


| Basic Information | |
|---|---|
| Family ID | F058424 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 135 |
| Average Sequence Length | 44 residues |
| Representative Sequence | PNLRLSEGLIDLMKDFSLSSAQGIGGAWLRPSTPFDERYGQW |
| Number of Associated Samples | 98 |
| Number of Associated Scaffolds | 135 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.75 % |
| % of genes near scaffold ends (potentially truncated) | 97.04 % |
| % of genes from short scaffolds (< 2000 bps) | 94.81 % |
| Associated GOLD sequencing projects | 92 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.27 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (73.333 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (33.333 % of family members) |
| Environment Ontology (ENVO) | Unclassified (48.889 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (47.407 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 41.43% β-sheet: 0.00% Coil/Unstructured: 58.57% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.27 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 135 Family Scaffolds |
|---|---|---|
| PF03401 | TctC | 11.11 |
| PF04392 | ABC_sub_bind | 5.19 |
| PF13924 | Lipocalin_5 | 3.70 |
| PF04226 | Transgly_assoc | 2.22 |
| PF01042 | Ribonuc_L-PSP | 1.48 |
| PF00528 | BPD_transp_1 | 1.48 |
| PF14026 | DUF4242 | 1.48 |
| PF01663 | Phosphodiest | 1.48 |
| PF05598 | DUF772 | 0.74 |
| PF13545 | HTH_Crp_2 | 0.74 |
| PF00027 | cNMP_binding | 0.74 |
| PF07485 | DUF1529 | 0.74 |
| PF00248 | Aldo_ket_red | 0.74 |
| PF07995 | GSDH | 0.74 |
| PF13358 | DDE_3 | 0.74 |
| PF02518 | HATPase_c | 0.74 |
| PF13417 | GST_N_3 | 0.74 |
| PF03928 | HbpS-like | 0.74 |
| PF11684 | DUF3280 | 0.74 |
| PF01855 | POR_N | 0.74 |
| PF09926 | DUF2158 | 0.74 |
| COG ID | Name | Functional Category | % Frequency in 135 Family Scaffolds |
|---|---|---|---|
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 11.11 |
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 5.19 |
| COG2261 | Uncharacterized membrane protein YeaQ/YmgE, transglycosylase-associated protein family | General function prediction only [R] | 2.22 |
| COG0251 | Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 family | Defense mechanisms [V] | 1.48 |
| COG0674 | Pyruvate:ferredoxin oxidoreductase or related 2-oxoacid:ferredoxin oxidoreductase, alpha subunit | Energy production and conversion [C] | 0.74 |
| COG2133 | Glucose/arabinose dehydrogenase, beta-propeller fold | Carbohydrate transport and metabolism [G] | 0.74 |
| COG4231 | TPP-dependent indolepyruvate ferredoxin oxidoreductase, alpha subunit | Energy production and conversion [C] | 0.74 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 73.33 % |
| Unclassified | root | N/A | 26.67 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300004633|Ga0066395_10259119 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 936 | Open in IMG/M |
| 3300004633|Ga0066395_10265432 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 926 | Open in IMG/M |
| 3300005332|Ga0066388_101930517 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1055 | Open in IMG/M |
| 3300005363|Ga0008090_10173441 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 669 | Open in IMG/M |
| 3300005363|Ga0008090_15873791 | Not Available | 1079 | Open in IMG/M |
| 3300005434|Ga0070709_10969294 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 675 | Open in IMG/M |
| 3300005437|Ga0070710_10085179 | All Organisms → cellular organisms → Bacteria | 1853 | Open in IMG/M |
| 3300005598|Ga0066706_10624466 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 855 | Open in IMG/M |
| 3300005713|Ga0066905_101094334 | Not Available | 707 | Open in IMG/M |
| 3300005764|Ga0066903_102208768 | Not Available | 1061 | Open in IMG/M |
| 3300005764|Ga0066903_102422243 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1015 | Open in IMG/M |
| 3300005764|Ga0066903_104057819 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 785 | Open in IMG/M |
