


| Basic Information | |
|---|---|
| Family ID | F058294 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 135 |
| Average Sequence Length | 41 residues |
| Representative Sequence | MTKHDEARRAFLLGAAVGAGAVAGATLVPDALAQTHE |
| Number of Associated Samples | 119 |
| Number of Associated Scaffolds | 135 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 98.51 % |
| % of genes near scaffold ends (potentially truncated) | 99.26 % |
| % of genes from short scaffolds (< 2000 bps) | 94.07 % |
| Associated GOLD sequencing projects | 115 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.39 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (65.185 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (37.037 % of family members) |
| Environment Ontology (ENVO) | Unclassified (42.963 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (40.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 52.31% β-sheet: 0.00% Coil/Unstructured: 47.69% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.39 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 135 Family Scaffolds |
|---|---|---|
| PF03401 | TctC | 11.11 |
| PF02738 | MoCoBD_1 | 11.11 |
| PF00687 | Ribosomal_L1 | 1.48 |
| PF02826 | 2-Hacid_dh_C | 1.48 |
| PF03992 | ABM | 1.48 |
| PF02668 | TauD | 1.48 |
| PF00563 | EAL | 1.48 |
| PF01977 | UbiD | 1.48 |
| PF07690 | MFS_1 | 1.48 |
| PF05685 | Uma2 | 1.48 |
| PF00106 | adh_short | 0.74 |
| PF00582 | Usp | 0.74 |
| PF13410 | GST_C_2 | 0.74 |
| PF00583 | Acetyltransf_1 | 0.74 |
| PF02768 | DNA_pol3_beta_3 | 0.74 |
| PF01593 | Amino_oxidase | 0.74 |
| PF02163 | Peptidase_M50 | 0.74 |
| PF07992 | Pyr_redox_2 | 0.74 |
| PF00589 | Phage_integrase | 0.74 |
| PF01135 | PCMT | 0.74 |
| PF13460 | NAD_binding_10 | 0.74 |
| PF00296 | Bac_luciferase | 0.74 |
| PF07521 | RMMBL | 0.74 |
| PF13450 | NAD_binding_8 | 0.74 |
| PF03929 | PepSY_TM | 0.74 |
| PF13505 | OMP_b-brl | 0.74 |
| PF13442 | Cytochrome_CBB3 | 0.74 |
| COG ID | Name | Functional Category | % Frequency in 135 Family Scaffolds |
|---|---|---|---|
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 11.11 |
| COG0043 | 3-polyprenyl-4-hydroxybenzoate decarboxylase | Coenzyme transport and metabolism [H] | 1.48 |
| COG0081 | Ribosomal protein L1 | Translation, ribosomal structure and biogenesis [J] | 1.48 |
| COG2175 | Taurine dioxygenase, alpha-ketoglutarate-dependent | Secondary metabolites biosynthesis, transport and catabolism [Q] | 1.48 |
| COG2200 | EAL domain, c-di-GMP-specific phosphodiesterase class I (or its enzymatically inactive variant) | Signal transduction mechanisms [T] | 1.48 |
| COG3434 | c-di-GMP phosphodiesterase YuxH/PdeH, contains EAL and HDOD domains | Signal transduction mechanisms [T] | 1.48 |
| COG4636 | Endonuclease, Uma2 family (restriction endonuclease fold) | General function prediction only [R] | 1.48 |
| COG4943 | Redox-sensing c-di-GMP phosphodiesterase, contains CSS-motif and EAL domains | Signal transduction mechanisms [T] | 1.48 |
| COG5001 | Cyclic di-GMP metabolism protein, combines GGDEF and EAL domains with a 6TM membrane domain | Signal transduction mechanisms [T] | 1.48 |
| COG0592 | DNA polymerase III sliding clamp (beta) subunit, PCNA homolog | Replication, recombination and repair [L] | 0.74 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.74 |
| COG2226 | Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenG | Coenzyme transport and metabolism [H] | 0.74 |
| COG2518 | Protein-L-isoaspartate O-methyltransferase | Posttranslational modification, protein turnover, chaperones [O] | 0.74 |
| COG2519 | tRNA A58 N-methylase Trm61 | Translation, ribosomal structure and biogenesis [J] | 0.74 |
| COG3182 | PepSY-associated TM region | Function unknown [S] | 0.74 |
| COG3295 | Uncharacterized conserved protein | Function unknown [S] | 0.74 |
| COG4122 | tRNA 5-hydroxyU34 O-methylase TrmR/YrrM | Translation, ribosomal structure and biogenesis [J] | 0.74 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 65.93 % |
| Unclassified | root | N/A | 34.07 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2035918004|FACENC_F56XM5W01DHD6G | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 518 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_103916537 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 528 | Open in IMG/M |
