


| Basic Information | |
|---|---|
| Family ID | F058311 |
| Family Type | Metagenome |
| Number of Sequences | 135 |
| Average Sequence Length | 43 residues |
| Representative Sequence | SVTVEDRADLDRMAPGVADAIARGAAAFKPSYVVPSTPGALP |
| Number of Associated Samples | 109 |
| Number of Associated Scaffolds | 135 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 2.22 % |
| % of genes near scaffold ends (potentially truncated) | 97.78 % |
| % of genes from short scaffolds (< 2000 bps) | 86.67 % |
| Associated GOLD sequencing projects | 100 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.52 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (100.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (35.556 % of family members) |
| Environment Ontology (ENVO) | Unclassified (35.556 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (49.630 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 25.71% β-sheet: 0.00% Coil/Unstructured: 74.29% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.52 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 135 Family Scaffolds |
|---|---|---|
| PF10646 | Germane | 54.07 |
| PF01138 | RNase_PH | 10.37 |
| PF03725 | RNase_PH_C | 7.41 |
| PF01725 | Ham1p_like | 2.96 |
| PF00730 | HhH-GPD | 2.22 |
| PF01520 | Amidase_3 | 0.74 |
| PF02517 | Rce1-like | 0.74 |
| PF02738 | MoCoBD_1 | 0.74 |
| COG ID | Name | Functional Category | % Frequency in 135 Family Scaffolds |
|---|---|---|---|
| COG0689 | Ribonuclease PH | Translation, ribosomal structure and biogenesis [J] | 17.78 |
| COG1185 | Polyribonucleotide nucleotidyltransferase (polynucleotide phosphorylase) | Translation, ribosomal structure and biogenesis [J] | 17.78 |
| COG2123 | Exosome complex RNA-binding protein Rrp42, RNase PH superfamily | Intracellular trafficking, secretion, and vesicular transport [U] | 17.78 |
| COG0127 | Inosine/xanthosine triphosphate pyrophosphatase, all-alpha NTP-PPase family | Nucleotide transport and metabolism [F] | 2.96 |
| COG0122 | 3-methyladenine DNA glycosylase/8-oxoguanine DNA glycosylase | Replication, recombination and repair [L] | 2.22 |
| COG0177 | Endonuclease III | Replication, recombination and repair [L] | 2.22 |
| COG1059 | Thermostable 8-oxoguanine DNA glycosylase | Replication, recombination and repair [L] | 2.22 |
| COG1194 | Adenine-specific DNA glycosylase, acts on AG and A-oxoG pairs | Replication, recombination and repair [L] | 2.22 |
| COG2231 | 3-Methyladenine DNA glycosylase, HhH-GPD/Endo3 superfamily | Replication, recombination and repair [L] | 2.22 |
| COG0860 | N-acetylmuramoyl-L-alanine amidase | Cell wall/membrane/envelope biogenesis [M] | 0.74 |
| COG1266 | Membrane protease YdiL, CAAX protease family | Posttranslational modification, protein turnover, chaperones [O] | 0.74 |
| COG4449 | Predicted protease, Abi (CAAX) family | General function prediction only [R] | 0.74 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 100.00 % |
| Unclassified | root | N/A | 0.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000955|JGI1027J12803_106314270 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 771 | Open in IMG/M |
| 3300002908|JGI25382J43887_10133331 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1279 | Open in IMG/M |
| 3300002914|JGI25617J43924_10001589 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 5968 | Open in IMG/M |
| 3300003367|JGI26338J50219_1014598 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 666 | Open in IMG/M |
| 3300004114|Ga0062593_102658255 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 569 | Open in IMG/M |
| 3300005180|Ga0066685_10965088 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 565 | Open in IMG/M |
| 3300005343|Ga0070687_100478089 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 834 | Open in IMG/M |
| 3300005518|Ga0070699_100133380 | All Organisms → cellular organisms → Bacteria | 2190 | Open in IMG/M |
| 3300005541|Ga0070733_10452210 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 857 | Open in IMG/M |
| 3300005554|Ga0066661_10031774 | All Organisms → cellular organisms → Bacteria | 2920 | Open in IMG/M |
| 3300005555|Ga0066692_10667541 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 647 | Open in IMG/M |