| 3300005764|Ga0066903_104537343 | All Organisms → cellular organisms → Bacteria | 740 | Open in IMG/M |
| 3300005764|Ga0066903_105933745 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 640 | Open in IMG/M |
| 3300005764|Ga0066903_106434660 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 612 | Open in IMG/M |
| 3300005764|Ga0066903_106651370 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Caballeronia → Caballeronia telluris | 601 | Open in IMG/M |
| 3300005764|Ga0066903_107822583 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 549 | Open in IMG/M |
| 3300005764|Ga0066903_109092285 | Not Available | 502 | Open in IMG/M |
| 3300006172|Ga0075018_10074079 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1465 | Open in IMG/M |
| 3300006176|Ga0070765_101355524 | All Organisms → cellular organisms → Bacteria | 671 | Open in IMG/M |
| 3300006603|Ga0074064_10003758 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 893 | Open in IMG/M |
| 3300006800|Ga0066660_11181769 | Not Available | 601 | Open in IMG/M |
| 3300006844|Ga0075428_101181905 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 807 | Open in IMG/M |
| 3300006871|Ga0075434_101165939 | Not Available | 783 | Open in IMG/M |
| 3300007788|Ga0099795_10660633 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 500 | Open in IMG/M |
| 3300009012|Ga0066710_103412067 | Not Available | 603 | Open in IMG/M |
| 3300009038|Ga0099829_11430097 | Not Available | 571 | Open in IMG/M |
| 3300009143|Ga0099792_11095806 | Not Available | 536 | Open in IMG/M |
| 3300009162|Ga0075423_10855270 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 963 | Open in IMG/M |
| 3300009162|Ga0075423_12783885 | Not Available | 536 | Open in IMG/M |
| 3300009792|Ga0126374_10872398 | All Organisms → cellular organisms → Bacteria | 695 | Open in IMG/M |
| 3300010043|Ga0126380_10516213 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 921 | Open in IMG/M |
| 3300010043|Ga0126380_10628478 | All Organisms → cellular organisms → Bacteria | 851 | Open in IMG/M |
| 3300010048|Ga0126373_12912475 | Not Available | 534 | Open in IMG/M |
| 3300010321|Ga0134067_10339011 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
| 3300010358|Ga0126370_11766462 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 597 | Open in IMG/M |
| 3300010360|Ga0126372_10937779 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 872 | Open in IMG/M |
| 3300010361|Ga0126378_10082124 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 3125 | Open in IMG/M |
| 3300010361|Ga0126378_12312836 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 613 | Open in IMG/M |
| 3300010361|Ga0126378_12484901 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 592 | Open in IMG/M |
| 3300010366|Ga0126379_11556999 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 766 | Open in IMG/M |
| 3300010366|Ga0126379_12838484 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
| 3300010376|Ga0126381_101832953 | All Organisms → cellular organisms → Bacteria | 875 | Open in IMG/M |
| 3300010398|Ga0126383_10107820 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2506 | Open in IMG/M |
| 3300010398|Ga0126383_10626869 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Candidatus Sulfobium → Candidatus Sulfobium mesophilum | 1149 | Open in IMG/M |
| 3300010398|Ga0126383_12670527 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 582 | Open in IMG/M |
| 3300010863|Ga0124850_1081150 | All Organisms → cellular organisms → Bacteria | 964 | Open in IMG/M |
| 3300011269|Ga0137392_10191779 | All Organisms → cellular organisms → Bacteria | 1668 | Open in IMG/M |
| 3300012096|Ga0137389_10356961 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1244 | Open in IMG/M |
| 3300012189|Ga0137388_11527128 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 605 | Open in IMG/M |
| 3300012200|Ga0137382_10160757 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1528 | Open in IMG/M |