| 3300000580|AF_2010_repII_A01DRAFT_1039078 | All Organisms → cellular organisms → Bacteria | 736 | Open in IMG/M |
| 3300005181|Ga0066678_10766583 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 640 | Open in IMG/M |
| 3300005332|Ga0066388_101711155 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1113 | Open in IMG/M |
| 3300005332|Ga0066388_102543138 | Not Available | 931 | Open in IMG/M |
| 3300005518|Ga0070699_100258974 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1556 | Open in IMG/M |
| 3300005542|Ga0070732_10165222 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1320 | Open in IMG/M |
| 3300005546|Ga0070696_101318492 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales → Actinomycetaceae → Actinomyces → unclassified Actinomyces → Actinomyces sp. oral taxon 175 | 613 | Open in IMG/M |
| 3300005713|Ga0066905_100432020 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1077 | Open in IMG/M |
| 3300005713|Ga0066905_101230487 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 671 | Open in IMG/M |
| 3300005764|Ga0066903_104121571 | Not Available | 778 | Open in IMG/M |
| 3300005921|Ga0070766_11077260 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
| 3300006031|Ga0066651_10640132 | Not Available | 567 | Open in IMG/M |
| 3300006034|Ga0066656_10364854 | Not Available | 933 | Open in IMG/M |
| 3300006049|Ga0075417_10380095 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 696 | Open in IMG/M |
| 3300006051|Ga0075364_10965452 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
| 3300006057|Ga0075026_100672348 | All Organisms → cellular organisms → Bacteria | 616 | Open in IMG/M |
| 3300006176|Ga0070765_102113802 | Not Available | 526 | Open in IMG/M |
| 3300006578|Ga0074059_12010974 | All Organisms → cellular organisms → Bacteria | 1033 | Open in IMG/M |
| 3300006605|Ga0074057_12338444 | All Organisms → cellular organisms → Bacteria | 1076 | Open in IMG/M |
| 3300006844|Ga0075428_101187031 | All Organisms → cellular organisms → Bacteria | 805 | Open in IMG/M |
| 3300009012|Ga0066710_101584177 | All Organisms → cellular organisms → Bacteria | 1005 | Open in IMG/M |
| 3300009792|Ga0126374_10432498 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 929 | Open in IMG/M |
| 3300010043|Ga0126380_11819847 | Not Available | 551 | Open in IMG/M |
| 3300010047|Ga0126382_12475701 | Not Available | 506 | Open in IMG/M |
| 3300010359|Ga0126376_13039935 | Not Available | 518 | Open in IMG/M |
| 3300010359|Ga0126376_13164148 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300010361|Ga0126378_13379373 | Not Available | 507 | Open in IMG/M |
| 3300010362|Ga0126377_11606941 | Not Available | 725 | Open in IMG/M |
| 3300010362|Ga0126377_12705959 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
| 3300010398|Ga0126383_12047279 | Not Available | 660 | Open in IMG/M |
| 3300012096|Ga0137389_10930590 | All Organisms → cellular organisms → Bacteria | 746 | Open in IMG/M |
| 3300012205|Ga0137362_11594105 | Not Available | 540 | Open in IMG/M |
| 3300012899|Ga0157299_10292405 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300012961|Ga0164302_11417145 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 568 | Open in IMG/M |
| 3300012984|Ga0164309_11933426 | Not Available | 506 | Open in IMG/M |
| 3300015358|Ga0134089_10258635 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 713 | Open in IMG/M |
| 3300015372|Ga0132256_102962178 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium | 571 | Open in IMG/M |
| 3300015374|Ga0132255_103587801 | Not Available | 660 | Open in IMG/M |
| 3300016357|Ga0182032_10170697 | All Organisms → cellular organisms → Bacteria | 1629 | Open in IMG/M |
| 3300016371|Ga0182034_11423296 | Not Available | 606 | Open in IMG/M |
| 3300016404|Ga0182037_11932891 | Not Available | 529 | Open in IMG/M |
| 3300016422|Ga0182039_11338318 | Not Available | 649 | Open in IMG/M |
| 3300017792|Ga0163161_10038740 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 3420 | Open in IMG/M |
| 3300017927|Ga0187824_10302160 | Not Available | 567 | Open in IMG/M |
| 3300017930|Ga0187825_10041278 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1558 | Open in IMG/M |
| 3300017975|Ga0187782_10518222 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 913 | Open in IMG/M |
