


| Basic Information | |
|---|---|
| Family ID | F058203 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 135 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MSVLHHESILETLFEEVLEEYPQFDEEQCESIAKARFEDLCQ |
| Number of Associated Samples | 72 |
| Number of Associated Scaffolds | 135 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Viruses |
| % of genes with valid RBS motifs | 74.63 % |
| % of genes near scaffold ends (potentially truncated) | 20.74 % |
| % of genes from short scaffolds (< 2000 bps) | 71.85 % |
| Associated GOLD sequencing projects | 61 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.59 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Predicted Viral (34.074 % of family members) |
| NCBI Taxonomy ID | 10239 (predicted) |
| Taxonomy | All Organisms → Viruses → Predicted Viral |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (38.519 % of family members) |
| Environment Ontology (ENVO) | Unclassified (67.407 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (88.148 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 48.57% β-sheet: 0.00% Coil/Unstructured: 51.43% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.59 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 135 Family Scaffolds |
|---|---|---|
| PF04851 | ResIII | 4.44 |
| PF13759 | 2OG-FeII_Oxy_5 | 4.44 |
| PF01555 | N6_N4_Mtase | 3.70 |
| PF01126 | Heme_oxygenase | 1.48 |
| PF00271 | Helicase_C | 1.48 |
| PF00856 | SET | 1.48 |
| PF04965 | GPW_gp25 | 0.74 |
| PF13640 | 2OG-FeII_Oxy_3 | 0.74 |
| PF00462 | Glutaredoxin | 0.74 |
| COG ID | Name | Functional Category | % Frequency in 135 Family Scaffolds |
|---|---|---|---|
| COG0863 | DNA modification methylase | Replication, recombination and repair [L] | 3.70 |
| COG1041 | tRNA G10 N-methylase Trm11 | Translation, ribosomal structure and biogenesis [J] | 3.70 |
| COG2189 | Adenine specific DNA methylase Mod | Replication, recombination and repair [L] | 3.70 |
| COG3230 | Heme oxygenase | Inorganic ion transport and metabolism [P] | 1.48 |
| COG5398 | Heme oxygenase | Coenzyme transport and metabolism [H] | 1.48 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 68.15 % |
| Unclassified | root | N/A | 31.85 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002231|KVRMV2_100819482 | Not Available | 564 | Open in IMG/M |
| 3300002242|KVWGV2_10001364 | All Organisms → Viruses → Predicted Viral | 1420 | Open in IMG/M |
| 3300005400|Ga0066867_10132058 | Not Available | 936 | Open in IMG/M |
| 3300005404|Ga0066856_10000114 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae | 25534 | Open in IMG/M |
| 3300005404|Ga0066856_10038355 | All Organisms → Viruses → Predicted Viral | 2094 | Open in IMG/M |
| 3300005404|Ga0066856_10456210 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium TMED228 | 545 | Open in IMG/M |
| 3300005427|Ga0066851_10005171 | Not Available | 5629 | Open in IMG/M |
| 3300005427|Ga0066851_10096971 | All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Marinimicrobia → Candidatus Marinimicrobia bacterium | 961 | Open in IMG/M |
| 3300005430|Ga0066849_10393223 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 522 | Open in IMG/M |
| 3300005463|Ga0068485_11052 | Not Available | 898 | Open in IMG/M |
| 3300005514|Ga0066866_10174977 | Not Available | 760 | Open in IMG/M |
| 3300005521|Ga0066862_10080982 | All Organisms → Viruses → Predicted Viral | 1118 | Open in IMG/M |
| 3300005522|Ga0066861_10139820 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 838 | Open in IMG/M |
| 3300005523|Ga0066865_10177621 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae | 794 | Open in IMG/M |
| 3300005599|Ga0066841_10015206 | All Organisms → Viruses → Predicted Viral | 1219 | Open in IMG/M |
| 3300006024|Ga0066371_10001653 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 5406 | Open in IMG/M |
| 3300006024|Ga0066371_10194676 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 628 | Open in IMG/M |
| 3300006332|Ga0068500_1139806 | All Organisms → Viruses → Predicted Viral | 1900 | Open in IMG/M |
| 3300006332|Ga0068500_1142192 | All Organisms → Viruses → Predicted Viral | 3699 | Open in IMG/M |
| 3300006332|Ga0068500_1497950 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 654 | Open in IMG/M |
| 3300006332|Ga0068500_1533273 | All Organisms → Viruses → Predicted Viral | 1787 | Open in IMG/M |
| 3300006332|Ga0068500_1657988 | All Organisms → Viruses | 1281 | Open in IMG/M |
| 3300006332|Ga0068500_1794715 | Not Available | 611 | Open in IMG/M |
| 3300006411|Ga0099956_1093931 | Not Available | 854 | Open in IMG/M |
| 3300006412|Ga0099955_1019926 | All Organisms → Viruses → Predicted Viral | 1620 | Open in IMG/M |
