300027548|Ga0209523_1073064 | All Organisms → cellular organisms → Bacteria | 707 | Open in IMG/M |
| 3300027575|Ga0209525_1087801 | All Organisms → cellular organisms → Bacteria | 741 | Open in IMG/M |
| 3300027583|Ga0209527_1043311 | All Organisms → cellular organisms → Bacteria | 1013 | Open in IMG/M |
| 3300027648|Ga0209420_1158134 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
| 3300027842|Ga0209580_10071256 | All Organisms → cellular organisms → Bacteria | 1650 | Open in IMG/M |
| 3300028536|Ga0137415_11411315 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 518 | Open in IMG/M |
| 3300028651|Ga0302171_10083163 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 769 | Open in IMG/M |
| 3300028766|Ga0302269_1101486 | All Organisms → cellular organisms → Bacteria | 847 | Open in IMG/M |
| 3300028798|Ga0302222_10170404 | All Organisms → cellular organisms → Bacteria | 855 | Open in IMG/M |
| 3300028909|Ga0302200_10239331 | All Organisms → cellular organisms → Bacteria | 892 | Open in IMG/M |
| 3300029636|Ga0222749_10497714 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 659 | Open in IMG/M |
| 3300029636|Ga0222749_10556492 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
| 3300029944|Ga0311352_10954056 | All Organisms → cellular organisms → Bacteria | 662 | Open in IMG/M |
| 3300029951|Ga0311371_11507707 | All Organisms → cellular organisms → Bacteria | 748 | Open in IMG/M |
| 3300030043|Ga0302306_10253939 | All Organisms → cellular organisms → Bacteria | 675 | Open in IMG/M |
| 3300030057|Ga0302176_10311632 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 633 | Open in IMG/M |
| 3300030114|Ga0311333_10028642 | Not Available | 3873 | Open in IMG/M |
| 3300030399|Ga0311353_11302835 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
| 3300030707|Ga0310038_10219826 | Not Available | 896 | Open in IMG/M |
| 3300030813|Ga0265750_1023540 | All Organisms → cellular organisms → Bacteria | 806 | Open in IMG/M |
| 3300031128|Ga0170823_12185406 | All Organisms → cellular organisms → Bacteria | 722 | Open in IMG/M |
| 3300031446|Ga0170820_13385323 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300031708|Ga0310686_115126087 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
| 3300031720|Ga0307469_10688902 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 925 | Open in IMG/M |
| 3300031720|Ga0307469_10902984 | All Organisms → cellular organisms → Bacteria | 818 | Open in IMG/M |
| 3300031740|Ga0307468_101431033 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 637 | Open in IMG/M |
| 3300031954|Ga0306926_10979470 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae → Levilinea → Levilinea saccharolytica | 1008 | Open in IMG/M |
| 3300032160|Ga0311301_10042560 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 10868 | Open in IMG/M |
| 3300032180|Ga0307471_102900239 | Not Available | 609 | Open in IMG/M |
| 3300032770|Ga0335085_12460033 | Not Available | 517 | Open in IMG/M |
| 3300032782|Ga0335082_11126305 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 651 | Open in IMG/M |
| 3300032805|Ga0335078_10029875 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 8100 | Open in IMG/M |