| 3300017993|Ga0187823_10110653 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 831 | Open in IMG/M |
| 3300017993|Ga0187823_10160123 | Not Available | 716 | Open in IMG/M |
| 3300018066|Ga0184617_1112664 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 771 | Open in IMG/M |
| 3300018073|Ga0184624_10161251 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 990 | Open in IMG/M |
| 3300018081|Ga0184625_10387883 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 722 | Open in IMG/M |
| 3300018468|Ga0066662_10283951 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1378 | Open in IMG/M |
| 3300020005|Ga0193697_1017907 | All Organisms → cellular organisms → Bacteria | 1746 | Open in IMG/M |
| 3300021180|Ga0210396_10389992 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1225 | Open in IMG/M |
| 3300021407|Ga0210383_10330946 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1312 | Open in IMG/M |
| 3300021475|Ga0210392_10965968 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 638 | Open in IMG/M |
| 3300021477|Ga0210398_10913317 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 703 | Open in IMG/M |
| 3300021560|Ga0126371_13190648 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 554 | Open in IMG/M |
| 3300025912|Ga0207707_10415081 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → Gemmatimonas aurantiaca | 1155 | Open in IMG/M |
| 3300025914|Ga0207671_11558547 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 509 | Open in IMG/M |
| 3300025920|Ga0207649_10148757 | All Organisms → cellular organisms → Bacteria | 1610 | Open in IMG/M |
| 3300025939|Ga0207665_10555682 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 892 | Open in IMG/M |
| 3300026095|Ga0207676_11827591 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
| 3300026116|Ga0207674_10551070 | All Organisms → cellular organisms → Bacteria | 1114 | Open in IMG/M |
| 3300026557|Ga0179587_10025391 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3235 | Open in IMG/M |
| 3300026557|Ga0179587_10661957 | Not Available | 688 | Open in IMG/M |
| 3300027490|Ga0209899_1084806 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 620 | Open in IMG/M |
| 3300027768|Ga0209772_10062258 | All Organisms → cellular organisms → Bacteria | 1120 | Open in IMG/M |
| 3300027889|Ga0209380_10755580 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 554 | Open in IMG/M |
| 3300027894|Ga0209068_10863010 | Not Available | 535 | Open in IMG/M |
| 3300028717|Ga0307298_10220921 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 560 | Open in IMG/M |
| 3300028717|Ga0307298_10250080 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 526 | Open in IMG/M |
| 3300028906|Ga0308309_11261758 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 636 | Open in IMG/M |
| 3300030007|Ga0311338_10020193 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 9655 | Open in IMG/M |
| 3300031198|Ga0307500_10017750 | Not Available | 1507 | Open in IMG/M |
| 3300031366|Ga0307506_10163537 | All Organisms → cellular organisms → Bacteria | 791 | Open in IMG/M |
| 3300031543|Ga0318516_10097740 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1657 | Open in IMG/M |
| 3300031544|Ga0318534_10144270 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1373 | Open in IMG/M |
| 3300031545|Ga0318541_10010061 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4220 | Open in IMG/M |
| 3300031545|Ga0318541_10658036 | Not Available | 585 | Open in IMG/M |
| 3300031546|Ga0318538_10279974 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 898 | Open in IMG/M |
| 3300031572|Ga0318515_10311175 | All Organisms → cellular organisms → Bacteria | 844 | Open in IMG/M |
| 3300031668|Ga0318542_10200962 | Not Available | 1005 | Open in IMG/M |
| 3300031680|Ga0318574_10231464 | All Organisms → cellular organisms → Bacteria | 1066 | Open in IMG/M |
| 3300031682|Ga0318560_10460832 | Not Available | 688 | Open in IMG/M |
| 3300031723|Ga0318493_10341116 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 813 | Open in IMG/M |
| 3300031748|Ga0318492_10671706 | Not Available | 554 | Open in IMG/M |
| 3300031751|Ga0318494_10735657 | Not Available | 578 | Open in IMG/M |
| 3300031763|Ga0318537_10093992 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1108 | Open in IMG/M |