| 3300012202|Ga0137363_10552987 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 969 | Open in IMG/M |
| 3300012207|Ga0137381_10556532 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1000 | Open in IMG/M |
| 3300012208|Ga0137376_10928363 | Not Available | 747 | Open in IMG/M |
| 3300012208|Ga0137376_11315275 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 613 | Open in IMG/M |
| 3300012209|Ga0137379_11058385 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Rhizobiales bacterium GAS113 | 717 | Open in IMG/M |
| 3300012355|Ga0137369_10182849 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1637 | Open in IMG/M |
| 3300012359|Ga0137385_11017056 | Not Available | 683 | Open in IMG/M |
| 3300012582|Ga0137358_10587021 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 748 | Open in IMG/M |
| 3300012971|Ga0126369_12509058 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium 13_1_40CM_3_65_7 | 601 | Open in IMG/M |
| 3300016341|Ga0182035_11574395 | Not Available | 592 | Open in IMG/M |
| 3300016357|Ga0182032_10173393 | All Organisms → cellular organisms → Bacteria | 1618 | Open in IMG/M |
| 3300016357|Ga0182032_11541412 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 577 | Open in IMG/M |
| 3300016371|Ga0182034_10260221 | Not Available | 1373 | Open in IMG/M |
| 3300016371|Ga0182034_11524602 | Not Available | 586 | Open in IMG/M |
| 3300016445|Ga0182038_11742700 | Not Available | 562 | Open in IMG/M |
| 3300016445|Ga0182038_12178978 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 503 | Open in IMG/M |
| 3300020579|Ga0210407_11078629 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
| 3300021361|Ga0213872_10450730 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 517 | Open in IMG/M |
| 3300021560|Ga0126371_12947036 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
| 3300021560|Ga0126371_13469974 | Not Available | 532 | Open in IMG/M |
| 3300025898|Ga0207692_10169481 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1264 | Open in IMG/M |
| 3300025916|Ga0207663_10518891 | Not Available | 928 | Open in IMG/M |
| 3300025922|Ga0207646_11052982 | Not Available | 717 | Open in IMG/M |
| 3300025929|Ga0207664_11331675 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 638 | Open in IMG/M |
| 3300027071|Ga0209214_1001270 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2218 | Open in IMG/M |
| 3300031543|Ga0318516_10283281 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 958 | Open in IMG/M |
| 3300031543|Ga0318516_10836067 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300031564|Ga0318573_10288447 | All Organisms → cellular organisms → Bacteria | 878 | Open in IMG/M |
| 3300031668|Ga0318542_10030828 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2307 | Open in IMG/M |
| 3300031668|Ga0318542_10057134 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1790 | Open in IMG/M |
| 3300031679|Ga0318561_10118100 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1407 | Open in IMG/M |
| 3300031680|Ga0318574_10114299 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1509 | Open in IMG/M |
| 3300031680|Ga0318574_10532983 | All Organisms → cellular organisms → Bacteria | 688 | Open in IMG/M |
| 3300031681|Ga0318572_10922905 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 518 | Open in IMG/M |
| 3300031682|Ga0318560_10823132 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 501 | Open in IMG/M |
| 3300031719|Ga0306917_10425577 | All Organisms → cellular organisms → Bacteria | 1038 | Open in IMG/M |
| 3300031719|Ga0306917_10925997 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 681 | Open in IMG/M |
| 3300031724|Ga0318500_10685592 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 522 | Open in IMG/M |
| 3300031744|Ga0306918_10211362 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1466 | Open in IMG/M |
| 3300031744|Ga0306918_10559096 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 896 | Open in IMG/M |