| 3300005561|Ga0066699_10176683 | All Organisms → cellular organisms → Bacteria | 1475 | Open in IMG/M |
| 3300005566|Ga0066693_10382255 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 570 | Open in IMG/M |
| 3300005586|Ga0066691_10030906 | All Organisms → cellular organisms → Bacteria | 2764 | Open in IMG/M |
| 3300005598|Ga0066706_10874652 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 702 | Open in IMG/M |
| 3300005921|Ga0070766_11143467 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 538 | Open in IMG/M |
| 3300006050|Ga0075028_101062259 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 506 | Open in IMG/M |
| 3300006176|Ga0070765_100630033 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1012 | Open in IMG/M |
| 3300006176|Ga0070765_100953777 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 811 | Open in IMG/M |
| 3300006354|Ga0075021_10561769 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 726 | Open in IMG/M |
| 3300006791|Ga0066653_10633864 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 546 | Open in IMG/M |
| 3300006794|Ga0066658_10062300 | All Organisms → cellular organisms → Bacteria | 1641 | Open in IMG/M |
| 3300006796|Ga0066665_10334296 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1230 | Open in IMG/M |
| 3300006796|Ga0066665_10903195 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 684 | Open in IMG/M |
| 3300006893|Ga0073928_10947093 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 588 | Open in IMG/M |
| 3300007255|Ga0099791_10245134 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 849 | Open in IMG/M |
| 3300007258|Ga0099793_10001158 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 8191 | Open in IMG/M |
| 3300007258|Ga0099793_10258080 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 842 | Open in IMG/M |
| 3300007258|Ga0099793_10260488 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 838 | Open in IMG/M |
| 3300009012|Ga0066710_100011623 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 8984 | Open in IMG/M |
| 3300009012|Ga0066710_100265078 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2495 | Open in IMG/M |
| 3300009038|Ga0099829_10843684 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 761 | Open in IMG/M |
| 3300009088|Ga0099830_10359571 | All Organisms → cellular organisms → Bacteria | 1172 | Open in IMG/M |
| 3300009088|Ga0099830_10362808 | All Organisms → cellular organisms → Bacteria | 1167 | Open in IMG/M |
| 3300009088|Ga0099830_11137257 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 648 | Open in IMG/M |
| 3300009088|Ga0099830_11720798 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 523 | Open in IMG/M |
| 3300009089|Ga0099828_11201476 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 672 | Open in IMG/M |
| 3300009089|Ga0099828_11517610 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 591 | Open in IMG/M |
| 3300009143|Ga0099792_10679316 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 664 | Open in IMG/M |
| 3300010048|Ga0126373_12710686 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 553 | Open in IMG/M |
| 3300010337|Ga0134062_10063122 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1533 | Open in IMG/M |
| 3300010359|Ga0126376_12185727 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 598 | Open in IMG/M |
| 3300010361|Ga0126378_13198952 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 521 | Open in IMG/M |
| 3300010366|Ga0126379_10237813 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1783 | Open in IMG/M |
| 3300011120|Ga0150983_12699589 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1557 | Open in IMG/M |
| 3300011270|Ga0137391_10960361 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 697 | Open in IMG/M |
| 3300011271|Ga0137393_10373908 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1219 | Open in IMG/M |
| 3300012096|Ga0137389_10361753 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1236 | Open in IMG/M |
| 3300012096|Ga0137389_10572797 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 970 | Open in IMG/M |
| 3300012198|Ga0137364_10631882 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 807 | Open in IMG/M |
| 3300012200|Ga0137382_10926657 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 627 | Open in IMG/M |