| 3300031771|Ga0318546_11053622 | Not Available | 572 | Open in IMG/M |
| 3300031780|Ga0318508_1006742 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2455 | Open in IMG/M |
| 3300031780|Ga0318508_1125703 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 721 | Open in IMG/M |
| 3300031781|Ga0318547_10402797 | All Organisms → cellular organisms → Bacteria | 840 | Open in IMG/M |
| 3300031781|Ga0318547_10547507 | All Organisms → cellular organisms → Bacteria | 716 | Open in IMG/M |
| 3300031796|Ga0318576_10444234 | Not Available | 612 | Open in IMG/M |
| 3300031833|Ga0310917_10334290 | Not Available | 1027 | Open in IMG/M |
| 3300031833|Ga0310917_10757297 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 656 | Open in IMG/M |
| 3300031835|Ga0318517_10277181 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 757 | Open in IMG/M |
| 3300031845|Ga0318511_10123403 | Not Available | 1117 | Open in IMG/M |
| 3300031846|Ga0318512_10048170 | All Organisms → cellular organisms → Bacteria | 1893 | Open in IMG/M |
| 3300031846|Ga0318512_10632754 | Not Available | 546 | Open in IMG/M |
| 3300031859|Ga0318527_10098591 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1197 | Open in IMG/M |
| 3300031879|Ga0306919_11008119 | Not Available | 636 | Open in IMG/M |
| 3300031880|Ga0318544_10273215 | Not Available | 655 | Open in IMG/M |
| 3300031890|Ga0306925_10325164 | All Organisms → cellular organisms → Bacteria | 1653 | Open in IMG/M |
| 3300031897|Ga0318520_10326197 | Not Available | 928 | Open in IMG/M |
| 3300031910|Ga0306923_11187200 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 816 | Open in IMG/M |
| 3300031912|Ga0306921_11030698 | All Organisms → cellular organisms → Bacteria | 926 | Open in IMG/M |
| 3300031912|Ga0306921_12325001 | Not Available | 561 | Open in IMG/M |
| 3300031913|Ga0310891_10212046 | Not Available | 655 | Open in IMG/M |
| 3300031942|Ga0310916_10458923 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1085 | Open in IMG/M |
| 3300031944|Ga0310884_10678272 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 622 | Open in IMG/M |
| 3300031945|Ga0310913_10374915 | All Organisms → cellular organisms → Bacteria | 1008 | Open in IMG/M |
| 3300031946|Ga0310910_10344362 | All Organisms → cellular organisms → Bacteria | 1177 | Open in IMG/M |
| 3300031947|Ga0310909_10336811 | Not Available | 1266 | Open in IMG/M |
| 3300031954|Ga0306926_10340649 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1854 | Open in IMG/M |
| 3300031954|Ga0306926_11816538 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 691 | Open in IMG/M |
| 3300031981|Ga0318531_10143269 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1068 | Open in IMG/M |
| 3300032001|Ga0306922_10188250 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2213 | Open in IMG/M |
| 3300032009|Ga0318563_10224561 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1014 | Open in IMG/M |
| 3300032010|Ga0318569_10430327 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 615 | Open in IMG/M |
| 3300032044|Ga0318558_10058581 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1724 | Open in IMG/M |
| 3300032044|Ga0318558_10391803 | Not Available | 691 | Open in IMG/M |
| 3300032052|Ga0318506_10022350 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2330 | Open in IMG/M |
| 3300032055|Ga0318575_10141211 | Not Available | 1192 | Open in IMG/M |
| 3300032059|Ga0318533_11148394 | Not Available | 569 | Open in IMG/M |
| 3300032063|Ga0318504_10125082 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1169 | Open in IMG/M |
| 3300032065|Ga0318513_10648718 | Not Available | 517 | Open in IMG/M |
| 3300032068|Ga0318553_10475927 | Not Available | 654 | Open in IMG/M |
| 3300032068|Ga0318553_10769782 | Not Available | 503 | Open in IMG/M |
| 3300032090|Ga0318518_10160984 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1142 | Open in IMG/M |
