


| Basic Information | |
|---|---|
| Family ID | F058165 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 135 |
| Average Sequence Length | 44 residues |
| Representative Sequence | VSTIAVLIDPARMAEADAVLMMMYGSLSALVGAYFGFSGVAAKK |
| Number of Associated Samples | 101 |
| Number of Associated Scaffolds | 135 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 17.91 % |
| % of genes near scaffold ends (potentially truncated) | 62.22 % |
| % of genes from short scaffolds (< 2000 bps) | 88.15 % |
| Associated GOLD sequencing projects | 91 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.33 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (77.037 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh (62.222 % of family members) |
| Environment Ontology (ENVO) | Unclassified (63.704 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (92.593 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 52.78% β-sheet: 0.00% Coil/Unstructured: 47.22% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.33 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 135 Family Scaffolds |
|---|---|---|
| PF08734 | GYD | 14.81 |
| PF04828 | GFA | 6.67 |
| PF05838 | Glyco_hydro_108 | 1.48 |
| PF01124 | MAPEG | 0.74 |
| PF07883 | Cupin_2 | 0.74 |
| PF06146 | PsiE | 0.74 |
| PF16778 | Phage_tail_APC | 0.74 |
| PF02635 | DrsE | 0.74 |
| PF00561 | Abhydrolase_1 | 0.74 |
| PF14534 | DUF4440 | 0.74 |
| PF09374 | PG_binding_3 | 0.74 |
| PF01844 | HNH | 0.74 |
| PF00462 | Glutaredoxin | 0.74 |
| COG ID | Name | Functional Category | % Frequency in 135 Family Scaffolds |
|---|---|---|---|
| COG4274 | Uncharacterized conserved protein, contains GYD domain | Function unknown [S] | 14.81 |
| COG3791 | Uncharacterized conserved protein | Function unknown [S] | 6.67 |
| COG3926 | Lysozyme family protein | General function prediction only [R] | 1.48 |
| COG3223 | Phosphate starvation-inducible membrane PsiE (function unknown) | General function prediction only [R] | 0.74 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 78.52 % |
| Unclassified | root | N/A | 21.48 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000401|BB_Man_B_Liq_inBBDRAFT_1017249 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 915 | Open in IMG/M |
| 3300000422|BB_Man_A_Liq_inBBDRAFT_1006141 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae | 1486 | Open in IMG/M |
| 3300000947|BBAY92_10049069 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1149 | Open in IMG/M |
| 3300001956|GOS2266_1013262 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2272 | Open in IMG/M |
| 3300002040|GOScombined01_101400239 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2272 | Open in IMG/M |
| 3300003474|NAP4_1112677 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 570 | Open in IMG/M |
| 3300005510|Ga0066825_10231976 | All Organisms → cellular organisms → Bacteria | 680 | Open in IMG/M |
| 3300005934|Ga0066377_10012569 | All Organisms → cellular organisms → Bacteria | 2192 | Open in IMG/M |
| 3300006402|Ga0075511_1638353 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
| 3300006425|Ga0075486_1019085 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 555 | Open in IMG/M |
| 3300006617|Ga0101443_100177 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium HIMB11 | 4786 | Open in IMG/M |
| 3300006621|Ga0101441_119123 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales | 3446 | Open in IMG/M |
| 3300006868|Ga0075481_10019677 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium HIMB11 | 2675 | Open in IMG/M |
| 3300006869|Ga0075477_10229691 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 752 | Open in IMG/M |
| 3300006870|Ga0075479_10260096 | Not Available | 686 | Open in IMG/M |
| 3300006870|Ga0075479_10281632 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 654 | Open in IMG/M |
| 3300006874|Ga0075475_10448486 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales | 514 | Open in IMG/M |
| 3300007133|Ga0101671_1047917 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales | 624 | Open in IMG/M |
| 3300007137|Ga0101673_1020523 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1024 | Open in IMG/M |
| 3300007152|Ga0101672_1006201 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium HIMB11 | 1801 | Open in IMG/M |
| 3300007236|Ga0075463_10201355 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 641 | Open in IMG/M |
| 3300007623|Ga0102948_1040540 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales | 1506 | Open in IMG/M |
| 3300007725|Ga0102951_1082419 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 919 | Open in IMG/M |
| 3300009000|Ga0102960_1249988 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae | 628 | Open in IMG/M |
| 3300009001|Ga0102963_1091311 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae | 1243 | Open in IMG/M |