| 3300012202|Ga0137363_10251243 | All Organisms → cellular organisms → Bacteria | 1437 | Open in IMG/M |
| 3300012202|Ga0137363_10369811 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1190 | Open in IMG/M |
| 3300012202|Ga0137363_11056940 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 690 | Open in IMG/M |
| 3300012202|Ga0137363_11674265 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 528 | Open in IMG/M |
| 3300012203|Ga0137399_10610761 | All Organisms → cellular organisms → Bacteria | 917 | Open in IMG/M |
| 3300012208|Ga0137376_10822235 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 799 | Open in IMG/M |
| 3300012285|Ga0137370_10299089 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 961 | Open in IMG/M |
| 3300012351|Ga0137386_11083016 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 566 | Open in IMG/M |
| 3300012356|Ga0137371_10206409 | All Organisms → cellular organisms → Bacteria | 1538 | Open in IMG/M |
| 3300012361|Ga0137360_10224717 | All Organisms → cellular organisms → Bacteria | 1531 | Open in IMG/M |
| 3300012362|Ga0137361_10653439 | All Organisms → cellular organisms → Bacteria | 962 | Open in IMG/M |
| 3300012582|Ga0137358_10549890 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 776 | Open in IMG/M |
| 3300012918|Ga0137396_10376321 | All Organisms → cellular organisms → Bacteria | 1052 | Open in IMG/M |
| 3300012922|Ga0137394_10507001 | All Organisms → cellular organisms → Bacteria | 1025 | Open in IMG/M |
| 3300012922|Ga0137394_10675419 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 870 | Open in IMG/M |
| 3300012922|Ga0137394_11431959 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 551 | Open in IMG/M |
| 3300012927|Ga0137416_10076807 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 2441 | Open in IMG/M |
| 3300012944|Ga0137410_11449836 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 598 | Open in IMG/M |
| 3300012964|Ga0153916_12656410 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 564 | Open in IMG/M |
| 3300013832|Ga0120132_1154914 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300014157|Ga0134078_10209188 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 800 | Open in IMG/M |
| 3300015052|Ga0137411_1035732 | All Organisms → cellular organisms → Bacteria | 1601 | Open in IMG/M |
| 3300015052|Ga0137411_1099509 | All Organisms → cellular organisms → Bacteria | 1564 | Open in IMG/M |
| 3300015052|Ga0137411_1099510 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1262 | Open in IMG/M |
| 3300015053|Ga0137405_1404015 | All Organisms → cellular organisms → Bacteria | 2108 | Open in IMG/M |
| 3300017936|Ga0187821_10048389 | All Organisms → cellular organisms → Bacteria | 1522 | Open in IMG/M |
| 3300017966|Ga0187776_10197746 | All Organisms → cellular organisms → Bacteria | 1262 | Open in IMG/M |
| 3300017972|Ga0187781_10144166 | All Organisms → cellular organisms → Bacteria | 1669 | Open in IMG/M |
| 3300018012|Ga0187810_10077115 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1287 | Open in IMG/M |
| 3300018085|Ga0187772_11414531 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 516 | Open in IMG/M |
| 3300018431|Ga0066655_10719334 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 676 | Open in IMG/M |
| 3300018482|Ga0066669_10048255 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2670 | Open in IMG/M |
| 3300020170|Ga0179594_10148141 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 867 | Open in IMG/M |
| 3300020582|Ga0210395_11263210 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 541 | Open in IMG/M |
| 3300021046|Ga0215015_10302174 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 553 | Open in IMG/M |
| 3300021046|Ga0215015_10685307 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 789 | Open in IMG/M |
| 3300021088|Ga0210404_10653219 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 599 | Open in IMG/M |
| 3300021168|Ga0210406_10424185 | All Organisms → cellular organisms → Bacteria | 1062 | Open in IMG/M |
| 3300021170|Ga0210400_10322472 | All Organisms → cellular organisms → Bacteria | 1270 | Open in IMG/M |
| 3300021178|Ga0210408_10042773 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3551 | Open in IMG/M |
| 3300021180|Ga0210396_10077924 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3011 | Open in IMG/M |