| 3300033289|Ga0310914_11629002 | Not Available | 549 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 37.04% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 8.89% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 7.41% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.93% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.70% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.22% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.22% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.22% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.96% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.96% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.96% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.48% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.48% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.48% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.48% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.74% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.74% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.74% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.74% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.74% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.74% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.74% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.74% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.74% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.74% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.74% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.74% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.74% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 0.74% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.74% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.74% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.74% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2035918004 | Soil microbial communities from sample at FACE Site 2 North Carolina CO2- | Environmental | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000580 | Forest soil microbial communities from Amazon forest - 2010 replicate II A01 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006051 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Host-Associated | Open in IMG/M |
| 3300006057 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006578 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006605 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012899 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S058-202B-2 | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300017927 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4 | Environmental | Open in IMG/M |
| 3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300017993 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_3 | Environmental | Open in IMG/M |
| 3300018066 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_b1 | Environmental | Open in IMG/M |
| 3300018073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1 | Environmental | Open in IMG/M |
| 3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300020005 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3m2 | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027490 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_0_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300027768 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028717 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_158 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300031198 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 14_S | Environmental | Open in IMG/M |
| 3300031366 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 25_S | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031763 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031780 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f21 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
| 3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
| 3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
| 3300031859 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031880 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031913 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D4 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031944 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031981 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
| 3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
| 3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
| 3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
| 3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
