


| Basic Information | |
|---|---|
| Family ID | F058394 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 135 |
| Average Sequence Length | 40 residues |
| Representative Sequence | MALRTKIRPDEAEPEGCGGSTVEGENEVWPDFRRNPKGR |
| Number of Associated Samples | 104 |
| Number of Associated Scaffolds | 135 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 33.33 % |
| % of genes near scaffold ends (potentially truncated) | 1.48 % |
| % of genes from short scaffolds (< 2000 bps) | 0.00 % |
| Associated GOLD sequencing projects | 97 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.15 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (97.778 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog (30.370 % of family members) |
| Environment Ontology (ENVO) | Unclassified (28.148 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (47.407 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 0.00% Coil/Unstructured: 100.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.15 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 135 Family Scaffolds |
|---|---|---|
| PF13432 | TPR_16 | 2.96 |
| PF00578 | AhpC-TSA | 2.22 |
| PF00005 | ABC_tran | 2.22 |
| PF02518 | HATPase_c | 1.48 |
| PF00550 | PP-binding | 1.48 |
| PF00535 | Glycos_transf_2 | 1.48 |
| PF07589 | PEP-CTERM | 1.48 |
| PF02769 | AIRS_C | 1.48 |
| PF02661 | Fic | 1.48 |
| PF01925 | TauE | 0.74 |
| PF00825 | Ribonuclease_P | 0.74 |
| PF00501 | AMP-binding | 0.74 |
| PF01019 | G_glu_transpept | 0.74 |
| PF11138 | DUF2911 | 0.74 |
| PF13545 | HTH_Crp_2 | 0.74 |
| PF07751 | Abi_2 | 0.74 |
| PF13565 | HTH_32 | 0.74 |
| PF13429 | TPR_15 | 0.74 |
| PF02371 | Transposase_20 | 0.74 |
| PF03819 | MazG | 0.74 |
| PF08668 | HDOD | 0.74 |
| PF01678 | DAP_epimerase | 0.74 |
| PF13520 | AA_permease_2 | 0.74 |
| PF12161 | HsdM_N | 0.74 |
| PF00171 | Aldedh | 0.74 |
| PF00474 | SSF | 0.74 |
| PF00331 | Glyco_hydro_10 | 0.74 |
| PF00561 | Abhydrolase_1 | 0.74 |
| PF01062 | Bestrophin | 0.74 |
| PF00756 | Esterase | 0.74 |
| PF13662 | Toprim_4 | 0.74 |
| PF00364 | Biotin_lipoyl | 0.74 |
| PF01557 | FAA_hydrolase | 0.74 |
| PF02660 | G3P_acyltransf | 0.74 |
| PF03705 | CheR_N | 0.74 |
| PF01118 | Semialdhyde_dh | 0.74 |
| PF00027 | cNMP_binding | 0.74 |
| PF03544 | TonB_C | 0.74 |
| PF02698 | DUF218 | 0.74 |
| PF02586 | SRAP | 0.74 |
| PF00378 | ECH_1 | 0.74 |
| PF02620 | YceD | 0.74 |
| PF16916 | ZT_dimer | 0.74 |
| PF13517 | FG-GAP_3 | 0.74 |
| PF09312 | SurA_N | 0.74 |
| PF09821 | AAA_assoc_C | 0.74 |
| PF11185 | DUF2971 | 0.74 |
| PF08530 | PepX_C | 0.74 |
| PF12867 | DinB_2 | 0.74 |
| PF02585 | PIG-L | 0.74 |
| PF00072 | Response_reg | 0.74 |
| PF01804 | Penicil_amidase | 0.74 |
| PF05362 | Lon_C | 0.74 |
| PF00903 | Glyoxalase | 0.74 |
| PF02527 | GidB | 0.74 |
| PF09335 | SNARE_assoc | 0.74 |
| PF01566 | Nramp | 0.74 |
| PF13784 | Fic_N | 0.74 |
| PF16499 | Melibiase_2 | 0.74 |
| PF01381 | HTH_3 | 0.74 |
| PF03717 | PBP_dimer | 0.74 |
| PF02012 | BNR | 0.74 |
| PF08240 | ADH_N | 0.74 |
| PF13340 | DUF4096 | 0.74 |
| PF07690 | MFS_1 | 0.74 |
| PF00494 | SQS_PSY | 0.74 |
| PF06463 | Mob_synth_C | 0.74 |
| PF00795 | CN_hydrolase | 0.74 |
| PF00793 | DAHP_synth_1 | 0.74 |
| PF13803 | DUF4184 | 0.74 |
| PF04461 | DUF520 | 0.74 |
| PF00135 | COesterase | 0.74 |
| PF01300 | Sua5_yciO_yrdC | 0.74 |
| PF00248 | Aldo_ket_red | 0.74 |
| PF01695 | IstB_IS21 | 0.74 |
| PF04052 | TolB_N | 0.74 |
| PF01894 | UPF0047 | 0.74 |
| PF01709 | Transcrip_reg | 0.74 |
| PF00933 | Glyco_hydro_3 | 0.74 |
| COG ID | Name | Functional Category | % Frequency in 135 Family Scaffolds |
|---|---|---|---|
| COG1352 | Methylase of chemotaxis methyl-accepting proteins | Signal transduction mechanisms [T] | 1.48 |
| COG0014 | Gamma-glutamyl phosphate reductase | Amino acid transport and metabolism [E] | 0.74 |