| 3300021180|Ga0210396_10934763 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 737 | Open in IMG/M |
| 3300021401|Ga0210393_11273303 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 590 | Open in IMG/M |
| 3300021406|Ga0210386_10166344 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1852 | Open in IMG/M |
| 3300021420|Ga0210394_10801376 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 823 | Open in IMG/M |
| 3300021432|Ga0210384_10223659 | All Organisms → cellular organisms → Bacteria | 1694 | Open in IMG/M |
| 3300021559|Ga0210409_11589752 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 530 | Open in IMG/M |
| 3300021560|Ga0126371_11028068 | All Organisms → cellular organisms → Bacteria | 965 | Open in IMG/M |
| 3300024330|Ga0137417_1334933 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4173 | Open in IMG/M |
| 3300024331|Ga0247668_1094993 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 603 | Open in IMG/M |
| 3300026325|Ga0209152_10272000 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 630 | Open in IMG/M |
| 3300026333|Ga0209158_1058817 | All Organisms → cellular organisms → Bacteria | 1546 | Open in IMG/M |
| 3300026342|Ga0209057_1248318 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 506 | Open in IMG/M |
| 3300026482|Ga0257172_1085202 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 581 | Open in IMG/M |
| 3300026528|Ga0209378_1059636 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1804 | Open in IMG/M |
| 3300026540|Ga0209376_1396706 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 516 | Open in IMG/M |
| 3300026550|Ga0209474_10530097 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 597 | Open in IMG/M |
| 3300026555|Ga0179593_1051332 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2005 | Open in IMG/M |
| 3300026555|Ga0179593_1104817 | All Organisms → cellular organisms → Bacteria | 1398 | Open in IMG/M |
| 3300026557|Ga0179587_10110908 | All Organisms → cellular organisms → Bacteria | 1671 | Open in IMG/M |
| 3300026557|Ga0179587_10752822 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 642 | Open in IMG/M |
| 3300027562|Ga0209735_1047579 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 916 | Open in IMG/M |
| 3300027795|Ga0209139_10024039 | All Organisms → cellular organisms → Bacteria | 2183 | Open in IMG/M |
| 3300027862|Ga0209701_10524548 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 640 | Open in IMG/M |
| 3300027869|Ga0209579_10471061 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 682 | Open in IMG/M |
| 3300027903|Ga0209488_11180274 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 517 | Open in IMG/M |
| 3300027908|Ga0209006_10541891 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 967 | Open in IMG/M |
| 3300027911|Ga0209698_11299745 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 533 | Open in IMG/M |
| 3300028906|Ga0308309_10786176 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 827 | Open in IMG/M |
| 3300028906|Ga0308309_11068894 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 698 | Open in IMG/M |
| 3300031231|Ga0170824_120806370 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 6953 | Open in IMG/M |
| 3300031708|Ga0310686_114609133 | All Organisms → cellular organisms → Bacteria | 1712 | Open in IMG/M |
| 3300031708|Ga0310686_114692865 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 711 | Open in IMG/M |
| 3300031720|Ga0307469_10547630 | All Organisms → cellular organisms → Bacteria | 1024 | Open in IMG/M |
| 3300031720|Ga0307469_12101427 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 549 | Open in IMG/M |
| 3300031753|Ga0307477_10182557 | All Organisms → cellular organisms → Bacteria | 1462 | Open in IMG/M |
| 3300031823|Ga0307478_10210706 | All Organisms → cellular organisms → Bacteria | 1567 | Open in IMG/M |
| 3300031823|Ga0307478_10888774 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 745 | Open in IMG/M |
| 3300031947|Ga0310909_11379998 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 564 | Open in IMG/M |
| 3300031962|Ga0307479_10197548 | All Organisms → cellular organisms → Bacteria | 1981 | Open in IMG/M |
| 3300031962|Ga0307479_11277790 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 695 | Open in IMG/M |