| 3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
| 3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
| 3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FACENCA_3834470 | 2035918004 | Soil | MTREATRMKKHDESRRAFLIGAAVGAAATTTFVPDAIAQTH |
| INPhiseqgaiiFebDRAFT_1039165371 | 3300000364 | Soil | MAKHDESRRAFLVGAAVGAGAVAGTSMVSEALAQHRKQ |
| AF_2010_repII_A01DRAFT_10390781 | 3300000580 | Forest Soil | MTKHDEARRAFLLGAAVGAGAVAGATLVPDALSQTHEAP |
| Ga0066678_107665831 | 3300005181 | Soil | MAKHDESRRAFLVGTVAGAGAVAAGAGLVPEGQAQTQRQQAAPV |
| Ga0066388_1017111552 | 3300005332 | Tropical Forest Soil | MTKHDEARRAFLVGAAVGAGAVAGATLVPNALAQTQEAPRTT |
| Ga0066388_1025431381 | 3300005332 | Tropical Forest Soil | MIMSKHDEARRAFLVGTAIGAGAAASVALVPGALAQHQPPQ |
| Ga0070699_1002589741 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MTKHDEARRAFLLGAAVGAGAVAGATLVPDALAQTHDART |
| Ga0070732_101652221 | 3300005542 | Surface Soil | MSEHDEGRRAFLVGAAASAGALAGTTLAPEARAQMHDMPMGHTTP |
| Ga0070696_1013184921 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | MTKHDEARRAFLMGAAVGAGAVAGATLVPDALAQTHEPSTTGTGPAHSHAGGP |
| Ga0066905_1004320201 | 3300005713 | Tropical Forest Soil | MSKPDEGRRAFLIGAAVGAGAAAGLVPDAIAQTHPPHPA |
| Ga0066905_1012304872 | 3300005713 | Tropical Forest Soil | MTKHDEARRAFLLGAAVGAGAVAGATLVPDALAQTHDARTTGTGTGPAHS |
| Ga0066903_1041215713 | 3300005764 | Tropical Forest Soil | MSKHDESRRAFLIGGATVGAGAVTGLVPDALAQTHAQ |
| Ga0070766_110772602 | 3300005921 | Soil | MSKHDEARRAFLKGAAVGAGAIAGTGLVPQAFAEPHERHPHEHKT |
| Ga0066651_106401321 | 3300006031 | Soil | MTKHDEARRAFLLGAAVGAGAVAGATLVPDALAQTPDAPTTGTATG |
| Ga0066656_103648541 | 3300006034 | Soil | MTKHDEARRAFLVGAAVGAGAVAGATLVPNALAQTHEAPTTGTA |
| Ga0075417_103800951 | 3300006049 | Populus Rhizosphere | MSKYDEARRAFLIGAAVGAGAVAGKGLVADAFAQTH |
| Ga0075364_109654522 | 3300006051 | Populus Endosphere | MSKHDESRRAFLIGGATVGAGAVTGLVPDALAQTH |
| Ga0075026_1006723482 | 3300006057 | Watersheds | MKKHEESRRAFLIGTAVGASAVAGAGLVPTALAQTQEQ |
| Ga0070765_1021138021 | 3300006176 | Soil | MSKHDEARRAFLKGAAAGAGVIAGTGLAPQALAKE |
| Ga0074059_120109742 | 3300006578 | Soil | MTKHDEARRAFLVGAAVGAGAVAGATLVPDALAQT |
| Ga0074057_123384442 | 3300006605 | Soil | MKKHEESRRAFLIGTAVGASAVAGAGLVPNALAQTHEQHNAA |
| Ga0075428_1011870311 | 3300006844 | Populus Rhizosphere | MKKHEESRRAFLIGTAVGASAVAGAGLVPNALAQTHEQHSA |
| Ga0066710_1015841771 | 3300009012 | Grasslands Soil | MTKHDEARRAFLVGAALGAGAVAAGAGLVADAEAQIHAQPKGNGG |
| Ga0126374_104324982 | 3300009792 | Tropical Forest Soil | MTKHDEARRAFLLGAAVGAGAVAGATLVPDALAQTHEPST |
| Ga0126380_118198471 | 3300010043 | Tropical Forest Soil | MTKHDEARRAFLLGAAVGAGAVAGATLVPDALAQTHDAP |
| Ga0126382_124757011 | 3300010047 | Tropical Forest Soil | MTKHDEARRAFLLGAAVGAGAVAGATLVPDALAQTR |
| Ga0126376_130399352 | 3300010359 | Tropical Forest Soil | MSRKHDESRRAFLVGAAVGASSVAGGLVPGALAQNQSPA |
| Ga0126376_131641482 | 3300010359 | Tropical Forest Soil | MSKHDESRRAFLIGGATVGAGAVTGLVPDALAQTHA |
| Ga0126378_133793731 | 3300010361 | Tropical Forest Soil | MTKHDEARRAFLVGAAVGAGAVAGATLVPNALGQTHEAPTTGAAPAPSHA |
| Ga0126377_116069412 | 3300010362 | Tropical Forest Soil | MSKHDEARRAFLVGAAVGASAAAGAALIPDALAQT |
| Ga0126377_127059592 | 3300010362 | Tropical Forest Soil | MKKHDEARRAFLIGAAAGASVAATGARLVPDAVAQTPAHDA |
| Ga0126383_120472791 | 3300010398 | Tropical Forest Soil | MSKHDEARRAFLLGAAVGAGAVAGATLVPDALAQTRDAPTTGTATGSVHAHAGG |
| Ga0137389_109305902 | 3300012096 | Vadose Zone Soil | MSKHDESRRAFLIGTAVGAGAVAGSGLVPDALAQTHAQH |
| Ga0137362_115941051 | 3300012205 | Vadose Zone Soil | MTKHDEARRAFLVGAAVGAGAVAGATLVPNALAQTH |
| Ga0157299_102924051 | 3300012899 | Soil | MSKHDESRRAFLIGTAVGASAVAGAGLVPTALAQTNV |
| Ga0164302_114171452 | 3300012961 | Soil | MEETLMSKHDEARRAFLVGAAVGAGAAAGAALVPEAL |
| Ga0164309_119334262 | 3300012984 | Soil | MTREATSMKNHDESRRAFLIGAGMGAAATTTLVPDAIAQTNEQR |
| Ga0134089_102586352 | 3300015358 | Grasslands Soil | MSEHDEGRRAFLLRAAATAGVVAGAGLAPDALAQDH |
| Ga0132256_1029621781 | 3300015372 | Arabidopsis Rhizosphere | MSKHDEARRAFLVGVAAGAVAGTGLKTEALAQTHEQHAAV |
| Ga0132255_1035878011 | 3300015374 | Arabidopsis Rhizosphere | MTQPDEGRRAFLVRTAVGAGAVAGAALVPDALAQT |
| Ga0182032_101706973 | 3300016357 | Soil | MTKHDEARRAFLLGAAVGAGAVAGATLVPDALAQTHDARTTGTGTGPAHSPA |
| Ga0182034_114232962 | 3300016371 | Soil | MKKHDESRRAFLIGAAVGAAATTALVPDAIAQTHEQHGVPT |