| 3300006412|Ga0099955_1100892 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 964 | Open in IMG/M |
| 3300006565|Ga0100228_1475269 | Not Available | 521 | Open in IMG/M |
| 3300006565|Ga0100228_1475725 | Not Available | 534 | Open in IMG/M |
| 3300006735|Ga0098038_1249968 | Not Available | 560 | Open in IMG/M |
| 3300006752|Ga0098048_1216073 | Not Available | 564 | Open in IMG/M |
| 3300006928|Ga0098041_1048706 | All Organisms → Viruses → Predicted Viral | 1372 | Open in IMG/M |
| 3300006928|Ga0098041_1145339 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 763 | Open in IMG/M |
| 3300006928|Ga0098041_1233773 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Salacisavirus → Prochlorococcus virus PSSM2 | 587 | Open in IMG/M |
| 3300007336|Ga0079245_1310649 | All Organisms → Viruses → Predicted Viral | 2509 | Open in IMG/M |
| 3300007336|Ga0079245_1362568 | Not Available | 784 | Open in IMG/M |
| 3300007338|Ga0079242_1240591 | Not Available | 695 | Open in IMG/M |
| 3300009481|Ga0114932_10007470 | All Organisms → Viruses | 9057 | Open in IMG/M |
| 3300009481|Ga0114932_10261226 | All Organisms → Viruses → Predicted Viral | 1043 | Open in IMG/M |
| 3300009481|Ga0114932_10549013 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 678 | Open in IMG/M |
| 3300009481|Ga0114932_10658760 | Not Available | 611 | Open in IMG/M |
| 3300009481|Ga0114932_10727146 | Not Available | 577 | Open in IMG/M |
| 3300009593|Ga0115011_10026335 | All Organisms → Viruses → Predicted Viral | 3895 | Open in IMG/M |
| 3300009593|Ga0115011_10085163 | All Organisms → Viruses → Predicted Viral | 2209 | Open in IMG/M |
| 3300009593|Ga0115011_10443771 | All Organisms → Viruses → Predicted Viral | 1019 | Open in IMG/M |
| 3300009593|Ga0115011_10494818 | All Organisms → Viruses | 969 | Open in IMG/M |
| 3300009593|Ga0115011_10810858 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 776 | Open in IMG/M |
| 3300009593|Ga0115011_11113506 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae | 675 | Open in IMG/M |
| 3300009593|Ga0115011_12242543 | Not Available | 504 | Open in IMG/M |
| 3300009679|Ga0115105_11402663 | All Organisms → Viruses → Predicted Viral | 1332 | Open in IMG/M |
| 3300009703|Ga0114933_10905452 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Salacisavirus → Prochlorococcus virus PSSM2 | 560 | Open in IMG/M |
| 3300009790|Ga0115012_10008474 | Not Available | 6196 | Open in IMG/M |
| 3300009790|Ga0115012_10012136 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae | 5256 | Open in IMG/M |
| 3300009790|Ga0115012_10135615 | All Organisms → Viruses → Predicted Viral | 1760 | Open in IMG/M |
| 3300009790|Ga0115012_10273124 | All Organisms → Viruses → Predicted Viral | 1263 | Open in IMG/M |
| 3300009790|Ga0115012_10651250 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Kanaloavirus → unclassified Kanaloavirus → Kanaloavirus sp. | 840 | Open in IMG/M |
| 3300009790|Ga0115012_11172884 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → Haifavirus → Haifavirus tim68 | 644 | Open in IMG/M |
| 3300009790|Ga0115012_11439559 | Not Available | 589 | Open in IMG/M |
| 3300009790|Ga0115012_11957964 | Not Available | 518 | Open in IMG/M |
| 3300009794|Ga0105189_1010909 | Not Available | 837 | Open in IMG/M |
| 3300009794|Ga0105189_1018786 | Not Available | 650 | Open in IMG/M |
| 3300009794|Ga0105189_1027912 | Not Available | 552 | Open in IMG/M |
| 3300010934|Ga0137844_1207962 | All Organisms → Viruses → Predicted Viral | 1186 | Open in IMG/M |
| 3300012952|Ga0163180_10953218 | Not Available | 684 | Open in IMG/M |
| 3300012954|Ga0163111_10993014 | Not Available | 810 | Open in IMG/M |
| 3300017738|Ga0181428_1080892 | Not Available | 758 | Open in IMG/M |
| 3300017767|Ga0181406_1222452 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 557 | Open in IMG/M |
| 3300017782|Ga0181380_1025878 | All Organisms → Viruses → Predicted Viral | 2168 | Open in IMG/M |
| 3300017786|Ga0181424_10412523 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Salacisavirus → Prochlorococcus virus PSSM2 | 548 | Open in IMG/M |
| 3300020248|Ga0211584_1010142 | All Organisms → Viruses → Predicted Viral | 1376 | Open in IMG/M |
| 3300020248|Ga0211584_1029963 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → Haifavirus → Haifavirus tim68 | 832 | Open in IMG/M |
| 3300020255|Ga0211586_1000239 | All Organisms → Viruses | 20421 | Open in IMG/M |
| 3300020255|Ga0211586_1003365 | All Organisms → Viruses → Predicted Viral | 3838 | Open in IMG/M |
| 3300020255|Ga0211586_1029613 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae | 975 | Open in IMG/M |
| 3300020270|Ga0211671_1002027 | All Organisms → Viruses → Predicted Viral | 4583 | Open in IMG/M |