| 3300032160|Ga0311301_10043905 | All Organisms → cellular organisms → Bacteria | 10604 | Open in IMG/M |
| 3300032174|Ga0307470_10824426 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 721 | Open in IMG/M |
| 3300032782|Ga0335082_10081319 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 3254 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 35.56% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 13.33% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 11.11% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 5.93% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 4.44% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.70% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.70% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.22% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.22% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.22% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.96% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.48% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.48% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.48% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.48% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.74% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.74% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.74% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.74% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.74% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.74% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.74% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.74% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.74% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002908 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002914 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm | Environmental | Open in IMG/M |
| 3300003367 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM3 | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012964 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 4 metaG | Environmental | Open in IMG/M |
| 3300013832 | Permafrost microbial communities from Nunavut, Canada - A3_5cm_0M | Environmental | Open in IMG/M |
| 3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300015052 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300017936 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1 | Environmental | Open in IMG/M |
| 3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018012 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5 | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021046 | Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depth | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300024331 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK09 | Environmental | Open in IMG/M |
| 3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
| 3300026333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes) | Environmental | Open in IMG/M |
| 3300026342 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 (SPAdes) | Environmental | Open in IMG/M |
| 3300026482 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-16-B | Environmental | Open in IMG/M |
| 3300026528 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes) | Environmental | Open in IMG/M |
| 3300026540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes) | Environmental | Open in IMG/M |
| 3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
| 3300026555 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027562 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027795 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI1027J12803_1063142701 | 3300000955 | Soil | AVEISSIIVEDRAELDRMAPRVADAIARGAAAFKPSYVVANVPGTLP* |
| JGI25382J43887_101333311 | 3300002908 | Grasslands Soil | VEDRADLDRMAPGVADAIARGAAAFRPSYVVPSAPGALP* |
| JGI25617J43924_100015898 | 3300002914 | Grasslands Soil | AAPAIAVEISSVTVDDRADLDRMAPGVADAIARGVAAFKPSYVVPNTPGALP* |
| JGI26338J50219_10145981 | 3300003367 | Bog Forest Soil | PAIAVEISSVVVEDRADLDRMAPGVADAIATGIAQFRPSYVVASTAGGTP* |
| Ga0062593_1026582551 | 3300004114 | Soil | AIAVEVSSVAVDDRGQLDRMAPGVADAIARGASAFRPSYVVATNPGERP* |