| Ga0182037_119328911 | 3300016404 | Soil | MTKHDEARRAFLLGAAVGAGAVAGATLVPDALAQTHEPSTTGTG |
| Ga0182039_113383181 | 3300016422 | Soil | MTKHDEARRAFLVGAAVGAGAVAGATLVPNALAQTQ |
| Ga0163161_100387403 | 3300017792 | Switchgrass Rhizosphere | MKKQEESRRAFLIGTAVGASAVAGAGLVPNALAQT |
| Ga0187824_103021602 | 3300017927 | Freshwater Sediment | MSEHDEGRRAFLVGAAASAGALAGTTLVPEAHAQM |
| Ga0187825_100412784 | 3300017930 | Freshwater Sediment | MPQHDEGRRAFLKGAAASAGAVAGATLIPPAQAADQ |
| Ga0187782_105182222 | 3300017975 | Tropical Peatland | MAKHDESRRAFLIGTAVGAGAVAGTTMVSDALAQQ |
| Ga0187823_101106531 | 3300017993 | Freshwater Sediment | MSEHDEGRRAFLVGAAASAGALAGTTLVPEAHAQMRDMP |
| Ga0187823_101601233 | 3300017993 | Freshwater Sediment | MPQHDEGRRAFLKGAAASAGAVAGATLIPPAQAAD |
| Ga0184617_11126641 | 3300018066 | Groundwater Sediment | MKKHEESRRAFLIGTAVGASAVAGAGLVPNALAQTHEQ |
| Ga0184624_101612512 | 3300018073 | Groundwater Sediment | MSKHDEARRAFLIGAAVGAGAVAGKGLVPEALAQTH |
| Ga0184625_103878832 | 3300018081 | Groundwater Sediment | VTKHDESRRAFLVGTVAGAGAVAAGAALPESAEAQVQPPV |
| Ga0066662_102839512 | 3300018468 | Grasslands Soil | MTKHDEARRAFLLGAAVGAGAVAGATLVPDALAQTHEPSTT |
| Ga0193697_10179072 | 3300020005 | Soil | MKKHEESRRAFLIGTAVGASAVAGAGLVPNALAQTHEQHN |
| Ga0210396_103899921 | 3300021180 | Soil | MAERDTSRRAFLVRAAVGAGAVAGASVVPDLSGQNP |
| Ga0210383_103309462 | 3300021407 | Soil | MGKPDESRRAFLVGAAVGAGAVAGTTMVPGALAQHRQHPK |
| Ga0210392_109659682 | 3300021475 | Soil | MAKHDESRRAFLVGAAVGAGAVAGTSMVTDALAQQHRQ |
| Ga0210398_109133171 | 3300021477 | Soil | MGKPDESRRAFLVGAAVGAGAVAGTTMVPGALAQH |
| Ga0126371_131906482 | 3300021560 | Tropical Forest Soil | MAKHDESRRAFLVGAAVGAGAVAGTSMVTDALAQQHR |
| Ga0207707_104150811 | 3300025912 | Corn Rhizosphere | MKKHEESRRAFLIGTAVGASAVAGAGLVPNALAQTHEQHNAADVP |
| Ga0207671_115585471 | 3300025914 | Corn Rhizosphere | MKKHEESRRAFLIGTAVGASAVAGAGLVPNALAQTHEQHNAADV |
| Ga0207649_101487572 | 3300025920 | Corn Rhizosphere | MKKKHEESRRAFLIGTAVGASAVAGAGLVPNALAQTHEQHNAA |
| Ga0207665_105556822 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MSKHDEARRAFLVGAAVVGAGAALAPEALAQQQPAATNT |
| Ga0207676_118275912 | 3300026095 | Switchgrass Rhizosphere | MKKHDEARRAFLVGAAVGAGAVASQTFAPGGLVADARA |
| Ga0207674_105510701 | 3300026116 | Corn Rhizosphere | MKKHEESRRAFLIGTAVGASAVAGAGLVPNALAQTHEQHNAAD |
| Ga0179587_100253911 | 3300026557 | Vadose Zone Soil | MSTHDEARRAFLKGAAAAGAIAGAAVVPQGIPEAMAESHEKR |
| Ga0179587_106619571 | 3300026557 | Vadose Zone Soil | MSKHDEARRAFLKGAALGAGAIAGAGFVPQTLAQAHEQHNDI |
| Ga0209899_10848061 | 3300027490 | Groundwater Sand | MSKHDEARRAFLVGAAGAAAGAALVPDALAQQHQH |
| Ga0209772_100622582 | 3300027768 | Bog Forest Soil | MGKHGKHDESRRAFLVGAAVGAGTVAGTTMVSGALAQH |
| Ga0209380_107555801 | 3300027889 | Soil | MSKHDEARRAFLKGAAVGAGAIAGTGLVPQAFAEQHERHPHEHKT |
| Ga0209068_108630101 | 3300027894 | Watersheds | MTKHDEARRAFLLGAAVGAGAVAGATLVPDALAQTHEPSTTGTGPPH |
| Ga0307298_102209211 | 3300028717 | Soil | MKKHEESRRAFLIGTAVGASAVAGTGLVPTALAQTHEQHPAAD |
| Ga0307298_102500801 | 3300028717 | Soil | MKKHEESRRAFLIGTAVGASAVAGAGLVPTALAQTHEQHP |
| Ga0308309_112617582 | 3300028906 | Soil | MSKHDEARRAFLKGAAVGAGAIAGTGLVPEAFAKPHEKHKT |
| Ga0311338_100201931 | 3300030007 | Palsa | MAKHDESRRAFLVGAAVGAGAVAGTGMVSGALAQHRQH |
| Ga0307500_100177501 | 3300031198 | Soil | MSKHDESRRAFLIGTAVGAGAVAGAGLAPGALAQTHAQHGPADV |
| Ga0307506_101635371 | 3300031366 | Soil | MKKHEESRRAFLIGTAVGASAVAGAGLVPNALAQTHEQHNA |
| Ga0318516_100977404 | 3300031543 | Soil | MTKHDEARRAFLVGAAVGAGAVAGATLVPNALGQTHEAPTTGAAPAPSHSGG |
| Ga0318534_101442701 | 3300031544 | Soil | MTKHDEARRAFLLGAAVGAGAVAGATLVPDALAQTHEPSTTGTD |
| Ga0318541_100100611 | 3300031545 | Soil | MTKHDEARRAFLLGAAVGAGAVAGATLVPDALAQTHE |
| Ga0318541_106580361 | 3300031545 | Soil | MTKHDEGRRAFLVGAAVGAGAVAGATLVPNALAQTHDARTTG |
| Ga0318538_102799741 | 3300031546 | Soil | MTKHDEARRAFLLGAAVGAGAVAGATLMPDALAQTHEPSTTGTGPAHSHAGGPGLG |
| Ga0318515_103111751 | 3300031572 | Soil | MTKHDEARRAFLLGAAVGAGAVAGATLVPDALAQTHEPSRTG |
| Ga0318542_102009621 | 3300031668 | Soil | MTKHDEARRAFLLGAAVGAGAVAGATLVPDALAQTRDAPTTGTGAVHSHAGG |
| Ga0318574_102314642 | 3300031680 | Soil | MTKHNESRRAFLVGTAVGAGAVAGAGLVPTAVPTRK |
| Ga0318560_104608323 | 3300031682 | Soil | MSKHDEARRAFLIGAAVGAGAVAGKGLVPEALAQTHEQHKATDAP |