| 3300031744|Ga0306918_10574594 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 883 | Open in IMG/M |
| 3300031744|Ga0306918_11194196 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 587 | Open in IMG/M |
| 3300031747|Ga0318502_10322171 | All Organisms → cellular organisms → Bacteria | 911 | Open in IMG/M |
| 3300031747|Ga0318502_10611846 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 656 | Open in IMG/M |
| 3300031765|Ga0318554_10483079 | Not Available | 701 | Open in IMG/M |
| 3300031771|Ga0318546_11332703 | Not Available | 504 | Open in IMG/M |
| 3300031793|Ga0318548_10374450 | Not Available | 699 | Open in IMG/M |
| 3300031794|Ga0318503_10141119 | Not Available | 775 | Open in IMG/M |
| 3300031795|Ga0318557_10607832 | Not Available | 502 | Open in IMG/M |
| 3300031821|Ga0318567_10058648 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 2007 | Open in IMG/M |
| 3300031821|Ga0318567_10134982 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1357 | Open in IMG/M |
| 3300031835|Ga0318517_10102253 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium | 1259 | Open in IMG/M |
| 3300031846|Ga0318512_10095078 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1394 | Open in IMG/M |
| 3300031859|Ga0318527_10445765 | Not Available | 552 | Open in IMG/M |
| 3300031879|Ga0306919_11491549 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 509 | Open in IMG/M |
| 3300031880|Ga0318544_10015745 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2469 | Open in IMG/M |
| 3300031890|Ga0306925_10462115 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1355 | Open in IMG/M |
| 3300031890|Ga0306925_11716339 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 605 | Open in IMG/M |
| 3300031896|Ga0318551_10468897 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 720 | Open in IMG/M |
| 3300031910|Ga0306923_10967142 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 927 | Open in IMG/M |
| 3300031912|Ga0306921_11606219 | Not Available | 706 | Open in IMG/M |
| 3300031941|Ga0310912_11456830 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 516 | Open in IMG/M |
| 3300031941|Ga0310912_11470074 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 513 | Open in IMG/M |
| 3300031942|Ga0310916_11369671 | Not Available | 580 | Open in IMG/M |
| 3300031946|Ga0310910_10758920 | All Organisms → cellular organisms → Bacteria | 765 | Open in IMG/M |
| 3300031981|Ga0318531_10548798 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 523 | Open in IMG/M |
| 3300032001|Ga0306922_12360664 | Not Available | 509 | Open in IMG/M |
| 3300032010|Ga0318569_10153960 | All Organisms → cellular organisms → Bacteria | 1059 | Open in IMG/M |
| 3300032025|Ga0318507_10332459 | Not Available | 661 | Open in IMG/M |
| 3300032035|Ga0310911_10368178 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 830 | Open in IMG/M |
| 3300032052|Ga0318506_10225299 | Not Available | 829 | Open in IMG/M |
| 3300032054|Ga0318570_10112069 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1199 | Open in IMG/M |
| 3300032059|Ga0318533_11092446 | Not Available | 584 | Open in IMG/M |
| 3300032060|Ga0318505_10481076 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 586 | Open in IMG/M |
| 3300032063|Ga0318504_10182185 | Not Available | 976 | Open in IMG/M |
| 3300032090|Ga0318518_10675324 | Not Available | 526 | Open in IMG/M |
| 3300032094|Ga0318540_10548904 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 557 | Open in IMG/M |
| 3300032261|Ga0306920_103685511 | Not Available | 563 | Open in IMG/M |
| 3300032261|Ga0306920_103819962 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
| 3300033289|Ga0310914_11325353 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 622 | Open in IMG/M |
| 3300033290|Ga0318519_10105029 | All Organisms → cellular organisms → Bacteria | 1526 | Open in IMG/M |
| 3300033290|Ga0318519_10122194 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1427 | Open in IMG/M |