| Ga0066685_109650881 | 3300005180 | Soil | VEDRADLDRMAPGVADAIARGAAAFKPSYVVPSAPGALP* |
| Ga0070687_1004780892 | 3300005343 | Switchgrass Rhizosphere | EVSSVAVDDRGQLDRMAPGVADAIARGASAFRPSYVVATNPGERP* |
| Ga0070699_1001333801 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | AIAVEISSVVVENRADLDRMAPGVADAIATGVATFRPSYVVPTPAGGTP* |
| Ga0070733_104522101 | 3300005541 | Surface Soil | AIAVEISSVVVEDRADLDRMVPGVADAIATGVAAFRPSYVLPTATGGTQ* |
| Ga0066661_100317741 | 3300005554 | Soil | VTVEDRADLDRMAPGVADAIARGAAAFRPSYVVPSAPGALP* |
| Ga0066692_106675411 | 3300005555 | Soil | AVEISSVTVEDRAELDRMAPGVADAIARGAAAFKPSYVVPNISAGRP* |
| Ga0066699_101766833 | 3300005561 | Soil | VTVEDRADLDRMAPGVADAIARGAAAFKPSYVVPSAPGALP* |
| Ga0066693_103822552 | 3300005566 | Soil | SVTVEDRADLDRMAPGVADAIARGAAAFKPSYVVPSTPGALP* |
| Ga0066691_100309061 | 3300005586 | Soil | SVTVENRADLDRMAPGVADAIARGVAAFKPSYVVASTSGAPR* |
| Ga0066706_108746521 | 3300005598 | Soil | VEVSSVTVEDRADLDRMAPGVADAIARGAAAFKPSYVVPSTPGALP* |
| Ga0070766_111434671 | 3300005921 | Soil | VENRADLDRMAPGVADAIATGAVAFRPSYVVPTTTGGTP* |
| Ga0075028_1010622591 | 3300006050 | Watersheds | IAVEISSVTVDDRADLDRMAPGLADAIARGAVAFKPSYIVPSTPGALP* |
| Ga0070765_1006300331 | 3300006176 | Soil | EDRADLDRMAPGVADSIATGVAAFRPSYVVATTGGTP* |
| Ga0070765_1009537771 | 3300006176 | Soil | APAIAVEISSVVVENRADLDRMAPGVADAIATGVASFRPSYVVPTTAGAAP* |
| Ga0075021_105617691 | 3300006354 | Watersheds | RGALDRMAPGVADAIARGATAFRPSYVVATNPGERP* |
| Ga0066653_106338641 | 3300006791 | Soil | VEVSSVTVEDRADLDRMAPGVADAIARGSAAFKPSYVVPSTPGALP* |
| Ga0066658_100623003 | 3300006794 | Soil | SSVTVEDRADLDRMAPGVADAIARGATTFKPSYVIPTSPGALP* |
| Ga0066665_103342963 | 3300006796 | Soil | EVSSVTVEDRADLDRMAPGVADAIARGTAAFKPSYVVPSAPGALP* |
| Ga0066665_109031951 | 3300006796 | Soil | SVTVEDRADLDRMAPGVADAIVRGAAAFKPSYVVPTVTGGLR* |
| Ga0073928_109470932 | 3300006893 | Iron-Sulfur Acid Spring | VSVDDRGDLDRMAPGVADAIARGASAFRPAYVVPANPGERP* |
| Ga0099791_102451341 | 3300007255 | Vadose Zone Soil | APAIAVEISSIVVEDRAELDHMAPGVADAIAHGAAAFKPSYVVANVPGTLP* |
| Ga0099793_1000115810 | 3300007258 | Vadose Zone Soil | VEDRAELDRMAPGVADAIARGAAAFKPSYVVPTTPGALR* |
| Ga0099793_102580801 | 3300007258 | Vadose Zone Soil | TVEDRADLDRMAPGVADAIARGAAAFKPSYVVPNTRGALP* |
| Ga0099793_102604882 | 3300007258 | Vadose Zone Soil | VTVEDRADLDRMAPGVADAIARGAAAFKPSYVVPNTRGALP* |
| Ga0066710_1000116231 | 3300009012 | Grasslands Soil | AIAVEVSSVTVEDRADLDRMAPGVADAIARGAAAFRPSYVVPSAPGALP |
| Ga0066710_1002650785 | 3300009012 | Grasslands Soil | VEDRADLDRMAPGVADAIARGAAAFKPSYVVPSTPGALP |
| Ga0099829_108436842 | 3300009038 | Vadose Zone Soil | TVENRADLDRMAPGVADAIARGAAAFKPSYVVPTVTGGLR* |
| Ga0099830_103595713 | 3300009088 | Vadose Zone Soil | VTVEDRADLDRMAPGVADAIARGAAAFKPSYVVPNTPGAMP* |
| Ga0099830_103628081 | 3300009088 | Vadose Zone Soil | AVEISSVTVEDRADLDRMAPGVADAIARGAAAFKPSYVVPNTPGALP* |
| Ga0099830_111372571 | 3300009088 | Vadose Zone Soil | SSVTVNDRADLDRMAPVVAEAITRGVTAFRPSYVVPSTPGALP* |
| Ga0099830_117207982 | 3300009088 | Vadose Zone Soil | EISSVTVEDRADLDRMAPGVADAIARGVAAFKPSYVVPTTPGALP* |
| Ga0099828_112014761 | 3300009089 | Vadose Zone Soil | RAQIDHMAPGVADAIARGAAAFRPTYVVPANPGERP* |
| Ga0099828_115176102 | 3300009089 | Vadose Zone Soil | DRAQLDRMAPGVADAIARGAAAFKPTYVVPNVPGGLP* |
| Ga0099792_106793161 | 3300009143 | Vadose Zone Soil | SIVVEDRAELDRMGPGVADAIARGAAAFKPSYVVANVPGTLP* |
| Ga0126373_127106861 | 3300010048 | Tropical Forest Soil | TAAPAIAVEVSSVTVENRNDLDRMAPGVADAVAKGVAAFRPIYVVAGTVGVRP* |
| Ga0134062_100631223 | 3300010337 | Grasslands Soil | DRAELDHMVPGVADAIARGVAAFKPLYAMALPSGALP* |
| Ga0126376_121857272 | 3300010359 | Tropical Forest Soil | AVEISSVTVNDRADLDRMAPGVAEAIARGVAAFKPSYVVPNVPGVLP* |
| Ga0126378_131989522 | 3300010361 | Tropical Forest Soil | AIAVEVSSVIVENRNDLDRMAPGVADAIAKGVAAFRPSYVVAGTVGARP* |
| Ga0126379_102378131 | 3300010366 | Tropical Forest Soil | NDRADLDRMAAGVADAIARGTVAFKPSYVISNTPGALL* |
| Ga0150983_126995893 | 3300011120 | Forest Soil | VNDRADLDRMAPGVADAIARGVAAFKPSYVVPNTTGALP* |
| Ga0137391_109603611 | 3300011270 | Vadose Zone Soil | VTVEDRADLDRMAPGVADAIARGAAAFKPSYVVPNTPGALP* |
| Ga0137393_103739081 | 3300011271 | Vadose Zone Soil | ISSVTVENRADLDRMAPGVADAIARGAAAFKPSYVVSNTPGALP* |
| Ga0137389_103617531 | 3300012096 | Vadose Zone Soil | APAIAVEISSVTVEDRADLDRMAPGVADAIARGAAAFKPSYVVPNTRGALP* |