| 3300020294|Ga0211520_1003353 | All Organisms → Viruses → Predicted Viral | 2862 | Open in IMG/M |
| 3300020294|Ga0211520_1016969 | All Organisms → Viruses → Predicted Viral | 1177 | Open in IMG/M |
| 3300020294|Ga0211520_1035159 | Not Available | 802 | Open in IMG/M |
| 3300020299|Ga0211615_1014779 | All Organisms → Viruses → Predicted Viral | 1077 | Open in IMG/M |
| 3300020312|Ga0211542_1000211 | All Organisms → Viruses | 23580 | Open in IMG/M |
| 3300020312|Ga0211542_1019207 | All Organisms → Viruses → Predicted Viral | 1459 | Open in IMG/M |
| 3300020312|Ga0211542_1079010 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae | 580 | Open in IMG/M |
| 3300020336|Ga0211510_1000007 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 64902 | Open in IMG/M |
| 3300020345|Ga0211706_1073663 | Not Available | 699 | Open in IMG/M |
| 3300020345|Ga0211706_1111713 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → Haifavirus → Haifavirus tim68 | 547 | Open in IMG/M |
| 3300020379|Ga0211652_10027191 | All Organisms → Viruses → Predicted Viral | 1713 | Open in IMG/M |
| 3300020379|Ga0211652_10128648 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae | 768 | Open in IMG/M |
| 3300020381|Ga0211476_10116028 | Not Available | 993 | Open in IMG/M |
| 3300020394|Ga0211497_10343301 | Not Available | 551 | Open in IMG/M |
| 3300020395|Ga0211705_10223091 | Not Available | 694 | Open in IMG/M |
| 3300020411|Ga0211587_10000073 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 60587 | Open in IMG/M |
| 3300020411|Ga0211587_10011659 | All Organisms → Viruses → Predicted Viral | 4677 | Open in IMG/M |
| 3300020411|Ga0211587_10026706 | All Organisms → Viruses → Predicted Viral | 2805 | Open in IMG/M |
| 3300020411|Ga0211587_10069959 | All Organisms → Viruses → Predicted Viral | 1563 | Open in IMG/M |
| 3300020411|Ga0211587_10104698 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 1226 | Open in IMG/M |
| 3300020411|Ga0211587_10277060 | Not Available | 692 | Open in IMG/M |
| 3300020421|Ga0211653_10014771 | All Organisms → Viruses → Predicted Viral | 3755 | Open in IMG/M |
| 3300020428|Ga0211521_10002785 | Not Available | 12873 | Open in IMG/M |
| 3300020428|Ga0211521_10107522 | All Organisms → Viruses → Predicted Viral | 1340 | Open in IMG/M |
| 3300020438|Ga0211576_10070789 | All Organisms → Viruses → Predicted Viral | 1959 | Open in IMG/M |
| 3300020445|Ga0211564_10004445 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 6982 | Open in IMG/M |
| 3300020445|Ga0211564_10004523 | Not Available | 6924 | Open in IMG/M |
| 3300020445|Ga0211564_10016864 | All Organisms → Viruses → Predicted Viral | 3627 | Open in IMG/M |
| 3300020445|Ga0211564_10018196 | All Organisms → Viruses → Predicted Viral | 3494 | Open in IMG/M |
| 3300020445|Ga0211564_10072583 | All Organisms → Viruses → Predicted Viral | 1717 | Open in IMG/M |
| 3300020445|Ga0211564_10364183 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 711 | Open in IMG/M |
| 3300020445|Ga0211564_10467903 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium TMED228 | 618 | Open in IMG/M |
| 3300020467|Ga0211713_10486386 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae | 600 | Open in IMG/M |
| 3300020468|Ga0211475_10033137 | All Organisms → Viruses → Predicted Viral | 2899 | Open in IMG/M |
| 3300020470|Ga0211543_10000694 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 22782 | Open in IMG/M |
| 3300020472|Ga0211579_10597478 | All Organisms → Viruses | 619 | Open in IMG/M |
| 3300020473|Ga0211625_10014923 | Not Available | 5720 | Open in IMG/M |
| 3300020478|Ga0211503_10174269 | All Organisms → Viruses → Predicted Viral | 1223 | Open in IMG/M |
| 3300024344|Ga0209992_10158871 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Kanaloavirus → unclassified Kanaloavirus → Kanaloavirus sp. | 980 | Open in IMG/M |
| 3300024344|Ga0209992_10165644 | Not Available | 955 | Open in IMG/M |
| 3300024344|Ga0209992_10375536 | Not Available | 566 | Open in IMG/M |
| 3300025096|Ga0208011_1000611 | Not Available | 13361 | Open in IMG/M |
| 3300025118|Ga0208790_1082981 | Not Available | 954 | Open in IMG/M |
| 3300025132|Ga0209232_1003493 | Not Available | 7386 | Open in IMG/M |
| 3300025132|Ga0209232_1028039 | All Organisms → Viruses → Predicted Viral | 2169 | Open in IMG/M |
| 3300026076|Ga0208261_1042495 | All Organisms → Viruses → Predicted Viral | 1275 | Open in IMG/M |
| 3300026166|Ga0208276_1001178 | All Organisms → Viruses → Predicted Viral | 4160 | Open in IMG/M |
| 3300026257|Ga0208407_1120734 | Not Available | 814 | Open in IMG/M |
| 3300026257|Ga0208407_1222152 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 545 | Open in IMG/M |