| 3300032828|Ga0335080_10763832 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae | 1002 | Open in IMG/M |
| 3300032828|Ga0335080_11244695 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 746 | Open in IMG/M |
| 3300032893|Ga0335069_10115074 | All Organisms → cellular organisms → Bacteria | 3377 | Open in IMG/M |
| 3300033134|Ga0335073_10328108 | All Organisms → cellular organisms → Bacteria | 1823 | Open in IMG/M |
| 3300033158|Ga0335077_11947179 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300033475|Ga0310811_10388510 | All Organisms → cellular organisms → Bacteria | 1537 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 14.81% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 7.41% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 5.93% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 4.44% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.44% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.44% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.44% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 4.44% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.70% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.70% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.22% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.22% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.22% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.22% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.96% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.96% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.96% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.96% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 1.48% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.48% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 1.48% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 1.48% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 1.48% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.48% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.74% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.74% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.74% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.74% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.74% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.74% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.74% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.74% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.74% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.74% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.74% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.74% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.74% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
| 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300005874 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_404 | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300005993 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 | Environmental | Open in IMG/M |
| 3300005994 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049 | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009525 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG | Environmental | Open in IMG/M |
| 3300009633 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_10 | Environmental | Open in IMG/M |
| 3300009683 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG | Environmental | Open in IMG/M |
| 3300009759 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_10 | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300010876 | Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300014160 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_30_metaG | Environmental | Open in IMG/M |
| 3300014489 | Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG | Environmental | Open in IMG/M |
| 3300014493 | Permafrost microbial communities from Stordalen Mire, Sweden - 712S2M metaG | Environmental | Open in IMG/M |
| 3300015052 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300017924 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5 | Environmental | Open in IMG/M |
| 3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300019787 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300019887 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2 | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022714 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026481 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-19-A | Environmental | Open in IMG/M |
| 3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027528 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027548 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027575 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027583 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027648 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028651 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_N2_2 | Environmental | Open in IMG/M |
| 3300028766 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_E2_2 | Environmental | Open in IMG/M |
| 3300028798 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_2 | Environmental | Open in IMG/M |
| 3300028909 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N3_1 | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300029944 | II_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300029951 | III_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300030043 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_1 | Environmental | Open in IMG/M |
| 3300030057 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_1 | Environmental | Open in IMG/M |
| 3300030114 | I_Fen_E2 coassembly | Environmental | Open in IMG/M |
| 3300030399 | II_Palsa_E2 coassembly | Environmental | Open in IMG/M |
| 3300030707 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2) | Environmental | Open in IMG/M |
| 3300030813 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSE1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12635J15846_105981222 | 3300001593 | Forest Soil | ENYDHQGTAWGRYLICPGCGKRHDPKNRLLQMGFHAEGYWKVDEC* |
| Ga0062387_1001630892 | 3300004091 | Bog Forest Soil | VFAVSEDHDSKGTGWSRYLECPRCGKRHDPKNRLLQLGYQADGGYWKVERC* |
| Ga0062389_1009563772 | 3300004092 | Bog Forest Soil | YDQQGTSYSRYLKCPQCGKRHDPKNRLLQLGYETERFWTVKDC* |
| Ga0062389_1044583031 | 3300004092 | Bog Forest Soil | GTAWSRYLKCPSCGKRHDPKNRLLQLGYQRAGYWKVDEC* |