| COG0217 | Transcriptional and/or translational regulatory protein YebC/TACO1 | Translation, ribosomal structure and biogenesis [J] | 0.74 |
| COG0253 | Diaminopimelate epimerase | Amino acid transport and metabolism [E] | 0.74 |
| COG0344 | Phospholipid biosynthesis protein PlsY, probable glycerol-3-phosphate acyltransferase | Lipid transport and metabolism [I] | 0.74 |
| COG0357 | 16S rRNA G527 N7-methylase RsmG (former glucose-inhibited division protein B) | Translation, ribosomal structure and biogenesis [J] | 0.74 |
| COG0398 | Uncharacterized membrane protein YdjX, related to fungal oxalate transporter, TVP38/TMEM64 family | Function unknown [S] | 0.74 |
| COG0405 | Gamma-glutamyltranspeptidase | Amino acid transport and metabolism [E] | 0.74 |
| COG0432 | Thiamin phosphate synthase YjbQ, UPF0047 family | Coenzyme transport and metabolism [H] | 0.74 |
| COG0466 | ATP-dependent Lon protease, bacterial type | Posttranslational modification, protein turnover, chaperones [O] | 0.74 |
| COG0586 | Membrane integrity protein DedA, putative transporter, DedA/Tvp38 family | Cell wall/membrane/envelope biogenesis [M] | 0.74 |
| COG0594 | RNase P protein component | Translation, ribosomal structure and biogenesis [J] | 0.74 |
| COG0730 | Sulfite exporter TauE/SafE/YfcA and related permeases, UPF0721 family | Inorganic ion transport and metabolism [P] | 0.74 |
| COG0760 | Peptidyl-prolyl isomerase, parvulin family | Posttranslational modification, protein turnover, chaperones [O] | 0.74 |
| COG0768 | Cell division protein FtsI, peptidoglycan transpeptidase (Penicillin-binding protein 2) | Cell cycle control, cell division, chromosome partitioning [D] | 0.74 |
| COG0810 | Periplasmic protein TonB, links inner and outer membranes | Cell wall/membrane/envelope biogenesis [M] | 0.74 |
| COG0823 | Periplasmic component TolB of the Tol biopolymer transport system | Intracellular trafficking, secretion, and vesicular transport [U] | 0.74 |
| COG1012 | Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase | Lipid transport and metabolism [I] | 0.74 |
| COG1067 | Predicted ATP-dependent protease | Posttranslational modification, protein turnover, chaperones [O] | 0.74 |
| COG1238 | Uncharacterized membrane protein YqaA, VTT domain | Function unknown [S] | 0.74 |
| COG1399 | 23S rRNA accumulation protein YceD (essential in plants, uncharacterized in bacteria) | Translation, ribosomal structure and biogenesis [J] | 0.74 |
| COG1434 | Lipid carrier protein ElyC involved in cell wall biogenesis, DUF218 family | Cell wall/membrane/envelope biogenesis [M] | 0.74 |
| COG1472 | Periplasmic beta-glucosidase and related glycosidases | Carbohydrate transport and metabolism [G] | 0.74 |
| COG1484 | DNA replication protein DnaC | Replication, recombination and repair [L] | 0.74 |
| COG1562 | Phytoene/squalene synthetase | Lipid transport and metabolism [I] | 0.74 |
| COG1666 | Cyclic di-GMP-binding protein YajQ, UPF0234 family | Signal transduction mechanisms [T] | 0.74 |
| COG1750 | Predicted archaeal serine protease, S18 family | General function prediction only [R] | 0.74 |
| COG1914 | Mn2+ or Fe2+ transporter, NRAMP family | Inorganic ion transport and metabolism [P] | 0.74 |
| COG2120 | N-acetylglucosaminyl deacetylase, LmbE family | Carbohydrate transport and metabolism [G] | 0.74 |
| COG2135 | ssDNA abasic site-binding protein YedK/HMCES, SRAP family | Replication, recombination and repair [L] | 0.74 |
| COG2272 | Carboxylesterase type B | Lipid transport and metabolism [I] | 0.74 |
| COG2366 | Acyl-homoserine lactone (AHL) acylase PvdQ | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.74 |
| COG2896 | GTP 3',8-cyclase (molybdenum cofactor biosynthesis protein MoaA) | Coenzyme transport and metabolism [H] | 0.74 |
| COG2936 | Predicted acyl esterase | General function prediction only [R] | 0.74 |