| 3300026263|Ga0207992_1014834 | All Organisms → Viruses → Predicted Viral | 2563 | Open in IMG/M |
| 3300026269|Ga0208766_1000051 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 59805 | Open in IMG/M |
| 3300026321|Ga0208764_10073035 | All Organisms → Viruses → Predicted Viral | 1800 | Open in IMG/M |
| 3300027906|Ga0209404_10005263 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Palaemonvirus → Prochlorococcus virus PSSM7 → Prochlorococcus phage P-SSM7 | 7335 | Open in IMG/M |
| 3300027906|Ga0209404_10083700 | All Organisms → Viruses → Predicted Viral | 1861 | Open in IMG/M |
| 3300027906|Ga0209404_10510361 | All Organisms → Viruses | 796 | Open in IMG/M |
| 3300027906|Ga0209404_10596949 | Not Available | 738 | Open in IMG/M |
| 3300031774|Ga0315331_10144981 | All Organisms → Viruses → Predicted Viral | 1770 | Open in IMG/M |
| 3300032006|Ga0310344_10360355 | All Organisms → Viruses → Predicted Viral | 1246 | Open in IMG/M |
| 3300032006|Ga0310344_10627930 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 918 | Open in IMG/M |
| 3300032006|Ga0310344_11217052 | Not Available | 624 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 38.52% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 34.07% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine | 8.89% |
| Deep Subsurface | Environmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface | 6.67% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 2.22% |
| Marine Oceanic | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine Oceanic | 2.22% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 2.96% |
| Marine Sediment | Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment | 1.48% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 0.74% |
| Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 0.74% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 0.74% |
| Subsea Pool Microbial Mat | Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Subsea Pool Microbial Mat | 0.74% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002231 | Marine sediment microbial communities from Santorini caldera mats, Greece - red mat | Environmental | Open in IMG/M |
| 3300002242 | Marine sediment microbial communities from Kolumbo Volcano mats, Greece - white/grey mat | Environmental | Open in IMG/M |
| 3300005400 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F12-01SV261 | Environmental | Open in IMG/M |
| 3300005404 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV205 | Environmental | Open in IMG/M |
| 3300005427 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV65 | Environmental | Open in IMG/M |
| 3300005430 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV69 | Environmental | Open in IMG/M |
| 3300005463 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT233_1_0125m | Environmental | Open in IMG/M |
| 3300005514 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F12-01SV263 | Environmental | Open in IMG/M |
| 3300005521 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F10-02SV255 | Environmental | Open in IMG/M |
| 3300005522 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F10-02SV257 | Environmental | Open in IMG/M |
| 3300005523 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F12-01SV265 | Environmental | Open in IMG/M |
| 3300005599 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302PF91A | Environmental | Open in IMG/M |
| 3300006024 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S15_td_DCM_ad_63m_LV_B | Environmental | Open in IMG/M |
| 3300006332 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT238_1_0200m | Environmental | Open in IMG/M |
| 3300006411 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT225_1_0200m | Environmental | Open in IMG/M |
| 3300006412 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT225_1_0125m | Environmental | Open in IMG/M |
| 3300006565 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT231_2_0125m | Environmental | Open in IMG/M |
| 3300006735 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG | Environmental | Open in IMG/M |
| 3300006752 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG | Environmental | Open in IMG/M |
| 3300006928 | Marine viral communities from the Subarctic Pacific Ocean - 8_ETSP_OMZ_AT15162 metaG | Environmental | Open in IMG/M |
| 3300007336 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - KN S7 DCM_A metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300007338 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - KN S5 c16 DCM_B metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009481 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV12_ACTIVE470 metaG | Environmental | Open in IMG/M |