| Ga0137389_105727971 | 3300012096 | Vadose Zone Soil | ELDRMAPGVADAIARGAAAFKPSYIVPKTPGALP* |
| Ga0137364_106318822 | 3300012198 | Vadose Zone Soil | EVSSVTVEDRADLDRMAPGVADAIARGTAAFKPSYVVPSTPGALP* |
| Ga0137382_109266571 | 3300012200 | Vadose Zone Soil | DLDRMAPGVADAIARGAAAFKPSYVVPNTRGALP* |
| Ga0137363_102512433 | 3300012202 | Vadose Zone Soil | SVTVEDRADLDRMAPGVADAIARGAAAFKPSYVVPNTRGALP* |
| Ga0137363_103698111 | 3300012202 | Vadose Zone Soil | IAVEISSVTVEDRADLDHMAPGVADAIARGAAAFKPSYVVPTVTGGLR* |
| Ga0137363_110569401 | 3300012202 | Vadose Zone Soil | DRAQLDHMAPGVAGAIARGAAAFRPTYVVPANPGERP* |
| Ga0137363_116742651 | 3300012202 | Vadose Zone Soil | AELDHMAPGVADAIARGAAAFRPSYVVPANPGERP* |
| Ga0137399_106107611 | 3300012203 | Vadose Zone Soil | RADLDRMAPEVADAIARGAAAFKPSYVVPTASGALP* |
| Ga0137376_108222352 | 3300012208 | Vadose Zone Soil | VEISSVTVEDRTDLDRMAPGVADAIARGAAAFKPSYVVPNTRGALP* |
| Ga0137370_102990893 | 3300012285 | Vadose Zone Soil | DLDHMAPGVADAVARGVVAFKPSYVMASTGGALP* |
| Ga0137386_110830161 | 3300012351 | Vadose Zone Soil | ISSVTVDDRADLDRMAPGVADAIARGAAAFKPSYVVPNTPGALP* |
| Ga0137371_102064093 | 3300012356 | Vadose Zone Soil | TVDDRAQLDRMAPGVADAIARGTAAFKPTYIVPNVPGGLP* |
| Ga0137360_102247173 | 3300012361 | Vadose Zone Soil | VSSVTVEDRADLDRMAPGVADAIARGAAAFRPSYVVPTTPGALP* |
| Ga0137361_106534391 | 3300012362 | Vadose Zone Soil | PAIAVEISSVTVEDRADLDRMAPGVADAIARGAAAFKPTYVVPNSPGALP* |
| Ga0137358_105498902 | 3300012582 | Vadose Zone Soil | VEDRADLDRMAPGVADAIARGAAAFKPSYVVPNTCGALP* |
| Ga0137396_103763211 | 3300012918 | Vadose Zone Soil | VEISSVTVENRADLDRMAPGVADAIARGAAAFKPSYVVPTASGALP* |
| Ga0137394_105070011 | 3300012922 | Vadose Zone Soil | SVTVEDRAQLDHMAPGVADAVARGAAAFRPTYVVPANPGERP* |
| Ga0137394_106754192 | 3300012922 | Vadose Zone Soil | IVVEDRAELDHMAPGVADAIAHGAAAFKPSYVVANVPGTLP* |
| Ga0137394_114319591 | 3300012922 | Vadose Zone Soil | ISSIVVEDRAELDHMAPGVADAIAHGAAAFKPSYVVANVPGTLP* |
| Ga0137416_100768075 | 3300012927 | Vadose Zone Soil | DRADLDRMAPGVADAIARGAAAFRPSYVVPTTPGTLP* |
| Ga0137410_114498361 | 3300012944 | Vadose Zone Soil | SIVVEDRAELDHMAPGVADAIAHGAAAFKPSYVVANVPGTLP* |
| Ga0153916_126564101 | 3300012964 | Freshwater Wetlands | IAVEISSVTVNDRADLDRMAQGVGEAIAGGAAAFKPSYVVPSVAGALP* |
| Ga0120132_11549141 | 3300013832 | Permafrost | SISVGDPGELDRMAPGIADAIARGVAAFKPSYLIPAIDGTPQ* |
| Ga0134078_102091882 | 3300014157 | Grasslands Soil | ADLDRMAPGVADAIARGAAAFKPSYVVPNTRGALP* |
| Ga0137411_10357321 | 3300015052 | Vadose Zone Soil | SSIVVEDRVVEDRLELDRMAPGVADAIARGAAAFKPSYVVPNVPGALP* |
| Ga0137411_10995091 | 3300015052 | Vadose Zone Soil | RSPVVTVEDRADLDRMAPGVADAIARGAAAFKPSYVVAKTPGALP* |
| Ga0137411_10995103 | 3300015052 | Vadose Zone Soil | ISSVTVEDRADLDRMAPGVADAIARGAAAFKPSYVVAKTPGALP* |
| Ga0137405_14040151 | 3300015053 | Vadose Zone Soil | EISSVTVENRNDLDRMAPGVADAIAKGVAAFKPSYVVAERLG* |
| Ga0187821_100483893 | 3300017936 | Freshwater Sediment | VENRAALDQMAPGVADAIATGVAAFRPSYVVPTATGGTP |
| Ga0187776_101977463 | 3300017966 | Tropical Peatland | ADLDRMASGVADAIARGVTGFKPLYVIPSVTGAQP |
| Ga0187781_101441661 | 3300017972 | Tropical Peatland | IAVEISSVVVNDRTDLDRMAPGVADAIARGVAAFKPMYVVPSLAGVQP |
| Ga0187810_100771151 | 3300018012 | Freshwater Sediment | TAAPAIAVEVSSVTVDDRATLERMAPGVADAIARGVAAFRPVYEASPAAGALP |
| Ga0187772_114145311 | 3300018085 | Tropical Peatland | DLDRMAPGVADAIATGVAMFRPSYVVPVNSSGGTP |
| Ga0066655_107193341 | 3300018431 | Grasslands Soil | VEDRADLDRMAPGVADAIARGTAAFKPSYVVPSTPGALP |
| Ga0066669_100482551 | 3300018482 | Grasslands Soil | VTVEDRADLDRMAPGVADAIARGATTFKPSYVIPSSPGALP |
| Ga0179594_101481412 | 3300020170 | Vadose Zone Soil | APAIAVEISSIVVEDRAELDRMAPGVADAIARGAAAFKPSYVVANVPGTLP |
| Ga0210395_112632101 | 3300020582 | Soil | AVEVSSVAVDDRAELDRMAPGVADAIARAVAAFKPTYVVANATGAQP |
| Ga0215015_103021742 | 3300021046 | Soil | VEDRADLDRMAPGVADAIARGAAAFKPSYVVPSAPGALP |
| Ga0215015_106853072 | 3300021046 | Soil | AELDRMAPGVAEAITRGVTAFRPSYVVPSTPGGLP |
| Ga0210404_106532192 | 3300021088 | Soil | VEISSVTVENRNDLDRMAPGVADAIAKGVAAFKPSYVVAGAAGVRR |
| Ga0210406_104241853 | 3300021168 | Soil | PAIAVEISSVVVEDRADLDRMAPGVADSIATGVAAFRPSYVVPTTGGTP |
| Ga0210400_103224721 | 3300021170 | Soil | IAVEVSSVTVENRNDLDRMAPGVADAIAKGVAAFKPSYVVAGTAGVKP |
| Ga0210408_100427736 | 3300021178 | Soil | PAIAVEISSIIVEDRAELDRMGPGIADAIARGAAAFKPSYIVPSAPGALP |