| COG2949 | Uncharacterized periplasmic protein SanA, affects membrane permeability for vancomycin | Cell wall/membrane/envelope biogenesis [M] | 0.74 |
| COG3480 | Predicted secreted protein YlbL, contains PDZ domain | Signal transduction mechanisms [T] | 0.74 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.74 |
| COG3693 | Endo-1,4-beta-xylanase, GH35 family | Carbohydrate transport and metabolism [G] | 0.74 |
| COG4230 | Delta 1-pyrroline-5-carboxylate dehydrogenase | Amino acid transport and metabolism [E] | 0.74 |
| COG4823 | Abortive infection bacteriophage resistance protein | Defense mechanisms [V] | 0.74 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 97.78 % |
| All Organisms | root | All Organisms | 2.22 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002848|draft_102312 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1762149 | Open in IMG/M |
| 3300014492|Ga0182013_10009752 | All Organisms → cellular organisms → Bacteria | 10076 | Open in IMG/M |
| 3300033402|Ga0326728_10004460 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 41386 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 30.37% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 10.37% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 6.67% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 5.93% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 5.19% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 4.44% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 4.44% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 3.70% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.22% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.22% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 2.22% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 2.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.96% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.48% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.48% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.48% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 1.48% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 1.48% |
| Wetland | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland | 0.74% |
| Hydrocarbon Resource Environments | Environmental → Aquatic → Thermal Springs → Tepid (25-34C) → Sediment → Hydrocarbon Resource Environments | 0.74% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.74% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.74% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.74% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.74% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.74% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.74% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.74% |
| Sugarcane Root And Bulk Soil | Host-Associated → Plants → Rhizome → Unclassified → Unclassified → Sugarcane Root And Bulk Soil | 0.74% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.74% |
| Host-Associated | Host-Associated → Plants → Peat Moss → Unclassified → Unclassified → Host-Associated | 0.74% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000567 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 | Environmental | Open in IMG/M |
| 3300001213 | Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly) | Environmental | Open in IMG/M |
| 3300002848 | PDIso5.158Aa3July202012 | Environmental | Open in IMG/M |
| 3300003316 | Sugarcane root Sample L1 | Host-Associated | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
| 3300005650 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate RNA 2013_055 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300009548 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_100 | Environmental | Open in IMG/M |
| 3300009632 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_40 | Environmental | Open in IMG/M |
| 3300009665 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 | Environmental | Open in IMG/M |