| Ga0062388_1029442241 | 3300004635 | Bog Forest Soil | GTACSRYLKCPRCGKRHDPKNRLLQLGYHRQGSWGEGYWKVDEC* |
| Ga0066679_110681371 | 3300005176 | Soil | GTNWSRYLICPGCSKRHDPKNRLLQMGYHREGYWKVDEC* |
| Ga0066687_104248912 | 3300005454 | Soil | LQLWDDLCCAENYDQQGTAWSRYLLCPECRKRHDPKNRLLQMGFQVEGYWKVDGC* |
| Ga0070681_103952181 | 3300005458 | Corn Rhizosphere | VAENYDRQGTAWSRYMICPGCGKRHDPKTRLLQMGFHTEGYWSVDEC* |
| Ga0070733_109458601 | 3300005541 | Surface Soil | AWSRYLVCPKCGKRHDPKNRLLELGYHRERYWKVDAC* |
| Ga0070732_100189881 | 3300005542 | Surface Soil | NWNRYLICPGCGKRHDPKNRLLQMGYHREGYWKVDKC* |
| Ga0066705_101981784 | 3300005569 | Soil | TVSNDYDHQGTAWNRYLTCPNCGKRHDPKNRLLQVGFHCEGYWKVDEC* |
| Ga0070762_112519622 | 3300005602 | Soil | NYDHQGTAWSRYLICPACGKRHDPKNRLLQMGFHPEGYWKVDDC* |
| Ga0070763_107298332 | 3300005610 | Soil | QGTAWRRYLVCPGCGKRHDPKNRLLQMGFHSEGYWKVDEC* |
| Ga0068856_1016023831 | 3300005614 | Corn Rhizosphere | NYDRQGTAWSRYLKCPKCGKRHDPKNRLLQIGYYREGYWKVDEV* |
| Ga0070764_105184352 | 3300005712 | Soil | RQGTAWSRYLICPNCGKRHDPKNRLLQMGYHREGYWKVDEC* |
| Ga0075288_10757791 | 3300005874 | Rice Paddy Soil | QGTAWSRYMVCPGCGKRHDPKNRLLQMGFHPEGYWKVDEC* |
| Ga0070766_103862603 | 3300005921 | Soil | ENYDRQGTAWSRYLICPSCGKRHDPKNRLLQVGYHREGFWQVDGC* |
| Ga0080027_101328201 | 3300005993 | Prmafrost Soil | VPENYDRQGTAWRCYLKCPSCGKRHDPKNRLLQLGYRRAGYLKLDQC* |
| Ga0066789_104312781 | 3300005994 | Soil | GRYLVCPGCGKRHDPKNRLLQMEFHAEGYWKVDECQLVRI* |
| Ga0075028_1005465382 | 3300006050 | Watersheds | FAVSENYDRQGTAWSRYLTCPKCGKRHDPKNRLLQVSFQRDGYWKVDEC* |
| Ga0075028_1009872081 | 3300006050 | Watersheds | TAWSRYLVCPGCAKRHDPKNRLLQVGYHPEGYWQVDDC* |
| Ga0075017_1005373641 | 3300006059 | Watersheds | AWSRYLKCPSCGKRHDPKNRLLQLGYQRAGYWKVDEC* |
| Ga0075030_1014896162 | 3300006162 | Watersheds | VSEQYDRQGTQWSRYLSCPNCGKRHDPKNRLLQLGYRREGYWGVDDC* |
| Ga0070715_104232221 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | EFDRKGTSWSRYLICPQCGKRHDPKNRLLELGYQADGYWKVEKC* |
| Ga0070716_1002579201 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | QLSRYLICPGCGKRHDPRNRLLHLGYHREGYWKVDGC* |
| Ga0070716_1007546512 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | SENYDRQGTAWSSYLKCPNCGKRHDPKNRLLQLGYDRRGYWKVDDC* |
| Ga0068871_1015311701 | 3300006358 | Miscanthus Rhizosphere | TAWSRYLICPGCSKRHDPKNRLLQMGFQSEGYWKVDEC* |
| Ga0066665_117033192 | 3300006796 | Soil | FAVAEEFDRKGSTWSRYRTCPQCGKRHDPKNRLLELGYQEDGYWKVEKC* |
| Ga0079221_112099282 | 3300006804 | Agricultural Soil | AVSEQYDRKGTSLSRYLTCPQCGKRHDPKNRLLELGYQREKFWQVEKC* |
| Ga0079220_109666702 | 3300006806 | Agricultural Soil | SRYLKCPHCGKRHDPKNRLLQLGYDRDGYWKVDKC* |
| Ga0099793_103105412 | 3300007258 | Vadose Zone Soil | AVSENYDRRGTAWSRYLKCPRCEKRHDPKNRLLQIGYQREGYWKVDC* |
| Ga0099827_111172802 | 3300009090 | Vadose Zone Soil | GTNWSRYLICPGCSKRHDPKNRLLQMGYHREGYWKVDER* |
| Ga0105240_109869101 | 3300009093 | Corn Rhizosphere | ENYDRQGTAWSRYMLCPGCGKRHDPQNRLLQMGFHTEGYWSVDDC* |
| Ga0105245_130785241 | 3300009098 | Miscanthus Rhizosphere | SRYLKCPNCEKRHDPKNRLLQIGYQREGYWKVDDC* |
| Ga0116220_102194321 | 3300009525 | Peatlands Soil | NYDRQGTAWGRYLKCPNCGKRHDPKNRLLQLGFQRDGYWKVDGC* |
| Ga0116129_12145101 | 3300009633 | Peatland | TENYDHRGTAWSRYMICPGCGKRHDPKNRLLQVGYHREGYWQVDKC* |