| 3300009593 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 Metagenome | Environmental | Open in IMG/M |
| 3300009679 | Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_155_C17_100m_0.8um Metatranscriptome (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009703 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 4SBTROV12_W25 metaG | Environmental | Open in IMG/M |
| 3300009790 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT10 Metagenome | Environmental | Open in IMG/M |
| 3300009794 | Marine viral communities from the Southern Atlantic ocean transect to study dissolved organic matter and carbon cycling - metaG 3438_5245 | Environmental | Open in IMG/M |
| 3300010934 | Microbial mat microbial communities from the Kallisti Limnes subsea pool, Santorini, Greece - 2-BIOTECH-ROV9-P3 | Environmental | Open in IMG/M |
| 3300012952 | Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 4 Metagenome | Environmental | Open in IMG/M |
| 3300012954 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St18 metaG | Environmental | Open in IMG/M |
| 3300017738 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 51 SPOT_SRF_2014-02-12 | Environmental | Open in IMG/M |
| 3300017767 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 29 SPOT_SRF_2011-12-20 | Environmental | Open in IMG/M |
| 3300017782 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 3 SPOT_SRF_2009-08-19 | Environmental | Open in IMG/M |
| 3300017786 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 47 SPOT_SRF_2013-09-18 | Environmental | Open in IMG/M |
| 3300020248 | Marine microbial communities from Tara Oceans - TARA_B100000123 (ERX556118-ERR599141) | Environmental | Open in IMG/M |
| 3300020255 | Marine microbial communities from Tara Oceans - TARA_B100000131 (ERX556136-ERR599013) | Environmental | Open in IMG/M |
| 3300020270 | Marine microbial communities from Tara Oceans - TARA_B100001029 (ERX555928-ERR599042) | Environmental | Open in IMG/M |
| 3300020294 | Marine microbial communities from Tara Oceans - TARA_E500000331 (ERX556124-ERR599153) | Environmental | Open in IMG/M |
| 3300020299 | Marine microbial communities from Tara Oceans - TARA_B100000214 (ERX555923-ERR599016) | Environmental | Open in IMG/M |
| 3300020312 | Marine microbial communities from Tara Oceans - TARA_B100000287 (ERX556125-ERR598977) | Environmental | Open in IMG/M |
| 3300020336 | Marine microbial communities from Tara Oceans - TARA_E500000081 (ERX289008-ERR315860) | Environmental | Open in IMG/M |
| 3300020345 | Marine microbial communities from Tara Oceans - TARA_B100000427 (ERX556079-ERR599137) | Environmental | Open in IMG/M |
| 3300020379 | Marine microbial communities from Tara Oceans - TARA_B100000902 (ERX556001-ERR599168) | Environmental | Open in IMG/M |
| 3300020381 | Marine microbial communities from Tara Oceans - TARA_A100001011 (ERX291769-ERR318620) | Environmental | Open in IMG/M |
| 3300020394 | Marine microbial communities from Tara Oceans - TARA_B000000557 (ERX556068-ERR599026) | Environmental | Open in IMG/M |
| 3300020395 | Marine microbial communities from Tara Oceans - TARA_B100000427 (ERX555987-ERR599133) | Environmental | Open in IMG/M |
| 3300020411 | Marine microbial communities from Tara Oceans - TARA_B100000131 (ERX556098-ERR599130) | Environmental | Open in IMG/M |
| 3300020421 | Marine microbial communities from Tara Oceans - TARA_B100000902 (ERX556005-ERR599007) | Environmental | Open in IMG/M |
| 3300020428 | Marine microbial communities from Tara Oceans - TARA_E500000331 (ERX556032-ERR599094) | Environmental | Open in IMG/M |
| 3300020436 | Marine microbial communities from Tara Oceans - TARA_B100000424 (ERX556009-ERR598984) | Environmental | Open in IMG/M |
| 3300020438 | Marine microbial communities from Tara Oceans - TARA_B100001094 (ERX555907-ERR598942) | Environmental | Open in IMG/M |
| 3300020445 | Marine microbial communities from Tara Oceans - TARA_B100001996 (ERX555961-ERR599087) | Environmental | Open in IMG/M |
| 3300020467 | Marine microbial communities from Tara Oceans - TARA_B100000945 (ERX555966-ERR598957) | Environmental | Open in IMG/M |
| 3300020468 | Marine microbial communities from Tara Oceans - TARA_A100000164 (ERX555914-ERR598993) | Environmental | Open in IMG/M |
| 3300020470 | Marine microbial communities from Tara Oceans - TARA_B100000287 (ERX555976-ERR599053) | Environmental | Open in IMG/M |
| 3300020472 | Marine microbial communities from Tara Oceans - TARA_B100001250 (ERX556017-ERR598995) | Environmental | Open in IMG/M |
| 3300020473 | Marine microbial communities from Tara Oceans - TARA_B100000700 (ERX555932-ERR598948) | Environmental | Open in IMG/M |
| 3300020478 | Marine microbial communities from Tara Oceans - TARA_B100000029 (ERX556025-ERR599111) | Environmental | Open in IMG/M |