| 3300009697 | Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fd - Sphagnum magellanicum MG | Host-Associated | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300011089 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 58 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300014153 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_60_metaG | Environmental | Open in IMG/M |
| 3300014160 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_30_metaG | Environmental | Open in IMG/M |
| 3300014199 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_30_metaG | Environmental | Open in IMG/M |
| 3300014491 | Permafrost microbial communities from Stordalen Mire, Sweden - 612S2D metaG | Environmental | Open in IMG/M |
| 3300014492 | Permafrost microbial communities from Stordalen Mire, Sweden - 612S2M metaG | Environmental | Open in IMG/M |
| 3300014499 | Permafrost microbial communities from Stordalen Mire, Sweden - 612S2S metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014655 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_10_metaG | Environmental | Open in IMG/M |
| 3300014658 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_10_metaG | Environmental | Open in IMG/M |
| 3300014838 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016728 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017931 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_100 | Environmental | Open in IMG/M |
| 3300017948 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10 | Environmental | Open in IMG/M |
| 3300017988 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_30_metaG | Environmental | Open in IMG/M |
| 3300018019 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_150 | Environmental | Open in IMG/M |
| 3300018030 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_100 | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300022524 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 E1 20-24 | Environmental | Open in IMG/M |
| 3300022875 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S2 10-14 | Environmental | Open in IMG/M |
| 3300023068 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S2 20-24 | Environmental | Open in IMG/M |
| 3300023090 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 20-24 | Environmental | Open in IMG/M |
| 3300023101 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 10-14 | Environmental | Open in IMG/M |
| 3300023255 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P2 10-14 | Environmental | Open in IMG/M |
| 3300025612 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300026502 | Peat soil microbial communities from Stordalen Mire, Sweden - H.B.S.T-25.r1 | Environmental | Open in IMG/M |
| 3300027080 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF009 (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300028068 | Peat soil microbial communities from Stordalen Mire, Sweden - H.B.S.T75 | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028552 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N1_1 | Environmental | Open in IMG/M |
| 3300028562 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N1_3 | Environmental | Open in IMG/M |
| 3300028565 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E2_3 | Environmental | Open in IMG/M |
| 3300028572 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N2_1 | Environmental | Open in IMG/M |
| 3300028745 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_E1_3 | Environmental | Open in IMG/M |
| 3300028785 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N3_2 | Environmental | Open in IMG/M |
| 3300028788 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E2_2 | Environmental | Open in IMG/M |
| 3300028813 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N3_3 | Environmental | Open in IMG/M |