| Ga0116224_101735323 | 3300009683 | Peatlands Soil | EDYDHQGTAWSRYLKCPNCEKRHDPKNRLLQIGYHREGYCKVDGC* |
| Ga0116101_10911222 | 3300009759 | Peatland | VAENYDRQGTEWGRFLPCPSCGKRHDPKNRLLQMGYQRDGFWKVDEC* |
| Ga0126374_102984203 | 3300009792 | Tropical Forest Soil | WSRYMICPACGKRHDPKNRLLQMGFHPEGYWKVDEC* |
| Ga0126373_121928082 | 3300010048 | Tropical Forest Soil | GARWSRYLVCPGCGKRHDPKNRLLQIGFHPEGYWKVDDC* |
| Ga0134082_102041173 | 3300010303 | Grasslands Soil | DRQGTSWSRYLECPKCGKRHDPKNRLLQLGYDGAGYWKVDEC* |
| Ga0126370_109800001 | 3300010358 | Tropical Forest Soil | WSRFSACPHCGKRHDPKNRFLELGFQREGYWKVEKC* |
| Ga0126381_1003933061 | 3300010376 | Tropical Forest Soil | DRHGTNWSRYLACPNCGKRHDPKNRLLELGYQPDGYWKVDRC* |
| Ga0126381_1042038941 | 3300010376 | Tropical Forest Soil | NYDRQGTAWSRYLICPGCGKRHDPKNRLLQMGFHSEGYWKVDEC* |
| Ga0134124_123193201 | 3300010397 | Terrestrial Soil | RYLKCPKCGKRHDPKNRLLQIGYHREGYWKVDDC* |
| Ga0134127_118742862 | 3300010399 | Terrestrial Soil | APDYDRLGTSWSRYLICPNCGKRHDPKNRLLELGYQSDGYWKVDKC* |
| Ga0134121_114907641 | 3300010401 | Terrestrial Soil | GTAWSRYLKCPNCEKRHDPKNRLLQIGYQREGYWKVDDC* |
| Ga0126361_101798501 | 3300010876 | Boreal Forest Soil | ENYDHQGTAWGRYLVCPGCGKRHDPKNRLLQMGFHAEGYWKVDEC* |
| Ga0137393_108509591 | 3300011271 | Vadose Zone Soil | ENYDRQGTAWSRYLICSNCGKRHDPKNRLLRVGFHREGYWKVDDC* |
| Ga0137363_114726401 | 3300012202 | Vadose Zone Soil | VSKDYDHQGTAWNRYLICPKCGKRHDPKNRLLQVGFHREGYWKVDEC* |
| Ga0137372_110285652 | 3300012350 | Vadose Zone Soil | GYVVCPGCGEGRDPKNRLLQMGLHAEGYWKVDEC* |
| Ga0137416_113078631 | 3300012927 | Vadose Zone Soil | DHQGTAWNRYLICPKCGKRHDPKNRLLQVGFHREGYWKVDEC* |
| Ga0134077_102861772 | 3300012972 | Grasslands Soil | TFVVSEDYDRQGTSWSRYLECPKCGKRHDPKNRLLQLGYDGAGYWKVDEC* |
| Ga0181517_103040381 | 3300014160 | Bog | TAWRRYLICPGCGKRHDPKNRLLQMRFHSEGYWKVDEC* |
| Ga0182018_107680961 | 3300014489 | Palsa | GTAWSRYLICPNCGKRHDPKNRLLQMEYHREGYWKVDEC* |
| Ga0182016_103202731 | 3300014493 | Bog | NYDHQGTAWSRYLKCPNCEKRHDPKNRLLQLGYERAGFWKVDAC* |
| Ga0137411_13759716 | 3300015052 | Vadose Zone Soil | TSFAVAENYDRKGTQWSRYLACPNCGKRHDPKNRLLQLGYQKAGYWKVDKC* |
| Ga0134089_101997013 | 3300015358 | Grasslands Soil | VSENYDRQGTSWSRYLECPKCGKRHDPKNRLLQLGYDGAGYWKVDEC* |
| Ga0187820_12176501 | 3300017924 | Freshwater Sediment | YDHQGTAWNRYLICPGCGKRHDPKNRLLQMGFHAEGYWKVDEC |
| Ga0187820_12205262 | 3300017924 | Freshwater Sediment | DHQGTAWSRYLPCPNCGKRHDPKNRLLQMGFHPEGYWKVEEC |
| Ga0187801_105179822 | 3300017933 | Freshwater Sediment | EDYDRKGSQWSRFLVCPTCGKRHDPRNRLLEMGYQREGYWKVDGC |
| Ga0187819_107565161 | 3300017943 | Freshwater Sediment | VAQNYDRQGTAWSRYLICPGCGKRHDPKNRLLQVGYHREGYWQVDGC |
| Ga0187817_108909021 | 3300017955 | Freshwater Sediment | NYDRQGTAWSRYLICPGCGKRHDPKNRLLQLGYHREGYWQVDCC |
| Ga0187816_103326221 | 3300017995 | Freshwater Sediment | QGPAWSRYLVCPGCGKRHDPRNRLLQMGFHPEGYWKVDEC |
| Ga0187772_101176534 | 3300018085 | Tropical Peatland | VAEDYDHQGTAWSRYLVCPGCGKRHDPKNRLLQMGFHPEGYWKVDEC |
| Ga0182031_11613451 | 3300019787 | Bog | QGTAWSRYLKCPNCEKRHDPKNRLLQLGYERAGFWKVDAC |
| Ga0193729_10366681 | 3300019887 | Soil | VSENYDRQGTAWSRYLKCPNCDKRHDPKNRLLQIGYEREGYWKVDDC |