| Ga0210396_100779245 | 3300021180 | Soil | ISSVVVENRADLDRMAPGVADAIPTGVASFRPSYVVPATSGGTP |
| Ga0210396_109347632 | 3300021180 | Soil | VEISSVAVQDRAEIDRMAPGVADAIARGVAAFKPSYVIPAGPGARP |
| Ga0210393_112733032 | 3300021401 | Soil | AIAVEISSVSVEDRAELDRMIPGVADAIARGVAEFKPSYVVATPPGGQP |
| Ga0210386_101663441 | 3300021406 | Soil | IAVEISSVVVEDRADLDRMAPGVAGAIATGVAAFRPSYVVPTAGGAP |
| Ga0210394_108013761 | 3300021420 | Soil | AVEVSSVSVDDHAELDRMAPGVADAIARGVAAFKPTYVVANATGAQQ |
| Ga0210384_102236591 | 3300021432 | Soil | PAIAVEVSSVTVEDRAQLDHMAPGVADAIARGAAAFRPSYVVPVNPGERP |
| Ga0210409_115897521 | 3300021559 | Soil | VEDRANLDRMAPGVADAIARGAAAFKPSYVVPNSPGALP |
| Ga0126371_110280683 | 3300021560 | Tropical Forest Soil | VIVENRNDLDRMGPGVADAIAKGAAAFRPLYVVAGPAGAQR |
| Ga0137417_13349336 | 3300024330 | Vadose Zone Soil | VTMEDRADLDRMAPGVADAIARGAAAFKPSYVVPSTPGALP |
| Ga0247668_10949932 | 3300024331 | Soil | RGDLNKMMPGVADAIARGLAAFRPSYVVPGDAGAQP |
| Ga0209152_102720002 | 3300026325 | Soil | VEDRADLDRMAPGVADAIARGAAAFKPAYVVPNSPGALP |
| Ga0209158_10588173 | 3300026333 | Soil | AAPAIAVEISSVTVENRADLDRMAPGVADAIARGVAAFKPSYVVASTSGAPR |
| Ga0209057_12483181 | 3300026342 | Soil | AVEVSSVVVNDRAELDHMVPGVADAIARGVAAFKPLYAMALPSGALP |
| Ga0257172_10852021 | 3300026482 | Soil | VEDRADLDRVAPGVADAIARGAAAFKPSYVVPNSPGALP |
| Ga0209378_10596364 | 3300026528 | Soil | DRTDLDRMAPGVADAIARGAAAFKPSYVVPNTRGALP |
| Ga0209376_13967061 | 3300026540 | Soil | DRADLDRMAPGVADAIARGAAAFKPSYVVPSAPGALP |
| Ga0209474_105300971 | 3300026550 | Soil | PAIAVEISSVTVEDRADLDRMAPGVADAIARGAAAFKPSYVVPNTRGALP |
| Ga0179593_10513322 | 3300026555 | Vadose Zone Soil | VTVEDRADLDRMAPGVADAIARGAAAFKPSYVVAKTPGALP |
| Ga0179593_11048173 | 3300026555 | Vadose Zone Soil | VEDRADLDRMAPGVADAIARGAAAFRPSYVVPTTPGALP |
| Ga0179587_101109081 | 3300026557 | Vadose Zone Soil | ANLDRMAPGVADAIARGTAAFKPSYVVPNSPGALP |
| Ga0179587_107528221 | 3300026557 | Vadose Zone Soil | ISSVTVEDRAELDRMAPGVADAIARGAAAFRPSYVVAGSPGALP |
| Ga0209735_10475792 | 3300027562 | Forest Soil | PAIAVEVSSVTVEDRAELDHMAPGVADAIARGAAAFRPSYIVPTNPGERP |
| Ga0209139_100240394 | 3300027795 | Bog Forest Soil | AIAVEISSVVVDDRADLDRMAPGVADAIATGIASFRPSYVIATTAGGTP |
| Ga0209701_105245482 | 3300027862 | Vadose Zone Soil | TVNDRADLDRMAPVVAEAITRGVTAFRPSYVVPSTPGALP |
| Ga0209579_104710611 | 3300027869 | Surface Soil | PAIAVEISSVVVEDRADLDRMAPGVADAIAGGVAAFRPSYVVPTMGGGTP |
| Ga0209488_111802741 | 3300027903 | Vadose Zone Soil | AIAVEISSVTVEERAELDHMAPGVADAIARGAAAFRPSYVVPANPGERP |
| Ga0209006_105418913 | 3300027908 | Forest Soil | RADLDRMAPGIADAIATGVAAFRPSYVVPTTTGGTP |
| Ga0209698_112997452 | 3300027911 | Watersheds | VEVSSVTVEDRAALDRMAPGVADAIARGVAAFRPVYEASPAAGALP |
| Ga0308309_107861761 | 3300028906 | Soil | APAIAVEISSVVVENRADLDRMAPGVADAIATGVASFRPSYVVPTTAGAAP |
| Ga0308309_110688941 | 3300028906 | Soil | AIAVEISSVVIEDRADLDRMAPGVADSIATGVAAFRPSYVVATTGGTP |
| Ga0170824_1208063708 | 3300031231 | Forest Soil | ELASVSVQDRADLDRMMPGVGDAIARGVAEFRPSYVVPGAAGAHP |
| Ga0310686_1146091333 | 3300031708 | Soil | VVVEDRADLDRMAPGVADAIATGIAAFRPSYVVPTNGGTP |
| Ga0310686_1146928652 | 3300031708 | Soil | AAPAIAVEISSVVVENRADLDRMGPGVADAIATGVAAFRPSYVVPTTSGGTP |
| Ga0307469_105476301 | 3300031720 | Hardwood Forest Soil | RAELDRMAPGVADAIAHGVAAFKPSYIVPNSAGALP |
| Ga0307469_121014271 | 3300031720 | Hardwood Forest Soil | SIIVEDRAELDRMGPGIADAIARGAAAFKPSYIVPGAPGALP |
| Ga0307477_101825571 | 3300031753 | Hardwood Forest Soil | SVTVDDRAALERMAPGVADAIARGVAAFRPIYEASPAAGALP |
| Ga0307478_102107063 | 3300031823 | Hardwood Forest Soil | VVEDRVDLDRMAPGVADAIATGVAAFRPSYVVPTTAGGTP |
| Ga0307478_108887741 | 3300031823 | Hardwood Forest Soil | DRADLDRMAPGVADAIAGGVAAFRPSYVVPTMGGGTP |
| Ga0310909_113799981 | 3300031947 | Soil | TVENRNDLDRMAPGVAEAIAKGVAAFRPSYVVAGTIGARP |
| Ga0307479_101975481 | 3300031962 | Hardwood Forest Soil | IAVEVSSVTVEDRAQLDHMAPGVADAIARGAAAFRPSYVVPVNPGERP |
| Ga0307479_112777901 | 3300031962 | Hardwood Forest Soil | AIAVEVSSVAVDDRGQLDRMAPGVADAIARGASAFRPSYVVATNPGERP |
| Ga0311301_100439055 | 3300032160 | Peatlands Soil | VTVEDRADLDRMAPGVADAIARGAAAFKPSYVVPAASGALP |
| Ga0307470_108244262 | 3300032174 | Hardwood Forest Soil | EVSSVTVEDRAELDHMAPGVADAIARGAAAFRPSYIVPTNPGERP |
| Ga0335082_100813196 | 3300032782 | Soil | AVEISSVSVQNRADLESMVPGVADAIARGVAAFRPSYVLPSSPVLGGSAQP |
| ⦗Top⦘ |