| 3300028859 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_E1_1 | Environmental | Open in IMG/M |
| 3300028866 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N3_2 | Environmental | Open in IMG/M |
| 3300028882 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N2_3 | Environmental | Open in IMG/M |
| 3300029883 | I_Bog_E2 coassembly | Environmental | Open in IMG/M |
| 3300029907 | I_Bog_N1 coassembly | Environmental | Open in IMG/M |
| 3300029911 | III_Bog_N2 coassembly | Environmental | Open in IMG/M |
| 3300029913 | III_Bog_N3 coassembly | Environmental | Open in IMG/M |
| 3300029915 | III_Bog_E1 coassembly | Environmental | Open in IMG/M |
| 3300029916 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E3_1 | Environmental | Open in IMG/M |
| 3300029922 | III_Fen_E1 coassembly | Environmental | Open in IMG/M |
| 3300029945 | I_Bog_N2 coassembly | Environmental | Open in IMG/M |
| 3300029952 | II_Bog_N3 coassembly | Environmental | Open in IMG/M |
| 3300029955 | II_Bog_E2 coassembly | Environmental | Open in IMG/M |
| 3300029956 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N1_2 | Environmental | Open in IMG/M |
| 3300029985 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_E1_1 | Environmental | Open in IMG/M |
| 3300029988 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E2_3 | Environmental | Open in IMG/M |
| 3300029992 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N2_3 | Environmental | Open in IMG/M |
| 3300029994 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_E1_4 | Environmental | Open in IMG/M |
| 3300030011 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_E2_3 | Environmental | Open in IMG/M |
| 3300030014 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_N3_3 | Environmental | Open in IMG/M |
| 3300030020 | II_Bog_N1 coassembly | Environmental | Open in IMG/M |
| 3300030114 | I_Fen_E2 coassembly | Environmental | Open in IMG/M |
| 3300030503 | III_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030506 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N1_1 | Environmental | Open in IMG/M |
| 3300030519 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E3_3 | Environmental | Open in IMG/M |
| 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Host-Associated | Open in IMG/M |
| 3300031259 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E1_3 | Environmental | Open in IMG/M |
| 3300031524 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_3 | Environmental | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031671 | Soil microbial communities from Risofladan, Vaasa, Finland - OX-1 | Environmental | Open in IMG/M |
| 3300031672 | Soil microbial communities from Risofladan, Vaasa, Finland - OX-2 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Host-Associated | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
| 3300032896 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4 | Environmental | Open in IMG/M |
| 3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| 3300033402 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MN | Environmental | Open in IMG/M |
| 3300033405 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB29MY | Environmental | Open in IMG/M |
| 3300033982 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB22AY SIP fraction | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12270J11330_101103772 | 3300000567 | Peatlands Soil | LREKIGPDEAEPEGFGNPKVEGDNKVWPDFIRNPKGRGGFSRSLRPS |
| JGIcombinedJ13530_1012029551 | 3300001213 | Wetland | LRAKIGPDEAEPEDFGYSKVEGENEVWTDLRRNPEGRGRFSR* |
| draft_102312907 | 3300002848 | Hydrocarbon Resource Environments | MALRAKIGPGEAEPEGFGGFKVEGENEEWPDLRRNPKRRG* |
| rootH1_100567914 | 3300003316 | Sugarcane Root And Bulk Soil | LRAEIRPDEAEAEGCGGPTVEADNEGWTDFRCNPQGRGRFS* |
| Ga0062389_1007094772 | 3300004092 | Bog Forest Soil | MALRAKIRPAKAEAENRGDPTIKAENAVWPDLRRNPKGRGRFS* |