| Ga0210403_104051811 | 3300020580 | Soil | AENYDRQGTAWGRYLPCPTCGKRHDPKNRLLQMGYQRDGFWKVDEC |
| Ga0210401_114871532 | 3300020583 | Soil | DRQGTAWSPYLKCPKCGKRHDPKNRLLQLGFQRDGYWKVDGC |
| Ga0210404_105569321 | 3300021088 | Soil | SFAVSDHYDRHGTPWSRYLLCPNCGKRHDPKNRLLQLGYRREGYWGVDGC |
| Ga0210404_106939781 | 3300021088 | Soil | VSEKYDRQGTPWSRFLVCPNCDKRHDPKNRLLQLGYHREGYWGVDEC |
| Ga0210405_110762051 | 3300021171 | Soil | WGRYLICPGCGKRHDPKNRLLQMGFHAEGYWKVDEC |
| Ga0210408_115218281 | 3300021178 | Soil | SRYLKCPNCGKRHDPKNRLLQLGYQRAGYWKVDEC |
| Ga0210393_102923083 | 3300021401 | Soil | WSRYLTCPGCGKKHDPKNRLLQMGFHAEGYWKVDEC |
| Ga0210387_112265891 | 3300021405 | Soil | QGTAWSRYLICPNCAKRHDPKNRLLQVGYHREGFWQVDGC |
| Ga0210387_113873892 | 3300021405 | Soil | GTAWSRYLICPGCGKHHDPKNRLLQMGFHSEGYWKVDEC |
| Ga0210383_108167931 | 3300021407 | Soil | ENYDRQGTAWGRYLKCPECGKRHDPKNRILQLGFQRDGYWKVDEC |
| Ga0210394_112622621 | 3300021420 | Soil | WSRYLTCPKCGKRHDPKNRLLQLGYQEEGYWKVEKC |
| Ga0210394_116723692 | 3300021420 | Soil | TAWSRYLPCPGCGKRHDPKNRLLQMGFHAEGYWQVDEC |
| Ga0210384_114161902 | 3300021432 | Soil | SRYLICPGCGKRHDPKNRLLQMGFHPEGYWKVDEC |
| Ga0210384_117902642 | 3300021432 | Soil | QGTAWGRYLVCPGCRKRHDPKNRLLQIGFHAEGYWKVDEC |
| Ga0210409_108369981 | 3300021559 | Soil | YDHQGTAWGRYLICPGCGKRHDPKNRLLQMGFHAEGYWKVDEC |
| Ga0210409_112280371 | 3300021559 | Soil | GTAWGRYLVCPGCSKRHDPKNRLLQMGFHAEGYWKVDEC |
| Ga0126371_132473981 | 3300021560 | Tropical Forest Soil | QGTAWSRYLICPGCEKRHDPKNRLLQMGFHSEGYWKVDEC |
| Ga0242671_10080414 | 3300022714 | Soil | VTEDHDSKGSGWNQYLKCPKCRKRHDPKNRLLQLNYQDEGYWKVEQC |
| Ga0137417_10498902 | 3300024330 | Vadose Zone Soil | QYDRHGTPWSRYLLCPNCGQRHDPKNRLLQLGYRREGYWGVDGC |
| Ga0207699_107438971 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | DRQGTAWSRYMLCPGCGKRHDPKNRLLQMGFHTEGYWAVDDC |
| Ga0207693_113157872 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | TSFAVSEKYDRHGSQWSRFLVCPGCGKRHDPRNRLLQLEYRQAGFWGVEDC |
| Ga0207709_111949851 | 3300025935 | Miscanthus Rhizosphere | AVSENYDRQGTPWSRYLKCPNCGKPHDPKNRLLQLGYQHGGYWTVDEC |
| Ga0207665_103362671 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | RWSRYLICPGCGKRHDPKNRLLQMGFHPEGYWKVDEC |
| Ga0257155_10494321 | 3300026481 | Soil | GTAWGRYLICPGCGKRHDPKNRLLQMGFHAEGYWKVDEC |
| Ga0209156_102382161 | 3300026547 | Soil | ENYDRQGTSWSRYLECPKCGKRHDPKNRLLQLGYDGAGYWKVDEC |
| Ga0209648_107998721 | 3300026551 | Grasslands Soil | NRYLICPKCDKRHDPKNRLLQVGFHREGYWNVDEC |
| Ga0179587_101906651 | 3300026557 | Vadose Zone Soil | SENYDRQGTACSRYLQFPNCEKRHDPKNRLLQIGYQREGYWKVDDC |
| Ga0208985_11079152 | 3300027528 | Forest Soil | VAENYDRQGASWSRYLPCPGCGKRHDPKNRVLKMGFHPEGYWKVDEC |
| Ga0209523_10730642 | 3300027548 | Forest Soil | FVVSENYDRQGTAWSRYLKCPNCGKRHDPKNRLLRLGYDRRGYWNVDDC |
| Ga0209525_10878012 | 3300027575 | Forest Soil | RRGTAWSRYLICPVRAKRHDPKNRLLQVGYQREGFWQVNKC |
| Ga0209527_10433111 | 3300027583 | Forest Soil | NYDHQGTAWGRYLICPGCGKRHDPKNRLLQMGFHAEGYWKVDEC |
| Ga0209420_11581342 | 3300027648 | Forest Soil | VAENYDHQGTAWSRYLICPNCGKRHDPKNRLLQIGYHREGYWKVDGC |
| Ga0209580_100712561 | 3300027842 | Surface Soil | TNWNRYLICPGCGKRHDPKNRLLQMGYHREGYWKVDKC |
| Ga0137415_114113152 | 3300028536 | Vadose Zone Soil | GWSRYLVCPSCGKRHDPKNRLLELGYHTDGYWKVDKC |