| 3300033290|Ga0318519_11000309 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 519 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 33.33% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 16.30% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 13.33% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 11.11% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 10.37% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.70% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.48% |
| Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 1.48% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.74% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.74% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.74% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.74% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.74% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.74% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.74% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.74% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005363 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006603 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMC (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010863 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (PacBio error correction) | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Host-Associated | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027071 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
| 3300031794 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f23 | Environmental | Open in IMG/M |
| 3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
| 3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
| 3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
| 3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
| 3300031859 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031880 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031981 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
| 3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
| 3300032054 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
| 3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
| 3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
| 3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0066395_102591191 | 3300004633 | Tropical Forest Soil | DGPPPNLRLSEGLIDLMKDFSLSSAQGIGGAWLRPSTPFDERYGQW* |
| Ga0066395_102654321 | 3300004633 | Tropical Forest Soil | SDNLIDLMKDFSLSSAQGIGAAWGIPLRASTPFDERYGQW* |
| Ga0066388_1019305171 | 3300005332 | Tropical Forest Soil | NLRLSEGLIDLMKDFSLSSAQGIGGAWLRPSTPFDERYGQW* |
| Ga0008090_101734411 | 3300005363 | Tropical Rainforest Soil | EMARVKPVDRPPPNLRLSEGLIDLMKDFSLSGAQGIGGAWLRPSTPFDERYGQW* |
| Ga0008090_158737911 | 3300005363 | Tropical Rainforest Soil | RPPPNLRLSEGLIDLMKDFSLSSAQGIGAAWGIPLRASTPFDERYGQW* |
| Ga0070709_109692941 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | PPNLRLSDDWIDLMSGFSLSSAQAIGGAWGTPLPPPTPFDERYGRW* |
| Ga0070710_100851792 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | LSDDVIDLMKAFSLSSAEGIGGAWGTPLRPPTPFDKRFGQ* |
| Ga0066706_106244663 | 3300005598 | Soil | MSPDLRLSENLIDLMKDFSLSSAQGIGGAWRIPPRASTP |
| Ga0066905_1010943341 | 3300005713 | Tropical Forest Soil | LSEGLIDLMKDFSLSSAKGIGGAWLRPSTPFDERYGQW* |
| Ga0066903_1022087681 | 3300005764 | Tropical Forest Soil | DLMTAGFSLSSAQAIGGSWATPVRSPTPFDDRYGQW* |
| Ga0066903_1024222433 | 3300005764 | Tropical Forest Soil | IDLMKDFRLSNVEAIGGAWAIPVRPSTPFDERYGQW* |
| Ga0066903_1040578191 | 3300005764 | Tropical Forest Soil | LRLSDTLIDLMEDFSLSSAQGIGLAWRIPSRASTPFDERYGQW* |
| Ga0066903_1045373433 | 3300005764 | Tropical Forest Soil | DLMKDFSLSSAQAIGRAWGTPLRSSTPFDERYGQW* |
| Ga0066903_1059337452 | 3300005764 | Tropical Forest Soil | KPIDLMKDFRLSSDQAIGGAWGIPLRPSTPFDERYGQW* |
| Ga0066903_1064346603 | 3300005764 | Tropical Forest Soil | DRLPPNLRLSDKSIDLMKDFRLSNVEAIGGAWAIPVRPSTPFDERYGQW* |