| Ga0062388_1005743701 | 3300004635 | Bog Forest Soil | MVLRAEIRPDKAEAENRGDPTIEGENAIWPDLRRDPKGQGRLS* |
| Ga0070681_109965841 | 3300005458 | Corn Rhizosphere | LRAKIWTDEAESAGCGGPTVKDDNEVWPDFGRNPKGKGEFS |
| Ga0075038_113424741 | 3300005650 | Permafrost Soil | VALRTKIGPDEAESEGCGGSTVEDDNEVWPDLRRNPEGWGQF |
| Ga0070766_104169691 | 3300005921 | Soil | VKIAPDEAESEGCGGPTTEDDNEVWRDFHRNPKGWGQFSSFR |
| Ga0070716_1005385982 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MALRVKIRPDEAEPNGFGGSKVEGENNVWSDFLRNPKGRGPIFP |
| Ga0116107_11589532 | 3300009548 | Peatland | MALREKIRLDEDLSLGWEAEPEGCGGSTVESENEVWPDF |
| Ga0116102_12065951 | 3300009632 | Peatland | MALPAKIAPDEAEPEGCGNPTAEGENEVWRDLRRSPKGRGRFSPFR |
| Ga0116135_10881811 | 3300009665 | Peatland | MALRGKIGPNEAEPEGFGGSKVEGENEVWPDFRRNPSGRGQFSRFPRPSS |
| Ga0116231_103746602 | 3300009697 | Host-Associated | MALRAKIRPDKAEPEDCGYSTIEGENAVWPNLRRNPKGQGQFS* |
| Ga0134128_104281381 | 3300010373 | Terrestrial Soil | MALRGKIRSDEAEPEGCDGSTVEGENEVWPDFRRNPKGR |
| Ga0134126_110392311 | 3300010396 | Terrestrial Soil | LLAKIRVDEAESAGCGGTTVKDDNEVWTDFGRNPK |
| Ga0138573_12564642 | 3300011089 | Peatlands Soil | LREKIGPDEAEPEGFGDPKVEGDNKVWPDFIRNPKGRGGFS |
| Ga0137383_104110561 | 3300012199 | Vadose Zone Soil | LRVKIGPDEAEPEGCGRPTVKGENEVWPDFRRNPP |
| Ga0137379_117160621 | 3300012209 | Vadose Zone Soil | LRTEIGSDEAESEGCGGSTVEDDNEVWTNLRRNPK |
| Ga0150984_1201974501 | 3300012469 | Avena Fatua Rhizosphere | ALRAQIGPDEAEAEGCGGSTVEDDNEVWANLRRNPKGRGRFSRSLRHSSFQ* |
| Ga0181527_10420271 | 3300014153 | Bog | MALREKVRPDEAEPEGCGGSTVEGENEVWPDFHRNPKGR |
| Ga0181517_104098511 | 3300014160 | Bog | MTLRGKIRPNEAEQEGCGGSTAEDENEVWPNLLRNPSGRGQF |
| Ga0181535_100121931 | 3300014199 | Bog | GPDEAEPEGCGGSTVKGENEVWPDFLRNPTGRSQFS* |
| Ga0182014_100199181 | 3300014491 | Bog | VALRGKIWPDEAEPEGCGGPTVEGENEVWPDFHRNPKGRGQFSSFRRH |
| Ga0182013_100097521 | 3300014492 | Bog | MALRAKKRPDEAEPEDCGGSTVEGGNEVWPLFRRNPKG |
| Ga0182013_100557451 | 3300014492 | Bog | LRTKIGPDEAESEGCGGSTVEDDNEVWPDLRRNPKGW |
| Ga0182012_104185731 | 3300014499 | Bog | MGQAALRAKIRQDEAEPEGCGGSTVKGENEVWPDFP |
| Ga0182012_105951361 | 3300014499 | Bog | MALRTKIRPDEAEPEGCGGSTVEGENEVWPDFRRNPKGRGQFSRF |
| Ga0182024_10000070197 | 3300014501 | Permafrost | MALRTKIRPDEAEAEGCGGSTVEDENEVWPDFRRNPKG |
| Ga0181516_106722612 | 3300014655 | Bog | MAVRAKIGPDEAEPAGRHGPTVKGDNEVWPDLRRNPE |
| Ga0181519_108570711 | 3300014658 | Bog | MGSDEAESEGCGGSTVEDDNNVWPDFRRNPKDWGQFSRF |
| Ga0182030_100040481 | 3300014838 | Bog | LRGKIGPDEAEPEGFGGSKVEGDNEVWPDFTRNPK |
| Ga0182030_109473992 | 3300014838 | Bog | LWGGDEAEPEGCGGFTVKGENEVWPDFRRNPKGRGHFS |
| Ga0182039_107743032 | 3300016422 | Soil | MALRAKIGPDEAEPEGCGGPTVEGENEVWPDLRRNPKGRG |
| Ga0181500_11851821 | 3300016728 | Peatland | LRAKIRPDEAEPEGCGGPTVKGENEVWPNLRRNPSGRGQFS |
| Ga0187877_13232051 | 3300017931 | Peatland | LRAKIRSDEAESEGRGGSTVEDENEVWPDFRRNPSG |
| Ga0187847_102171621 | 3300017948 | Peatland | LACAALRAKTAPDEAEDDGCGQPTAKDDNEVWRALRRNPKGW |
| Ga0187847_107257842 | 3300017948 | Peatland | LPAKIGPDEAEPEDCGGPTVKGENEVWPDLRRNPKGRGHPSSVNRP |
| Ga0181520_101082481 | 3300017988 | Bog | VQGIGPDEAEDDGCGGSTAQDDNEVWPDFGRNPEGQGR |
| Ga0181520_108801742 | 3300017988 | Bog | VALRWKIRPVEAESEGCGGPTVEDDNEEWADFPRNPKGWGQFSRF |
| Ga0181520_108896512 | 3300017988 | Bog | VALLGKIRPVEAESEGCGGPTVEDDNEEWADFPRNPKGWGQFSRF |
| Ga0187874_102548501 | 3300018019 | Peatland | MALRVKIGSYEAGPEGCGGSTVEGENEVWPDFHPSDEDQ |
| Ga0187869_104698652 | 3300018030 | Peatland | MALRGKIGPNEAEPEGFGGSKVEGENEVWTDLRRNL |
| Ga0210385_111832841 | 3300021402 | Soil | LREEIAPDEAKSEGCGGPTIEDDNEVWRDFHRNPKGWGQF |
| Ga0210386_105728951 | 3300021406 | Soil | MALRAKIRPDEAESKGCGGSTVEDENEVWPDFRRNPSGRGQFS |
| Ga0210390_101572381 | 3300021474 | Soil | MALRAKIGPYEAEFEGCGGPTVEDDNEVWPDFRRNPE |
| Ga0210390_102123033 | 3300021474 | Soil | VALREKIAPDEAEDEGCGRSTIEDDNEVWRDFHRNPKGWGQFSSFPRR |