| 3300024344 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV12_ACTIVE470 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025096 | Marine viral communities from the Subarctic Pacific Ocean - 7_ETSP_OMZ_AT15161 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025118 | Marine viral communities from the Subarctic Pacific Ocean - 10_ETSP_OMZ_AT15264 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025132 | Marine viral communities from the Pacific Ocean - ETNP_2_60 (SPAdes) | Environmental | Open in IMG/M |
| 3300026076 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S7_td_DCM_ad_131m_LV_B (SPAdes) | Environmental | Open in IMG/M |
| 3300026166 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302PF91A (SPAdes) | Environmental | Open in IMG/M |
| 3300026257 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV69 (SPAdes) | Environmental | Open in IMG/M |
| 3300026263 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F10-02SV255 (SPAdes) | Environmental | Open in IMG/M |
| 3300026269 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F12-01SV263 (SPAdes) | Environmental | Open in IMG/M |
| 3300026321 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302SV91 (SPAdes) | Environmental | Open in IMG/M |
| 3300027906 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 Metagenome (SPAdes) | Environmental | Open in IMG/M |
| 3300031774 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 60m 34915 | Environmental | Open in IMG/M |
| 3300032006 | Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - HC15-DNA-20-200_MG | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| KVRMV2_1008194821 | 3300002231 | Marine Sediment | LHNEALLETLFEEVLAEYPQFDEEQCESIAKARFEDYSN* |
| KVWGV2_100013642 | 3300002242 | Marine Sediment | MSCLHNEALLETLFEEVLDEYRQFDEEQCESIAKARFEDYSN* |
| Ga0066867_101320583 | 3300005400 | Marine | MSTLQNESLMETIFEEVLEEWFPELDMEKCESIAKTRFESMCQ* |
| Ga0066856_1000011419 | 3300005404 | Marine | MSVLHHESILETIYEEVLEEFPQLDEAHCEIIAKQRFEDMCQ* |
| Ga0066856_100383556 | 3300005404 | Marine | MSTLHHESILETLFEEVLEEYPQFDEEQCETIAKQRFEDMLQ* |
| Ga0066856_104562102 | 3300005404 | Marine | MSVLHHESLLETIYEEVLDEYPHLDEESCESIAKARFEDLCQ* |
| Ga0066851_100051711 | 3300005427 | Marine | MSTLQHESILETLYEEVLEEYPQFDEDQCESIAKQRFQDCAH* |
| Ga0066851_100969714 | 3300005427 | Marine | MSVLHHESLLETIYEEVLDEYFPQYDEEQCESIARQRFEDSLQ* |
| Ga0066849_103932232 | 3300005430 | Marine | MSTLQHESILETLYEEVLEEYPQFDEDQCESIAKQRFQDFAQ* |
| Ga0068485_110522 | 3300005463 | Marine | MSVLHHEALLETIYEEVLEEYPQFDEEQCESIAYARFEDLCQ* |
| Ga0066866_101749772 | 3300005514 | Marine | MSVLSHESLLETIYEEVLDEYFPQYDEEQCESIARQRFEDSLQ* |
| Ga0066862_100809824 | 3300005521 | Marine | TLANEILMETIFEEVLEEWFPEFDEEQCESIAKTRFESMCQ* |
| Ga0066861_101398201 | 3300005522 | Marine | IMEVCLLMSTLHHESILETLFDEVCEEFPYFTEEMCASIAQKRFEDMCQ* |
| Ga0066865_101776213 | 3300005523 | Marine | MSVLHHESILETLFEEVCEEYPQFSEEQCEVIAQQRFEDLCQ* |
| Ga0066841_100152063 | 3300005599 | Marine | MSTLANEILMETIFEEVLEEWFPEFDEEQCESIAKTRFESMCQ* |
| Ga0066371_1000165315 | 3300006024 | Marine | MSVLHHESILETLYEEVLEEYPQFSEEQCETIAKQRFEDLCQ* |
| Ga0066371_101946763 | 3300006024 | Marine | MSCLHNEALLETLFEEVLAEYPQFDEEQCESIAKQR |
| Ga0068500_11398062 | 3300006332 | Marine | MSVLHHEALLETIYEEVLEEYPQFDEEQCESIAKARFEDLCQ* |
| Ga0068500_11421927 | 3300006332 | Marine | MSVLHHESILETLYEEVCEEYPQFSEEQCETIAKARFEELCQ* |
| Ga0068500_14979501 | 3300006332 | Marine | MEVKLIMSNIHNEALLETIYEEVLEEYYPQFDEEQCESIAKQRFEDMAW* |
| Ga0068500_15332734 | 3300006332 | Marine | MSVLHHESILETLYEEVLEEYPQFDEEQCESIAKQRFEDYSN* |
| Ga0068500_16579885 | 3300006332 | Marine | LHHESILETLFEEVCEEYPQFDEEQCETIAYARFEDMCQ* |
| Ga0068500_17947152 | 3300006332 | Marine | MSCLHNEALLETLFEEVLAEYPQFDEEQCESIAKARFEDYSN* |
| Ga0099956_10939314 | 3300006411 | Marine | MSCINNEALLETLFEEVLAEYPQFDEEQCESIAKARFEDYSN* |
| Ga0099955_10199261 | 3300006412 | Marine | STLHHESILETLFEEVCEEYPQFDEEQCETIAYARFEELCQ* |
| Ga0099955_11008923 | 3300006412 | Marine | MSVLHHESILETLYEEVLEEYPQFDEEQCESIAKQRFEDLCQ* |
| Ga0100228_14752692 | 3300006565 | Marine | MSCINNEALLETLFEEGLAEYPQFDEEQCESIAKARFEDYSN* |
| Ga0100228_14757251 | 3300006565 | Marine | MSCINNEALLETLFEEVLAEYPQFDEEACEAIAKQRFEDYSN* |
| Ga0098038_12499683 | 3300006735 | Marine | ALLETLFEEVLAEYPQFDEEQCESIAKARFEDYSN* |
| Ga0098048_12160731 | 3300006752 | Marine | LLETLFEEVLAEYPQFDEEACEAIAKARFEDLSN* |
| Ga0098041_10487064 | 3300006928 | Marine | MSTLNHESILETLFEEVLEEYPQFDEEQCESIAKQRFEDMLQ* |
| Ga0098041_11453393 | 3300006928 | Marine | MSTLANEQILETLFEEVLSEYPQYDEEQCESIARARFEDLLQ* |
| Ga0098041_12337731 | 3300006928 | Marine | MSVLHHESILETIYEEVLEEFPQLDEAHCEIIAKQRFEDMSR* |