| Ga0066903_1066513702 | 3300005764 | Tropical Forest Soil | LIDLMKDFSLSSAQGIGGAWLRPSTPFDERYGQW* |
| Ga0066903_1078225831 | 3300005764 | Tropical Forest Soil | PNLRLSEGLIDLMKDFSLSSAQGIGGAWLRPSTPFDERYGQW* |
| Ga0066903_1090922852 | 3300005764 | Tropical Forest Soil | RVKPVDRPPPNLRLSEGLIDLMKDFSLSSTQGIGGAWLRPSTPFDERYGQW* |
| Ga0075018_100740791 | 3300006172 | Watersheds | VKPVDRTPPNIRLSDELVDLTKDFSLSSAQAIGGAWGIPLRPSTPFDERYGQW* |
| Ga0070765_1013555242 | 3300006176 | Soil | IDLMKDFSLSSAQAIGGAWGIPLRPSTPFDERYGQW* |
| Ga0074064_100037581 | 3300006603 | Soil | PNLRLSDNLIDLMEHFSLSSAQGIGRAWGIPLRASTPFDERYGQW* |
| Ga0066660_111817692 | 3300006800 | Soil | PNLRLSDDRIDLMKDFSLSSGQAIGGAWGIPPRPSTPFDERYGQW* |
| Ga0075428_1011819051 | 3300006844 | Populus Rhizosphere | KPVDQISPGHRLGDNLIDLMKDFSLSSAQGVGGAWRIPPRALTPFDARYGQW* |
| Ga0075434_1011659391 | 3300006871 | Populus Rhizosphere | DRIDLMTASFSLSSAQAIGGAWGIPGGPLTPFDDRYGQW* |
| Ga0099795_106606331 | 3300007788 | Vadose Zone Soil | LSDNLIDLMNDFSLSSAQGIGGAWGIPPRASTPFDARYGQW* |
| Ga0066710_1034120671 | 3300009012 | Grasslands Soil | SDDLIDLMKDFSLSSAQAIGGAWGIPLRPSTPFDERYGQW |
| Ga0099829_114300971 | 3300009038 | Vadose Zone Soil | PPNLRLSDNPIDLMEHFSLSSAQGIGRAWGIPLRASTPFDERYGQW* |
| Ga0099792_110958061 | 3300009143 | Vadose Zone Soil | VDLMKHFSLSSAQGVGSAWGAPLRPPMPFDERYGQW* |
| Ga0075423_108552703 | 3300009162 | Populus Rhizosphere | DLRLSDKPIDLMKDFRLSNAEAIGGAWAIPVRPSTPFDERYGQW* |
| Ga0075423_127838852 | 3300009162 | Populus Rhizosphere | PPNLRLSDNLIDLMEHFSLSSAQGIGRAWGMPLRASTPFDERYGQW* |
| Ga0126374_108723982 | 3300009792 | Tropical Forest Soil | DKPIDLMKDFRLSNAEAIGGAWAIPVRPSTPFDERYGQW* |
| Ga0126380_105162131 | 3300010043 | Tropical Forest Soil | STPANLRLSDDRIDLMSGISLSSNQAIGGVWGIPVRPPTPFDERYGQW* |
| Ga0126380_106284781 | 3300010043 | Tropical Forest Soil | VEGTPLNLRLSDNRIDLMSGISVSSNQAIGGGIPVRPPTPFDERYGQW* |
| Ga0126373_129124751 | 3300010048 | Tropical Forest Soil | LARVKPVDKMPPNLRLGDDLIDLMKDFSLSSAQGIGAAWGIPLRASTPFDERYGQW* |
| Ga0134067_103390111 | 3300010321 | Grasslands Soil | NLIDLMKDFSLSSAQGIGGAWRIPPRASTPFDARYGQW* |
| Ga0126370_117664622 | 3300010358 | Tropical Forest Soil | PPPNLRLSEGLIDLMKDFSLSSAQGIGGAWLRPSTPFDERYGQW* |
| Ga0126372_109377792 | 3300010360 | Tropical Forest Soil | LSDGLIDLMKGFSLSSAQGIGSAWLRPSTPFDERYGQW* |
| Ga0126378_100821247 | 3300010361 | Tropical Forest Soil | DLMKDFRLSNVEAIGGAWAIPVRPSTPFDERYGQW* |
| Ga0126378_123128361 | 3300010361 | Tropical Forest Soil | RIDLMSGFGLSSNQGIGGALGIPVRPPTPFDERYGQW* |
| Ga0126378_124849011 | 3300010361 | Tropical Forest Soil | VKPVDRLPPNLRLSDKPIDLMKDFRLSSDQAIGGAWGIPLRPSTPFD* |
| Ga0126379_115569992 | 3300010366 | Tropical Forest Soil | VKPVDRPPPNLRLSEGLIDLMKDFSLSSAQGIGGPWLRPSTPFDERYGQW* |
| Ga0126379_128384841 | 3300010366 | Tropical Forest Soil | MPPNLRLSDTLIDLMEDFSLSSAQGIGRAWGIPLRASTPFDERYGEW |
| Ga0126381_1018329531 | 3300010376 | Tropical Forest Soil | VKPVDRTPPNLRLSDDRIDLMSGFSLSSAQAVGGAWGIPLRPPTPFDERYGQW* |
| Ga0126383_101078201 | 3300010398 | Tropical Forest Soil | NLRLSDKPIDLMKDFRLSNVEAIGGAWAIPVRPSTPFDERCG* |
| Ga0126383_106268691 | 3300010398 | Tropical Forest Soil | IDLMEDFSLSSAQGIGLAWRIPSRASTPFDERYGQW* |
| Ga0126383_126705272 | 3300010398 | Tropical Forest Soil | EGLIDLMKDFSLSSAQGIGGAWLRPSTPFDERYGQW* |
| Ga0124850_10811501 | 3300010863 | Tropical Forest Soil | LQLSDDLIDLMKDFSLSSAQAIGRAWGPPRPSTTPFDERYGQW* |
| Ga0137392_101917793 | 3300011269 | Vadose Zone Soil | SDDLIDLMKDFSLSSAQAIGGAWGIPLRPSTPFDERYGQW* |
| Ga0137389_103569614 | 3300012096 | Vadose Zone Soil | DRAPPNLRLSNSLIDLMKGFSLSSSQGIGGAWETPPNIATPGSFAERYGRW* |
| Ga0137388_115271282 | 3300012189 | Vadose Zone Soil | RLSDNLIDLMEHFSLSSAQGIGRAWGIPLRASTPFDERYGQW* |
| Ga0137382_101607572 | 3300012200 | Vadose Zone Soil | DNLIDLMKDFSLSSAQGVGGALRIPPRASTPFDARYGQW* |
| Ga0137363_105529871 | 3300012202 | Vadose Zone Soil | RVKPVESTPNLRLSDDRIDLMSGFSLSSKQAIGGAWGIPVRPPTPFDERYGQW* |