| Ga0224534_10512741 | 3300022524 | Soil | LREKIGPDEAEPEGRGGSTVEGENEVWPDFPRNPPGRG |
| Ga0224553_10374141 | 3300022875 | Soil | MALRTKIRPDEAEPEGCGGSTVEGENEVWPDFRRNPKGRGQ |
| Ga0224554_10057531 | 3300023068 | Soil | MALRAKKRPDEAEPEDCGGSTVEGENEVWPLFRRNPK |
| Ga0224554_10739891 | 3300023068 | Soil | MALRAKKRPDEAEPEDCGGSTVEGENEVWPVFRRNPK |
| Ga0224558_12175942 | 3300023090 | Soil | VAALREKIGPDEAESEGCGGSTVEGDNEISPYFIRNPKGRGQFPSF |
| Ga0224557_10704083 | 3300023101 | Soil | MALRAKKRPDEAEPEDCGGSTVEGENEVWPLFRRNPKGR |
| Ga0224547_10040911 | 3300023255 | Soil | MALRTKIRPDEAEAEGCGGSTVEDENEVWPDFRRNPKGR |
| Ga0208691_11417321 | 3300025612 | Peatland | MALRTKILPDEAEPEGCGGTTVEGENEVWQDFRRNPK |
| Ga0255350_100010124 | 3300026502 | Soil | MALRVKIGPEQADPKGFGGSKAEDENDVWPDFRCNPSGRGQFS |
| Ga0208237_10379842 | 3300027080 | Forest Soil | LREKIRPYEAEAEECGGPTFKADNEVWPDFRRNPE |
| Ga0209415_1003608810 | 3300027905 | Peatlands Soil | LREKIGPDEAEPEGFGDPKVEGDNKVWPDFIRNPKG |
| Ga0255355_10353612 | 3300028068 | Soil | LRTKITPDEAESEGCGGSTVEDDNDEWHDLRRNPE |
| Ga0137415_108478781 | 3300028536 | Vadose Zone Soil | VSSNSWLAALRAKISPDKAEVEGCGGSTVEADNEVWANFRRNPERRGGFF |
| Ga0302149_10492732 | 3300028552 | Bog | MALRAKKRPDEAEPEDCGGSTVEGENEVWPLFRRNPKGRGQFSRFL |
| Ga0302149_11436701 | 3300028552 | Bog | LAWMALRAKKRPDEAEPEDCGGSTVEGENEVWPLFRRNPKGRRHRASSGNRP |
| Ga0302151_102040691 | 3300028562 | Bog | MALRAKKRPDEAEPEDCGGSTVEGENEVWPLFRRNPKG |
| Ga0302145_101988291 | 3300028565 | Bog | LRAKIRPDEAEPAGCGGSTVKGENEVWTDFGRNPGSPAHVLC |
| Ga0302152_100702332 | 3300028572 | Bog | MALRAKKRPDEAEPEDCGGSTVEGENEVWPLFRRNP |
| Ga0302267_100680462 | 3300028745 | Bog | MALREKIRPDEAESEGCGGPTVEGDNEVWPDYIRNP |
| Ga0302267_101744021 | 3300028745 | Bog | VALRWKIRPVEAESEGCGGPTVEYDNEEWADFPRNPKGWGQFSR |
| Ga0302201_102229911 | 3300028785 | Bog | MALRAKKRPDEAEPEDCGGSTVEGENEVWPLFSRN |
| Ga0302201_103661092 | 3300028785 | Bog | LRTKIAPDEAESEGCGGSTVKDDNEEWRDFRRNPEGWGQF |
| Ga0302201_104016831 | 3300028785 | Bog | MALREKIRPDEAESEGCGGPTVEGDNEVWPDYIRNPKGRG |
| Ga0302189_101022281 | 3300028788 | Bog | MALRAKKRPDEAEPEDCGGSTVEGENEVWPLFSRNPKGRGQFSRFL |
| Ga0302157_106860611 | 3300028813 | Bog | LRGKIGPDEAEPEGFGDSKVKGDNEVWPDFHRNPNG |
| Ga0302265_10984291 | 3300028859 | Bog | MALRAKKRPDEAEPEDCGGSTVEGENEVWPLFSRNP |
| Ga0302278_100180289 | 3300028866 | Bog | LRTKIAPDEAESEGCGGSTVKDDNEEWRDFRRNPE |
| Ga0302154_100986471 | 3300028882 | Bog | MALRAKKRPDEAEPEDCGGSTVEGENEVWPLFSRNPK |
| Ga0311327_100604081 | 3300029883 | Bog | MALRAKKRPDEAEPEDCGGSTVEGENEVWLLFRRNPKG |
| Ga0311327_102387642 | 3300029883 | Bog | LLGKIRPVEAESEGCGGPTVEDDNEEWADFPRNPK |
| Ga0311327_103251301 | 3300029883 | Bog | GLHLWGGDEAEPEGCGGFTVKGENEVWPDFRRNPKGRGHFSPFRRHSSLLEL |
| Ga0311329_103815321 | 3300029907 | Bog | MALRAKKRPDEAEPEDCGGSTVEGGNEVWPLFSRNP |
| Ga0311361_104593782 | 3300029911 | Bog | VALRWKIRPVEAESEGCGGPTVEDDNEEWADFPRNPKGWGQFSRFPR |
| Ga0311362_101568501 | 3300029913 | Bog | MALRAKKRPDEAEPEDCGGSTVEGENEVWPVFRRNPKG |
| Ga0311362_101637893 | 3300029913 | Bog | MALRAKKRPDEAEPEDCGGSTVEGENEVWLLFRRNPK |
| Ga0311362_104785641 | 3300029913 | Bog | LLGKIRPVEAESEGCGGPTVEDDNEEWADFPRNPKG |
| Ga0311362_105724041 | 3300029913 | Bog | MALRAKKRPDEAEPEDCGGSTVEGENEVWPLFIRNP |
| Ga0311358_101696161 | 3300029915 | Bog | MALRTKIRPDEAEPEGCGGSTVEGENEVWPDFRRNPKGR |
| Ga0311358_102972342 | 3300029915 | Bog | VALLVKIGPDEAESEGCGGPTVEDDNDVWPDFHRSPKG |
| Ga0302148_10052706 | 3300029916 | Bog | MALRAKKRPDEAEPEDCGGSTVEGENEVWLLFRRNPKGRG |
| Ga0302148_10303221 | 3300029916 | Bog | MALRAKKRPDEAEPEDCGGSTVEGENEVWPLFRRN |
| Ga0311363_107659861 | 3300029922 | Fen | LRAKIRQDEAEPEGCGGSTVKGENEVWPDFRRNPSG |
| Ga0311330_102332772 | 3300029945 | Bog | MALRAKKRPDEAEPEDCGGSTVEGENEVWPLFRRNPKGRGQFS |
| Ga0311346_103956673 | 3300029952 | Bog | NATGRMALRVKIGPEQADPKGFGGSKAEDENDVWPDFRCNPSGRGQFS |
| Ga0311342_104237112 | 3300029955 | Bog | MALRTKIRPDEAEPEGCGGSTVEGENEVWPDFRRNPK |