| Ga0079245_13106492 | 3300007336 | Marine | MSVLHHEALLETLFEEVLEEYPQFDEEQCESIAKARFEDLCQ* |
| Ga0079245_13625681 | 3300007336 | Marine | HRSWEVNLIMSCLHNEALLETLFEEVLAEYPQFDEEQCESIAKARFEDYSN* |
| Ga0079242_12405912 | 3300007338 | Marine | MSNIHNEALLETIYEEVLEEYYPQFDEEQCESIAKQRFEDMAW* |
| Ga0114932_100074705 | 3300009481 | Deep Subsurface | MSVIHHEALLETIYEEVLEEYPQFDEEQCESIAYARFEDLCQ* |
| Ga0114932_102612263 | 3300009481 | Deep Subsurface | MSCINNEALLETLFEEVLAEYPQFDEEQCESIAKARFEDYSR* |
| Ga0114932_105490133 | 3300009481 | Deep Subsurface | MSCINNEALLETLFEEVLAEYPQFDEEQCESIAKARFEDY |
| Ga0114932_106587603 | 3300009481 | Deep Subsurface | NEALLETLFEEVLAEYPQFDEEQCESIAKARFEDYSR* |
| Ga0114932_107271461 | 3300009481 | Deep Subsurface | HNEALLETLFEEVLAEYPQFDEEQCESIAKARFEDYSN* |
| Ga0115011_100263355 | 3300009593 | Marine | MSTLHHESILESIYEEVLDEYFPQYDEEQCESIARQRFEDSLQ* |
| Ga0115011_100851633 | 3300009593 | Marine | MSCIHNESILETIYEEVLEEFPQLDEAHCEIIAKQRFEDMCQ* |
| Ga0115011_104437714 | 3300009593 | Marine | MSTLHHESILETLYEEVLEEYPQFDEEQCESIAKQRFEDLCQ* |
| Ga0115011_104948184 | 3300009593 | Marine | MSNIQNEMILENIYEEVLEEYPQFDEEQCESIAKQRFEDLCQ* |
| Ga0115011_108108583 | 3300009593 | Marine | MSNIQNEMILENIYEEVLEEYPQFDEEQCETIAKARFEDLCQ* |
| Ga0115011_111135062 | 3300009593 | Marine | MSTLANEQILETLFEEVLEEYPQYDEEQCESIARARFEDLLQ* |
| Ga0115011_122425432 | 3300009593 | Marine | MILETIYEEVLDEYFPQYDEEQCESIARQRFEDMCQ* |
| Ga0115105_114026631 | 3300009679 | Marine | ESLLETIYEEVLDEYFPQYDEEQCESIARQRFEDSLQ* |
| Ga0114933_109054521 | 3300009703 | Deep Subsurface | MSCINNEALLETLFEEVLAEYPQYDEEACEAIAKARFEDCSR* |
| Ga0115012_1000847413 | 3300009790 | Marine | MSVLHHESILETLFEEVCEEYPQFSEEQCETIAKARFEELCQ* |
| Ga0115012_1001213612 | 3300009790 | Marine | MSVLHHESLLETIYEEVLDEYFPQYDEEQCESIARQRFEDLCQ* |
| Ga0115012_101356152 | 3300009790 | Marine | MSTLNHESILETLFEEVLEEYPQFDEEQCETIAKQRFEDMLQ* |
| Ga0115012_102731242 | 3300009790 | Marine | MSVLHHEALLETLFEEVLEEYPQFDEEQCETIAKQRFEDLCQ* |
| Ga0115012_106512503 | 3300009790 | Marine | MSCLRNEALLETLFEEVLAEYPQFDEEQCEAIAKARFEDYSN* |
| Ga0115012_111728842 | 3300009790 | Marine | MSTLNHESILETLFEEVLEEYPQFDEEQCESIAKQRFEDLCQ* |
| Ga0115012_114395593 | 3300009790 | Marine | MSVLHHESILETIFEEVCEEYPQYTDEQCETIAYARFEDMCQ* |
| Ga0115012_119579642 | 3300009790 | Marine | MSCLHNEALLETLFEEVLAEYSHLDEEACEAIAKARFEDYSN* |
| Ga0105189_10109093 | 3300009794 | Marine Oceanic | MSCLHNEALLETLFEEVLAEYPQFDEEQCESIAKARFEDYSR* |
| Ga0105189_10187861 | 3300009794 | Marine Oceanic | MSVLHHEALLETIYEEVLEEYSHLDEESCESIAKARFEDLCQ* |
| Ga0105189_10279121 | 3300009794 | Marine Oceanic | MSTLHHESILETLYEEVCEEYPQFDEEQCETIAQQRFEDMCQ* |
| Ga0137844_12079622 | 3300010934 | Subsea Pool Microbial Mat | MSCIXNEALLETLFEEVLAEYPQFDEEQCESIAKARFEDYSN* |
| Ga0163180_109532182 | 3300012952 | Seawater | MSVLHHEALLETIFEEVLEEYPQFDEEQCESIARARFEDLCQ* |
| Ga0163111_109930144 | 3300012954 | Surface Seawater | MSCLHNEALLETLFEEVLAEYPHLDEEACESIAKARFEDYSN* |
| Ga0181428_10808922 | 3300017738 | Seawater | MSCIHNESILESLFDEVCEEYPQFDEDQCESIAKQRFEDMCQ |
| Ga0181406_12224522 | 3300017767 | Seawater | MSCINNEALLETLFVEVCAEYPQFDEEQCESIAKARFEDSSR |
| Ga0181380_10258782 | 3300017782 | Seawater | MSCIQNESILESLFDEVCEEYPQFDEDQCESIAKQRFEAMCY |
| Ga0181424_104125232 | 3300017786 | Seawater | MSCINNEALLETLFEEVLAEYPQFDEEQCESIAKQRFEDYAR |
| Ga0211584_10101423 | 3300020248 | Marine | MSVLHHEALLETIYEEVLEEYPQFDEEQCESIAKARFEDLCI |
| Ga0211584_10299633 | 3300020248 | Marine | MSVLHHEALLETIYEEVLDEYPHLDEESCESIAKARFEDLCQ |
| Ga0211586_100023917 | 3300020255 | Marine | MSVLHHESILETLYEEVLEEYPQFDEEQCETIAKQRFEDLCQ |
| Ga0211586_100336511 | 3300020255 | Marine | VSTLHHESILETLFEEVCEEYPQFSEEQCEVIAQQRFEDLCQ |
| Ga0211586_10296132 | 3300020255 | Marine | MSVLHHESILETIYEEVLDEYFPQYDEEQCESIARQRFEDLCQ |
| Ga0211671_10020277 | 3300020270 | Marine | MSVLHHESILETLFEEVLEEYPQFDEEQCESIAKARFEDLCQ |
| Ga0211520_10033531 | 3300020294 | Marine | IHHEALLETIYEEVLEEYPQFDEEQCESIAYARFEDLCQ |
| Ga0211520_10169692 | 3300020294 | Marine | MSTLHHESILETCFEEVCEEYPQFNEEQCETIAYARFEELCQ |
| Ga0211520_10351593 | 3300020294 | Marine | MSVLHHEALIETLFEEVLEEYPHLDEEQCESIAKARFEDMCQ |
| Ga0211615_10147793 | 3300020299 | Marine | MSVLHHEALLETIYEEVLEEYSHLDEESCESIAKARFEDLCQ |
| Ga0211542_100021121 | 3300020312 | Marine | MSVLHHESILETLYEEVLEEFPNLDEAHCEIIAKQRFEDMCQ |
| Ga0211542_10192075 | 3300020312 | Marine | MSVLHHESILETLYEEVVEEFPTFSEEQLEKIVYERFEDLCI |
| Ga0211542_10790101 | 3300020312 | Marine | MSVLHHESILETLFEEVCEEYPQFSEEQCEVIAQQRFEDLCQ |
| Ga0211510_100000728 | 3300020336 | Marine | MSVIHHEALLETIYEEVLEEYPQFDEEQCESIAYARFEDLCQ |
| Ga0211706_10736632 | 3300020345 | Marine | MSTLNHESILETLFEEVLEEYPQFDEEQCETIAKQRFEDMLQ |
| Ga0211706_11117132 | 3300020345 | Marine | MSVLHHEALLETLFEEVLEEYPQFDEEQCESIAKARFEDLCQ |