| Ga0137381_105565321 | 3300012207 | Vadose Zone Soil | RLSDDRIDLMKDFSLSSGQAIGGAWGIPLRPSTPFDERYGQW* |
| Ga0137376_109283631 | 3300012208 | Vadose Zone Soil | TPPNLRLSDDRIDLMTGGFSLSSAQAIGGAWEIPVRPPTPFDARYGQW* |
| Ga0137376_113152752 | 3300012208 | Vadose Zone Soil | RLSDNLIDLMKDFSLSSAQGIGGAWRIPPRASTPFDARYGQW* |
| Ga0137379_110583851 | 3300012209 | Vadose Zone Soil | NLRLSDKPIDLMKYFSLSSDQAIGGAWGIPLRPSTPFDERSGQW* |
| Ga0137369_101828491 | 3300012355 | Vadose Zone Soil | SHDLIDLMQEFSLSSAHAIGGAWGIPVRPPTLFDERYGRW* |
| Ga0137385_110170562 | 3300012359 | Vadose Zone Soil | RVKPVDRLPPNLRLSDKPIDLMKYFSLSSDQAIGGAWGIPLRPSTPFDERYGQW* |
| Ga0137358_105870213 | 3300012582 | Vadose Zone Soil | PPDLRLSDKPIALMKDFRLSNAEAIGGAWAIPVRPSTPFDERYGQW* |
| Ga0126369_125090581 | 3300012971 | Tropical Forest Soil | EMARVKPVDSPPPNLRLSEGLIDLMKDFSLSSAKGIGGAWLRPSTPFDERYGQW* |
| Ga0182035_115743951 | 3300016341 | Soil | ARVKPVDTMPPNLRLSDNLIDLMEHFSLSSAQGIGRAWGIPLRASTPFDERYGQW |
| Ga0182032_101733932 | 3300016357 | Soil | RVKPVDSPPPNLRLSEGLIDLMKDFSLSSTQGIGGAWLRPSTPFDERYGQW |
| Ga0182032_115414121 | 3300016357 | Soil | KPVDRPPPNLRLSEGLIDLMKDFSLSSAQGIGGAWLRPSTPFDERYGQW |
| Ga0182034_102602211 | 3300016371 | Soil | MFNMKPVDTMPPNLRLSEGLIDLMKDFSISSAEGIGGAWGVPPRPSTPFDERYGQW |
| Ga0182034_115246021 | 3300016371 | Soil | PVNTVPPNLRLSDNLIDLMEHFSLSSAQGIGCAWGIPLRASTPFDERYGQW |
| Ga0182038_117427001 | 3300016445 | Soil | PVDTMPPNLRLSDNLIDLMEDFSLSSAQGIGLAWRIPPRASTPFDERYGQW |
| Ga0182038_121789782 | 3300016445 | Soil | LPPNLQLSDKPIDLMKDFRLSNVEAIGGAWAIPVRPSTPFDERYGQW |
| Ga0210407_110786291 | 3300020579 | Soil | RNLRFSDDRIDLMSGFSLSSNRAIGGAWEIPMRPPTPFDERYGQW |
| Ga0213872_104507301 | 3300021361 | Rhizosphere | VDRPPPNLRLSEGLIDLMKDFSLSSAQGIGGAWLRPSTPFDERYGQW |
| Ga0126371_129470362 | 3300021560 | Tropical Forest Soil | VKPVDRPPPNLRLSEGLIDLMKDFSLSSAQGIGGPWLRPSTPFDERYGQW |
| Ga0126371_134699741 | 3300021560 | Tropical Forest Soil | RVKPVDTMPPNLRLSDNLIDLMEDFSLSSAQGIGLAWRIPPRASTPFDERYGQW |
| Ga0207692_101694813 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | LIDLMKDFSLSSAQGVGGAWRIPPRALTPFDARYGQW |
| Ga0207663_105188911 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | PPNLRLSDDRIDLMTGGFSLSSAQAIGGAWEIPVRPPTPFDARYGQW |
| Ga0207646_110529822 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | LSDDRIDLMKDFSLSSGQAIGGAWGIPPRPSTPFDERYGQW |
| Ga0207664_113316752 | 3300025929 | Agricultural Soil | RLSDNLIDLMKGFSLSSAQGIGGAWRIPPRASTPFDARYGQW |
| Ga0209214_10012701 | 3300027071 | Forest Soil | RLSDKPIDLMKDFRLSNAEAIGGAWAIPVRPSTPFDERYGQW |
| Ga0318516_102832813 | 3300031543 | Soil | RLSEGLIDLMKDFSLSSAKGIGGAWLRPSTPFDERYGQW |
| Ga0318516_108360671 | 3300031543 | Soil | ARVKPVDRPPPNLRLSEGLIDLMKDFSLSSAQGIGGAWLRPSTPFDERYGQW |
| Ga0318573_102884471 | 3300031564 | Soil | MPPNLRLSDNLIDLMKDFSLSSAQAIGGAWETPLPPPTPFDERYGRW |
| Ga0318542_100308284 | 3300031668 | Soil | SKPVDRTPPNLRLSEDLIDLMKDFSLSSAQGIGGAWLRPSTPFDERYGQW |
| Ga0318542_100571341 | 3300031668 | Soil | RVKPVDSPPPNLRLSEGLIDLMKDFSLSSAKGIGGAWLRPSTPFDERYGQW |
| Ga0318561_101181001 | 3300031679 | Soil | NLRLSDNLIDLMEHFSLSSAQGIGRAWGIPLRASTPFDERYGQW |
| Ga0318574_101142991 | 3300031680 | Soil | VKPVDSPPPNLRLSEGLIDLMKDFSLSSAKGIGGAWLRPSTPFDERYGQW |
| Ga0318574_105329831 | 3300031680 | Soil | SEGLIDLMKDFSLSSAQGIGGAWLRPSTPFDERYGQW |
| Ga0318572_109229051 | 3300031681 | Soil | PPPNLRLSEGLIDLMKDFSLSSAQGIGGAWLRPSTPFDERYGQW |
| Ga0318560_108231322 | 3300031682 | Soil | PVDRPPPNLRLSEGLIDLMKDFSLSSAQGIGGAWLRPSTPFDERYGQW |
| Ga0306917_104255771 | 3300031719 | Soil | PPNLRLSEGLIDLMKDFSLSSAQGIGGAWLRPSTPFDERYGQW |
| Ga0306917_109259972 | 3300031719 | Soil | NLRLSEGLIDLMKDFSLSSAQGIGGAWLRPSTPFDERYGQW |
| Ga0318500_106855921 | 3300031724 | Soil | FRLSDNLIDLMEDFSLSSAQGIGLAWRIPPRASTPFDERYGQW |
| Ga0306918_102113624 | 3300031744 | Soil | EGLIDLMKDFSLSSAQGIGGAWLRPSTPFDERYGQW |
| Ga0306918_105590961 | 3300031744 | Soil | IDLMKDFSLSSAQAIDGAWGTRLRPSTPFGERYGRW |
| Ga0306918_105745941 | 3300031744 | Soil | VKPVDRPPPNLRLSEGLIDLMKDFSLSSAQGIGGAWLRPSTPFDERYGQW |