| Ga0302171_100831632 | 3300028651 | Fen | RHGTAWSRYLECPQCGKRHDPKNRLLQLGYQPEGYWKVDKC |
| Ga0302269_11014861 | 3300028766 | Bog | ENYDHQGTAWSRYLICPGCGKRHDPKNRLLQVGYHREGYWKVDGC |
| Ga0302222_101704041 | 3300028798 | Palsa | AENYDRQGTAWSRYLVCPGCGKRHDPKNRLLQIGFHPQGYWKVDDC |
| Ga0302200_102393311 | 3300028909 | Bog | AVAKNYDHQGTAWSRYLICPNCSKRHDPKNRLLQIGYHREGYRKVDGC |
| Ga0222749_104977141 | 3300029636 | Soil | RYLRVPECGKRHDPKNRILQLGFQRDGYWKVDECLKLLTASS |
| Ga0222749_105564922 | 3300029636 | Soil | DRQGTQWSRYLTCPHCGKRHDPKNRLLQLGYRREGYWRVEDC |
| Ga0311352_109540561 | 3300029944 | Palsa | GTAWSRYLICPNCGKRHDPKNRLLQMGYHREGYWKVDEC |
| Ga0311371_115077072 | 3300029951 | Palsa | ENYDRQGTAWSRYLVCPGCGKRHDPKNRLLQIGFHPQGYWKVDDC |
| Ga0302306_102539392 | 3300030043 | Palsa | LGTAWSRYMVCPKCGKRHDPKNRLLEIGYHSEGFWKVDGC |
| Ga0302176_103116322 | 3300030057 | Palsa | AVAENYDRQGTAWGRYLPCPTCGKRHDPKNRLLQMGYQRDGFWKVDEC |
| Ga0311333_100286427 | 3300030114 | Fen | VGEDYDRHGTAWSRYLECPQCGKRHDPKNRLLQLGYQPEGYWKVDKC |
| Ga0311353_113028351 | 3300030399 | Palsa | RRSTSWSRYLICPGCGKRHDPKNRLLQVGYHREGYWQVDEC |
| Ga0310038_102198262 | 3300030707 | Peatlands Soil | DRQGTAWGRYLKCPNCGKRHDPKNRLLQLGFQRDGYWKVDGC |
| Ga0265750_10235402 | 3300030813 | Soil | DHQGTAWGRYLPCPGCGKRHDPKSRLLQMGFHAEGYWKVDEC |
| Ga0170823_121854061 | 3300031128 | Forest Soil | ENYDHQGTAWGRYLICPGCGKRHDPKNRLLQMGFHAEGYWKVDEC |
| Ga0170820_133853231 | 3300031446 | Forest Soil | PDRKNSTSTWSRYLKCPGCGKRHDPKNRLLELGYHREGYGRGGFWEVDAC |
| Ga0170820_143505411 | 3300031446 | Forest Soil | GTTFAVAENYDRQGTAWGRYLKCPNCEKRHDPKNRLLQLGYQRAGYWKVDEC |
| Ga0310686_1151260871 | 3300031708 | Soil | QGTAWGRYLPCPTCGKRHDPKNRLLQMGYQRDGFWKVDEC |
| Ga0307469_101385045 | 3300031720 | Hardwood Forest Soil | GTSFAVSEQYDRLGTQWSRFLVCPSCGKRHDPKNRLLQLGYHREGYWGVDDC |
| Ga0307469_106889023 | 3300031720 | Hardwood Forest Soil | GDYDHKGTNWSRYLTCPGCGKRHDPKNRLLELHYDPNGYWKVAKC |
| Ga0307469_109029843 | 3300031720 | Hardwood Forest Soil | ENYDRQGAAWTRYLKCPNCGKRHDPKNRLLQLGYDRRGYWQVDEC |
| Ga0307468_1014310332 | 3300031740 | Hardwood Forest Soil | RQGTAWSRYLTCPGCGKRHDPKNRLLQMAFHPEGYWKVDDC |
| Ga0306926_109794701 | 3300031954 | Soil | AVSEKYDRNGTQWSRFLVCPNCGKRHDPKNRLLQLGYHRQGYWGVENC |
| Ga0311301_100425601 | 3300032160 | Peatlands Soil | TENYDRQGTAWSRYLICPGCGKRHDPKNRLLQVGYHPEGFWQVDAC |
| Ga0307471_1029002392 | 3300032180 | Hardwood Forest Soil | TAWSRYLICPACGKRHDPKNRLLQMGYHREGYWKVDEC |
| Ga0335085_124600331 | 3300032770 | Soil | AENYDRQGTAWSRYLKCPKCGKRHDPKNRLLQVGYHREGYWKVDEC |
| Ga0335082_111263053 | 3300032782 | Soil | NYDRHGTAWSRYLKCPNCGKRHDPKNRLLQHGYQREGYWKVDGC |
| Ga0335078_100298751 | 3300032805 | Soil | EDFDRCGTNWSRYLICPNCGKRHDPKNRLLQVGYQREGYWKVDDC |
| Ga0335080_107638321 | 3300032828 | Soil | AENYDRQGTAWSRYLQCPKCGKRHDPKNRLLQVGYHREGYWKVDEV |
| Ga0335080_112446951 | 3300032828 | Soil | SRYLVCPGCGKCHDPKNRLLQMGFHPEGYWKVDEC |
| Ga0335069_101150741 | 3300032893 | Soil | GSAYRRFLVCPACGKRHDPRNRLLHLGFQRDGYWKVDGC |
| Ga0335073_103281083 | 3300033134 | Soil | VAENYDRQGTAWSRYLKCPSCGKRHDPKNRLLRVGYERTGYWHVDEC |
| Ga0335077_119471792 | 3300033158 | Soil | NYDRQGTAWSRYLKCPKCGKRHDPKNRLLQVGYHREGYWKVDEC |
| Ga0310811_103885104 | 3300033475 | Soil | HKGTNWSRYLICPGCGKRHDPKNRLLELHYDPDGYWKVAKC |
| ⦗Top⦘ |