| Ga0211652_100271914 | 3300020379 | Marine | MSTLHHESLLESIYEEVLDEYFPQYDEEQCESIARQRFEDSLQ |
| Ga0211652_101286481 | 3300020379 | Marine | MSTLANEQILETLFEEVLSEYPQYDEEQCESIARARFEDLLQ |
| Ga0211476_101160282 | 3300020381 | Marine | MSCINNEALLETLFEEVLAEYPQFDEEQCESIAKARFEDYSN |
| Ga0211497_103433011 | 3300020394 | Marine | MSVLHHESLLETLYEEVCEEFPSYSEEQLETIAKARFEDLCQXVIKDQTYCD |
| Ga0211705_102230912 | 3300020395 | Marine | MSTLHHESILETLYEEVLEEYPQFDEEQCESIAKQRFEDLCQ |
| Ga0211587_1000007383 | 3300020411 | Marine | MSTLHHESILETLFEEVCEEYPQYTDEQCETIAYAR |
| Ga0211587_1001165912 | 3300020411 | Marine | MSVLHHEALLETLFEEVLEEYPQFDEEQCETIAKQRFEDLCQ |
| Ga0211587_100267062 | 3300020411 | Marine | MSCLQNEMILENIFEEVLAEYPQFDEEQCESIAKQRFEDMCQ |
| Ga0211587_100699593 | 3300020411 | Marine | MSTLHHESILETLYEEVCEEYPQFSEEQCETIAQQRFEDMCQ |
| Ga0211587_101046983 | 3300020411 | Marine | MSCLHNEALLETLFEEVLEEYPHLDEEACEAIAKARFEDYSN |
| Ga0211587_102770603 | 3300020411 | Marine | MSCLQNELLLESIFEEVLEEYPQFDEEQCESIAKQRFEDMCQ |
| Ga0211653_100147711 | 3300020421 | Marine | RSLTMSTLNHESILETLFEEVLEEYPQFDEEQCESIAKQRFEDMLQ |
| Ga0211521_1000278518 | 3300020428 | Marine | MSTLHHESILESIYEEVLDEYFPQYDEEQCESIARQRFEDSLQ |
| Ga0211521_101075221 | 3300020428 | Marine | MSVIHHEALLETIYEEVLEEYPQFDEEQCESIAYA |
| Ga0211708_100786322 | 3300020436 | Marine | MSCIQNEMILESLFDEVCEEFPNYDQKQLEAITMERFEAMCQ |
| Ga0211576_100707894 | 3300020438 | Marine | MSCIQNESILESLFDEVCEEYPQFDEDQCESIAKQRFEDMCQ |
| Ga0211564_1000444514 | 3300020445 | Marine | MSVLHHESILETLYEEVLEEFPTFSEEQIETITRQRFEDMCM |
| Ga0211564_100045236 | 3300020445 | Marine | MSVLHHESILETIYEEVLEEFPQLDEAHCEIIAKQRFEDMCQ |
| Ga0211564_1001686413 | 3300020445 | Marine | MSTLNHESILETLFEEVLEEYPQFDEEQCESIAKQRFEDMCQ |
| Ga0211564_100181965 | 3300020445 | Marine | MSVLHHESLLETIYEEVLDEYFPQYDEEQCESIARQRFEDLCQ |
| Ga0211564_100725835 | 3300020445 | Marine | MSVLHHESILETLYEEVLEEYPQFSEEQCETIAKQRFEDLCQ |
| Ga0211564_103641832 | 3300020445 | Marine | MSVLHHEALLETLFEEVLEEYPQFDEEQCESIARARFEDLCQ |
| Ga0211564_104679031 | 3300020445 | Marine | MSVLHHESLLETIYEEVLDEYPHLDEESCESIAKARFEDLCQ |
| Ga0211713_104863861 | 3300020467 | Marine | MSVLHHESLLESIYEEVLDEYFPQYDEEQCESIAR |
| Ga0211475_100331376 | 3300020468 | Marine | MSTLHHESILETIFEEVCEEYPQFDEEQCETIAYARFEELCQ |
| Ga0211543_100006946 | 3300020470 | Marine | MSTLHHESILETLYEEVLEEYPQYDEEQCEAIAKARFEEVCQ |
| Ga0211579_105974783 | 3300020472 | Marine | MSVLHHEALLETIFEEVLEEYPQFDEEQCESIARARFEDLCQ |
| Ga0211625_1001492314 | 3300020473 | Marine | MSCLHNEALLETLFEEVLAEYPHLDEEACESIAKARFEDYSN |
| Ga0211503_101742691 | 3300020478 | Marine | MSTLHHESILETLFEEVCEEYPQFSEEQCEVIAQQRFEDMCQ |
| Ga0209992_101588713 | 3300024344 | Deep Subsurface | MSCINNEALLETLFEEVLAEYPQFDEEQCESIAKARFEDYSR |
| Ga0209992_101656444 | 3300024344 | Deep Subsurface | SCLHNEALLETLFEEVLAEYPQFDEEQCESIAKARFEDYSN |
| Ga0209992_103755362 | 3300024344 | Deep Subsurface | MSCLHNEALLETLFEEVLAEYPQFDEEQCESIAKARFEDYSN |
| Ga0208011_10006113 | 3300025096 | Marine | MSVLHHESLLETIYEEVLDEYFPQYDEEQCESIARQRFEDSLQ |
| Ga0208790_10829812 | 3300025118 | Marine | MSTLQNESLMETIFEEVLEEWFPELDMEKCESIAKTRFESMCQ |
| Ga0209232_100349312 | 3300025132 | Marine | MSTLHHESILETLFEEVLEEYPQFDEEQCETIAKQRFEDMLQ |
| Ga0209232_10280397 | 3300025132 | Marine | EALLETLFEEVLAEYPQFDEEQCESIAKQRFEDYSR |
| Ga0208261_10424953 | 3300026076 | Marine | MSVLHHEALLETIYEEVLEEYPQFDEEQCESIAYARFEDLCQ |
| Ga0208276_10011785 | 3300026166 | Marine | MSTLANEILMETIFEEVLEEWFPEFDEEQCESIAKTRFESMCQ |
| Ga0208407_11207343 | 3300026257 | Marine | MSTLANEILMETIFEEVLEEWFPEFDEETCESIAKTRFESMCQ |
| Ga0208407_12221522 | 3300026257 | Marine | NRTKQSKLMSTLQHESILETLYEEVLEEYPQFDEDQCESIAKQRFQDFAQ |
| Ga0207992_10148347 | 3300026263 | Marine | MSVLSHESLLETIYEEVLDEYFPQYDEEQCESIARQRFEDSLQ |
| Ga0208766_100005111 | 3300026269 | Marine | MSTLQHESILETLYEEVLEEYPQFDEDQCESIAKQRFQDFAQ |
| Ga0208764_100730351 | 3300026321 | Marine | ESILETLYEEVLEEYPQFSEEQCETIAKQRFEDLCQ |
| Ga0209404_1000526314 | 3300027906 | Marine | MSTLANEQILETLFEEVLEEYPQYDEEQCESIARARFEDLLQ |
| Ga0209404_100837003 | 3300027906 | Marine | MSCIHNESILETIYEEVLEEFPQLDEAHCEIIAKQRFEDMCQ |
| Ga0209404_105103613 | 3300027906 | Marine | MSNIQNEMILENIYEEVLEEYPQFDEEQCETIAKARFEDLCQ |
| Ga0209404_105969493 | 3300027906 | Marine | MSNIQNEMILENIYEEVLEEYPQFDEEQCESIAKQRFEDLCQ |
| Ga0315331_101449815 | 3300031774 | Seawater | MSVLHHESILDTIYEEVLEEYPHLDEESCESIAKARFEDMCQ |
| Ga0310344_103603554 | 3300032006 | Seawater | MSNIHNEALLETIYEEVLEEYYPQFDEEQCESIAKQRFEDMAW |
| Ga0310344_106279303 | 3300032006 | Seawater | MSCLHNEALLETLFEEVLAEYPQYDEEACEAIAKARFEDYSN |
| Ga0310344_112170521 | 3300032006 | Seawater | ALLETIYEEVLEEYYPQFDEEQCESIAKQRFEDMAW |
| ⦗Top⦘ |