| Ga0306918_107956262 | 3300031744 | Soil | ARVKPVDRPPPNLRLSEGLIDLMKDFSLSSAEGIGGAWLRPSTPFDERYGQW |
| Ga0306918_111941961 | 3300031744 | Soil | VDKLPPNLRLSDKPIDLMKDFRLSNVEAIGGAWAIPVRPSTPFDERYGQW |
| Ga0318502_103221711 | 3300031747 | Soil | LRLSEGLIDLMKDFSLSSAQGIGGAWLRPSTPFDERYGQW |
| Ga0318502_106118462 | 3300031747 | Soil | LSEGLIDLMKDFSISSAEGIGGAWGIPPRPSTPFDERYGRW |
| Ga0318554_104830791 | 3300031765 | Soil | DRTPPNLQLSDDLIDLMKDFSLSSAQAIGRAWGPLRPSTPFDERYGQW |
| Ga0318546_113327031 | 3300031771 | Soil | IEMARVKPVDRPPPNLRLSEGLIDLMKDFSLSSTQGIGGAWLRPSTPFDERYGQW |
| Ga0318548_103744501 | 3300031793 | Soil | DLIDLMKDFSLSSAQAIGRAWGPLRPSTPFDERYGQW |
| Ga0318503_101411191 | 3300031794 | Soil | DTMPPNLRLSEGLIDLMKDFSISSAEGIGGAWGIPPRPSTPFDERYRRW |
| Ga0318557_106078321 | 3300031795 | Soil | VKPVDTMPPNLRLSDNLIDLMEDFSLSSAQGIGLAWRIPPRASTPFDERYGQW |
| Ga0318567_100586484 | 3300031821 | Soil | PVDRPPSNLRLSEGLIDLMKDFSLSSAQGIGGAWLRPSTPFDERYGQW |
| Ga0318567_101349821 | 3300031821 | Soil | GLIDLMKDFSLSSAEGIGGAWLRPSTPFDERYGQW |
| Ga0318517_101022531 | 3300031835 | Soil | NLRLSDDLIDLMKDFSLSSAQAIGGAWLRPSTPFDERYGQW |
| Ga0318512_100950781 | 3300031846 | Soil | LIDLMRDFSLSSAQAIGGVWKTPLPPSTPFDERYGRW |
| Ga0318527_104457651 | 3300031859 | Soil | DRPPPNLRLSEGLIDLMKDFSLSSTQGIGGAWLRPSTPFDERYGQW |
| Ga0306919_114915492 | 3300031879 | Soil | SDDQIDLMSGFSLSSNQAIGGAWGIPVRPPTPFDERYGQW |
| Ga0318544_100157457 | 3300031880 | Soil | GLIDLMKDFSLSSAKGIGGAWLRPSTPFDERYGQW |
| Ga0306925_104621151 | 3300031890 | Soil | MPPNLRLSDNLIDLMEHFSLSSAQGIGRAWGIPLRASTPFDERYGQW |
| Ga0306925_117163391 | 3300031890 | Soil | GLIDLMKDFSLSSAKGIGGAWLRPSTPFDERYAQW |
| Ga0318551_104688971 | 3300031896 | Soil | PVDWMPPNLRLSDDLIDLMKDFSLSSAQAIGGAWLRPSTPFDERYGQW |
| Ga0306923_109671421 | 3300031910 | Soil | PPNLRLSEDLIDLMKDFSLSSAQGIGGAWLRPSTPFDERYGQW |
| Ga0306921_116062191 | 3300031912 | Soil | VDTMPPNLRLSDNLIDLMEDFSLSSAQGIGLAWRIPPGASTPFDERYGQW |
| Ga0310912_114568302 | 3300031941 | Soil | PPNLQLSDKPIDLMKDFRLSNVEAIGGAWAIPVRPSTPFDERYGQW |
| Ga0310912_114700742 | 3300031941 | Soil | DTMLPNLRLSDNLIDLMEDFSLSSAEGIGLAWRIPPRASTPFDERYGQW |
| Ga0310916_113696712 | 3300031942 | Soil | PPNLRLSDNLIDLMEHFSLSSAQGIGRAWGIPLRASTPFDERYGQW |
| Ga0310910_107589201 | 3300031946 | Soil | EVARVKPVDRPPPNLRLSEGLIDLMKDFSLSSAEGIGGAWLRPSTPFDERYGQW |
| Ga0318531_105487981 | 3300031981 | Soil | DLIDLMKDFSLSSAQGIGGAWLRPSTPFDERYGQW |
| Ga0306922_123606641 | 3300032001 | Soil | RPPPNLRLSEGLIDLMKDFSLSSAQGIGGAWVRPSTPFDERFGQW |
| Ga0318569_101539601 | 3300032010 | Soil | PNLRLSDNLIDLMEHFSLSSAQGIGRAWGIPLRASTPFDERYGQW |
| Ga0318507_103324591 | 3300032025 | Soil | LSEGLIDLMKDFSLSSAQGIGGAWLRPSTPFDERYGRW |
| Ga0310911_103681781 | 3300032035 | Soil | LSEGRIDLMKDFSLSSAQGIGGAWLRPSTPFDERYGQW |
| Ga0318506_102252992 | 3300032052 | Soil | DRMPPNLQLSDDLIDLMKDFSLSSAQAIGRAWGTPLRSSTPFDERYGQW |
| Ga0318570_101120693 | 3300032054 | Soil | LIDLMKDFSLSSAQAIDGAWGTRLRPSTPFGERYGRW |
| Ga0318533_110924462 | 3300032059 | Soil | KSMFNMKPVDTMPPNLRLSEGLIDLMKDFSISSAEGIGGAWGVPPRPSTPFDERYGQW |
| Ga0318505_104810762 | 3300032060 | Soil | LRLSDDQIDLMSGFSLSSNQAIGGAWGIPVRPPTPFDERYGQW |
| Ga0318504_101821851 | 3300032063 | Soil | ARVKPVDSPPPNLRLSEGLIDLMKDFSLSSAKGIGGAWLRPSTPFDERYGQW |
| Ga0318518_106753242 | 3300032090 | Soil | VDTMPPNLRLSDNLIDLMEDFSLSSAQGIGLAWRIPPRASTPFDERYGQW |
| Ga0318540_105489042 | 3300032094 | Soil | QIDLMSGFSLSSNQAIGGAWGIPVRPPTPFDERYGQW |
| Ga0306920_1036855112 | 3300032261 | Soil | KPVDTMPPNLRLSDNLIDLMEDFSLSSAQGIGLAWRIPPRASTPFDERYGQW |
| Ga0306920_1038199621 | 3300032261 | Soil | RTPPNLRLSDDRIDLMSGLSLSSAQAIGRAWGIPLRPPTPFEERYGQW |
| Ga0310914_113253532 | 3300033289 | Soil | NLIDLMEDFSLSSAQGIGLAWRIPPRASTPFDERYGQW |
| Ga0318519_101050292 | 3300033290 | Soil | RLSEGLIDLMKDFSLSSTQGIGGAWLRPSTPFDERYGQW |
| Ga0318519_101221941 | 3300033290 | Soil | IDLMKDFSLSSAQAIGRAWGPLRPSTPFDERYGQW |
| Ga0318519_110003091 | 3300033290 | Soil | DNLIDLMEDFSLSSAQGIGLAWRIPPRASTPFDERYGQW |
| ⦗Top⦘ |