| Ga0318493_103411161 | 3300031723 | Soil | MTKHDEARRAFLLGAAVGAGAVAGATLVPDALAQTHERS |
| Ga0318492_106717061 | 3300031748 | Soil | MTKHDEARRAFLLGAAVGAGAVAGATLVPDALAQTHEPSR |
| Ga0318494_107356571 | 3300031751 | Soil | MTKHDEGRRAFLVGAAVGAGAVAGATLVPNALAQTHDARTTGTGPAPAHSHA |
| Ga0318537_100939922 | 3300031763 | Soil | MTKHDEARRAFLLGAAVGAGAVAGATLVPDALAQTHDAPTTG |
| Ga0318546_110536221 | 3300031771 | Soil | MSKHDEARRAFLKGAAVGAGAIAGTGLISEALAKPHEKHK |
| Ga0318508_10067421 | 3300031780 | Soil | MTKHDEARRAFLLGAAVGAGAVAGATLVPDALAQTHEPSTTGTGPAHSHAGG |
| Ga0318508_11257032 | 3300031780 | Soil | MTKHDEARRAFLLGAAVGAGAVAGATLVPDALAQTHEPSTTGTGPAHSHAGGPGLG |
| Ga0318547_104027971 | 3300031781 | Soil | MTKHDEGRRAFLVGAAVGAGAVAGATLVPNALAQT |
| Ga0318547_105475072 | 3300031781 | Soil | MTKHDEARRAFLLGAAVGAGAVAGATIVPNAFAQTHEAATIGTAPP |
| Ga0318576_104442342 | 3300031796 | Soil | MTKHDEARRAFLVGAAVGAGAVAGATLVPNALGQTHEAPTTGAA |
| Ga0310917_103342901 | 3300031833 | Soil | MKKHDESRRAFLIGAAVGAAATTALVPDAIAQTHE |
| Ga0310917_107572971 | 3300031833 | Soil | MTKHDEARRAFLLGAAVGAGAVAGATLVPDALAQT |
| Ga0318517_102771811 | 3300031835 | Soil | MTKHDEARRAFLLGAAVGAGAVAGATLVPDALAQTHDAPTTGTG |
| Ga0318511_101234033 | 3300031845 | Soil | MTKHDEARRAFLLGAAVGAGAVAGATLVPDALAQTRDAPTTGTGAVHSHAGGP |
| Ga0318512_100481702 | 3300031846 | Soil | MTKHNESRRAFLVGTAVGAGAVAGAGLVPTALAQTPPQH |
| Ga0318512_106327541 | 3300031846 | Soil | MTKHDEARRAFLVGAAVGAGAVAGATLVPNALGQTHEAPTTGAAPA |
| Ga0318527_100985912 | 3300031859 | Soil | MTKHDEARRAFLLGAAVGAGAVAGATLVPDALAQTHDARTTGTG |
| Ga0306919_110081192 | 3300031879 | Soil | MTKHDEARRAFLLGAAVGAGAVAGATLVPDALAQTHEPSRTGTGPAHSHAGGPGL |
| Ga0318544_102732151 | 3300031880 | Soil | MTKHDEARRAFLLGAAVGAGAVAGATLVPDALAQTHEPSTTG |
| Ga0306925_103251643 | 3300031890 | Soil | MTKHNESRRAFLVGTAVGAGAVAGAGLVPTALAQTPPQ |
| Ga0318520_103261971 | 3300031897 | Soil | MSKHDEARRAFLIGAAVGAGAVAGKGLVPEALAQTHEQ |
| Ga0306923_111872002 | 3300031910 | Soil | MTKPDEARRAFLLGAAVGAGAVAGATLVPDALAQTHDARTTGT |
| Ga0306921_110306981 | 3300031912 | Soil | MTKHDEARRAFLLGAAVGAGAVAGATLVPDALAQTHEP |
| Ga0306921_123250011 | 3300031912 | Soil | MTKHDEARRAFLVGAAVGAGAVAGATLVPNALAQTHDARTTGTGPAPA |
| Ga0310891_102120462 | 3300031913 | Soil | MKKHEESRRAFLIGTAVGASAVAGAGLVPNALAQTHEQH |
| Ga0310916_104589231 | 3300031942 | Soil | MTKHDEARRAFLLGAAVGAGAVAGATLVPDALAQTHEAP |
| Ga0310884_106782721 | 3300031944 | Soil | MKKHEESRRAFLIGTAVGASAVAGAGLVPNALGQTHEQHNAADV |
| Ga0310913_103749151 | 3300031945 | Soil | MSKHDEARRAFLIGAAVGAGAVAGKGLVPEALAQT |
| Ga0310910_103443621 | 3300031946 | Soil | MRKHDDARRAFLIGAAAGAGAAAGVAFDAFAQAPEQ |
| Ga0310909_103368111 | 3300031947 | Soil | MSKHDEARRAFLKGAAVGAGAIAGTGLISEALAKPHEKPK |
| Ga0306926_103406493 | 3300031954 | Soil | MRKHDDARRAFLIGAAAGAGAAAGVAFDAFAQAPEQH |
| Ga0306926_118165381 | 3300031954 | Soil | MTKHDEARRAFLLGAAVGAGAVAGATLVPDALAQTH |
| Ga0318531_101432692 | 3300031981 | Soil | MTKHDEARRAFLVGAAVGAGAVAGATLVPNALGQTHEAPTTGA |
| Ga0306922_101882501 | 3300032001 | Soil | MTKHDEARRAFLLGAAVGAGAVAGATIVPNAFAQTHEAATIGTAPPATPSHA |
| Ga0318563_102245611 | 3300032009 | Soil | MTKHDEARRAFLVGAAVGAGAVAGATLVPNALAQTQEAPRTTGTVPP |
| Ga0318569_104303272 | 3300032010 | Soil | MTKHDEARRAFLVGAAVGAGAVAGATLVPNALAQTQEAP |
| Ga0318558_100585811 | 3300032044 | Soil | MTKHDEARRAFLLGAAVGAGAVAGATLVPDALAQTHEPSTTGTGPAHS |
| Ga0318558_103918032 | 3300032044 | Soil | MSKHDEARRAFLIGAAVGAGAVAGKGLVPEALAQTHEQHK |
| Ga0318506_100223504 | 3300032052 | Soil | MTKHDEARRAFLVGAAVGAGAVAGATLVPNALGQTHE |
| Ga0318575_101412113 | 3300032055 | Soil | MTKHDEARRAFLLGAAVGAGAVAGATLVPDALAQTHDARTTGTGTGPAHSPAG |
| Ga0318533_111483941 | 3300032059 | Soil | MSKHDEARRAFLKGAALGASAVAGAGLVPQALAQAPEQVIPRRQVL |
| Ga0318504_101250821 | 3300032063 | Soil | MTKHDEARRAFLLGAAVGAGAVAGATLVPDALAQTHDARTTGTGTGPVH |
| Ga0318513_106487181 | 3300032065 | Soil | MTKHDEARRAFLVGAAVGAGAVAGATLVPNALGQTH |
| Ga0318553_104759271 | 3300032068 | Soil | MSKHDEARRAFLIGAAVGAGAVAGKGLVPEALAQTHEQHKATDAPA |
| Ga0318553_107697821 | 3300032068 | Soil | MTKHDEARRAFLLGAAVGAGAVAGATLVPDALAQTHEPSTTGTGPAH |
| Ga0318518_101609841 | 3300032090 | Soil | MTKHDEARRAFLVGAAVGAGAVAGATLVPNALGQTHEAPTTGAAPAPSHAGGPGL |
| Ga0335080_108611892 | 3300032828 | Soil | MSKRRDSKHDEARRAFLVGAAVGAVTGAGLVPEALAQDRQPTPAAPP |
| Ga0310914_116290021 | 3300033289 | Soil | MTKHDEARRAFLLGAAVGAGAVAGATLVPDALAQTHEPSTTGTGPAHSH |
| ⦗Top⦘ |