| Ga0311342_106482091 | 3300029955 | Bog | MALRAKKRPDEAEPEDCGGSTVEGENEVWPLFRRNPKGRGQF |
| Ga0302150_101022291 | 3300029956 | Bog | LRGKIGPDETEPEGFGDSKVEGDNEVWPDFTRNPRSPVRE |
| Ga0302280_11943102 | 3300029985 | Fen | MALRAKKRPDEAEPEDCGGSTVEGENEVWPLFRRNPKGRR |
| Ga0302190_100876641 | 3300029988 | Bog | LRAKIRPDEAEPEGCGGSTVEGENEVWPDFRRNPKG |
| Ga0302276_101088711 | 3300029992 | Bog | LFKLLGWMALREKIRPDEAESEGCGGPTVEGDNEVWPDYIRNPKGRG |
| Ga0302283_13046931 | 3300029994 | Fen | LRWKIRPVEAESEGCGGPTVEDDNEEWADFPRNPK |
| Ga0302270_102902001 | 3300030011 | Bog | VALRWKIRPVEAESEGCGGPTVEYDNEEWADFPRNPKGWGQFSRFPRRSS |
| Ga0302175_101319041 | 3300030014 | Fen | LRAKIGSDNAGPEGSGGPTVEGEIHGWPLLRRNPKGR |
| Ga0311344_113115851 | 3300030020 | Bog | LRAKIGPDEAESEGCGGPTVEGENEVWPDLRRNPADRGQFS |
| Ga0311333_118063152 | 3300030114 | Fen | LRTKTGPDEAGSEGCGGPTVEDDNEVWPGLRRNPEG |
| Ga0311370_120367572 | 3300030503 | Palsa | MALRAKIRPDEAEREGCGGLTVEGENEVWQDFLRNPKGRGQFSSF |
| Ga0302194_100046301 | 3300030506 | Bog | MALRAKKRPDEAEPEDCGGSTVEGENEVWPLFRRNPKGRG |
| Ga0302193_102044142 | 3300030519 | Bog | VALLGKIRPVEAESEGCGGPTVEDDNEEWADFPRNPKGWGQFSRFP |
| Ga0265770_10185262 | 3300030878 | Soil | MALRAKIGPDEAEPEGCGDPTVEGENEVWPDFRRNPKGRGRFPRFRCRSPL |
| Ga0265339_105567822 | 3300031249 | Rhizosphere | MVWAALRTKIRPDEAEPAGCGGSTVKGENEVWPDLRRSLSGRGQFS |
| Ga0302187_104828761 | 3300031259 | Bog | LRAKILPDQAEPAGCGGSTVKGENEVWQDFRRNPK |
| Ga0302320_110872282 | 3300031524 | Bog | VALRWKIRPVEAESEGCGGPTVEYDNEEWADFPRNPKGWGQFSRFPRRS |
| Ga0302326_101213301 | 3300031525 | Palsa | MALRAKIRPDKAEPDDCGDPTIEGENEVWPDLRRNPKGRGQF |
| Ga0302326_106380841 | 3300031525 | Palsa | MALRVKIRPDKAEPDHCGDPTIEGENEVWPDLRRNPKGRGQ |
| Ga0307372_100051651 | 3300031671 | Soil | MALRAKMRAGEAKSEGCGGPTAEDDNEVWPHFRRNP |
| Ga0307373_100226987 | 3300031672 | Soil | MRAGEAKSEGCGGPTAEDDNEVWPHFRRNPEGRGRFSPFF |
| Ga0310686_1131946809 | 3300031708 | Soil | MRKPTMALRTKIRPDEAEPEGCGGSTVEGENEVWPDFRRN |
| Ga0265342_104518341 | 3300031712 | Rhizosphere | LRAKIAPDEAEDDGCGDPTTKDDNEAWRYFRRDPLGWGQFSPFLC |
| Ga0335085_108182882 | 3300032770 | Soil | LLTLLEWMALRAKIGPDEAEREVCGGPTVKGENEVWPDLRRNPEGR |
| Ga0335085_121037682 | 3300032770 | Soil | MALRSENRADEAERDVCGGPTVKGENEVWPDLRSNPEGRG |
| Ga0335079_119346761 | 3300032783 | Soil | LRAKIGLDEAEAAGCGRPPVKADNEVWPDFHRNPKERGGFSR |
| Ga0335078_113905212 | 3300032805 | Soil | MALRGKIRPEEAESEGCGGSTVEGENEIWPDLPRNP |
| Ga0335078_118642462 | 3300032805 | Soil | MALRGKIGPEEAEPEGCGGSTVEGENEVWPDLPRNPKGRG |
| Ga0335074_101974904 | 3300032895 | Soil | MALRAKIRPDEAEPEGFGGSKVEGENEVWPEFRRNPKGRGQF |
| Ga0335074_105089561 | 3300032895 | Soil | LREKIAPDEAEDEGCGGSTVEDDNEVWGDFRRNPSGWGRFSSFRCR |
| Ga0335075_107865892 | 3300032896 | Soil | MALRAKIRPDEAEPEGFGGSKVEGENEVWPHFRRN |
| Ga0335072_100425111 | 3300032898 | Soil | MALLAKIAPDAAEPEGFGDSKVEGDNKVCRNFRSNPKGR |
| Ga0335072_103234424 | 3300032898 | Soil | LREKIAPDEAEDEGCGGSTVEDDNEVWDDFRRNPSGWGR |
| Ga0335072_112047781 | 3300032898 | Soil | MALRAKIGSDEAEPEGFGGSKVEGENEVWRDFRRN |
| Ga0335073_105420381 | 3300033134 | Soil | MALRGKIRPEEAEPEGCGGSAVEGENEVWPDLPRNPKGR |
| Ga0335073_113057161 | 3300033134 | Soil | MALLAKIAPDAAEPEGFGDSKVEGDNKVWRNFRSNPKGRGPFFR |
| Ga0335073_121080792 | 3300033134 | Soil | MALRGEIRPEEAEPEGCGGSTVEGENEVWPDLPRNPKGR |
| Ga0326728_100044601 | 3300033402 | Peat Soil | LTFARAALRVKIGPGETESEGCGGSTVEDDNEAWPDLRRNP |
| Ga0326728_101337273 | 3300033402 | Peat Soil | LLTFARAALRVKIGPGETESEGCGGSTVEDDNEAWPDLRRNPKG |
| Ga0326727_103685301 | 3300033405 | Peat Soil | MALRVKIRSDEAEPEGCGGFTVKGENEVWPDFRRNPEGRGQFSRFL |
| Ga0326727_106691322 | 3300033405 | Peat Soil | AKIMSDEAEPEGFGGLKVEGENEVWRDFRHNPKGRGRFSPFRCRSSLQ |
| Ga0371487_0152627_1035_1148 | 3300033982 | Peat Soil | MALRVKIRPDEAEPEGCGGSTVEGENEVWPDFHRNPKG |
| Ga0371487_0244022_2_124 | 3300033982 | Peat Soil | MKIGPGETESEGCGGSTVEDDNEAWPDLRRNPQGRGQFSPF |
| ⦗Top⦘ |