| 3300009001|Ga0102963_1150536 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium HIMB11 | 938 | Open in IMG/M |
| 3300009027|Ga0102957_1161802 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae | 795 | Open in IMG/M |
| 3300010300|Ga0129351_1172129 | Not Available | 848 | Open in IMG/M |
| 3300010300|Ga0129351_1312303 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 593 | Open in IMG/M |
| 3300010389|Ga0136549_10019220 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium HIMB11 | 4156 | Open in IMG/M |
| 3300010389|Ga0136549_10427521 | Not Available | 534 | Open in IMG/M |
| 3300012523|Ga0129350_1232995 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae | 548 | Open in IMG/M |
| 3300012528|Ga0129352_10817326 | Not Available | 528 | Open in IMG/M |
| 3300012528|Ga0129352_10858874 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae | 1059 | Open in IMG/M |
| 3300012528|Ga0129352_10941089 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 623 | Open in IMG/M |
| 3300016729|Ga0182056_1002681 | Not Available | 568 | Open in IMG/M |
| 3300016731|Ga0182094_1133822 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 658 | Open in IMG/M |
| 3300016732|Ga0182057_1295625 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae | 908 | Open in IMG/M |
| 3300016745|Ga0182093_1347543 | Not Available | 1921 | Open in IMG/M |
| 3300016746|Ga0182055_1241136 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium HIMB11 | 1987 | Open in IMG/M |
| 3300016749|Ga0182053_1015930 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae | 982 | Open in IMG/M |
| 3300016781|Ga0182063_1143860 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Planktomarina → Planktomarina temperata | 651 | Open in IMG/M |
| 3300016791|Ga0182095_1198152 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 723 | Open in IMG/M |
| 3300016791|Ga0182095_1233409 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae | 900 | Open in IMG/M |
| 3300017743|Ga0181402_1182135 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300017750|Ga0181405_1189758 | Not Available | 500 | Open in IMG/M |
| 3300017818|Ga0181565_10483264 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 807 | Open in IMG/M |
| 3300017818|Ga0181565_10616447 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 695 | Open in IMG/M |
| 3300017818|Ga0181565_10731429 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
| 3300017818|Ga0181565_10865772 | Not Available | 565 | Open in IMG/M |
| 3300017824|Ga0181552_10541927 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales | 545 | Open in IMG/M |
| 3300017824|Ga0181552_10584609 | Not Available | 520 | Open in IMG/M |
| 3300017949|Ga0181584_10455348 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 793 | Open in IMG/M |
| 3300017950|Ga0181607_10311457 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 881 | Open in IMG/M |
| 3300017951|Ga0181577_10353783 | Not Available | 943 | Open in IMG/M |
| 3300017951|Ga0181577_10469542 | All Organisms → cellular organisms → Bacteria | 791 | Open in IMG/M |
| 3300017951|Ga0181577_10948295 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
| 3300017952|Ga0181583_10819187 | Not Available | 546 | Open in IMG/M |
| 3300017952|Ga0181583_10826213 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 543 | Open in IMG/M |
| 3300017956|Ga0181580_10875798 | Not Available | 561 | Open in IMG/M |
| 3300017957|Ga0181571_10658380 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 629 | Open in IMG/M |
| 3300017957|Ga0181571_10678960 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae | 617 | Open in IMG/M |
| 3300017957|Ga0181571_10822538 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
| 3300017958|Ga0181582_10422906 | All Organisms → cellular organisms → Bacteria | 844 | Open in IMG/M |
| 3300017958|Ga0181582_10498886 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae | 758 | Open in IMG/M |
| 3300017958|Ga0181582_10600623 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
| 3300017958|Ga0181582_10740266 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Planktomarina | 589 | Open in IMG/M |
| 3300017964|Ga0181589_10566350 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 726 | Open in IMG/M |
| 3300017964|Ga0181589_10756631 | Not Available | 605 | Open in IMG/M |
| 3300017968|Ga0181587_10101883 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae | 2063 | Open in IMG/M |
| 3300017968|Ga0181587_10864659 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 561 | Open in IMG/M |
| 3300017969|Ga0181585_10408664 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae | 925 | Open in IMG/M |
| 3300017969|Ga0181585_10740762 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae | 640 | Open in IMG/M |
| 3300017969|Ga0181585_10775901 | Not Available | 622 | Open in IMG/M |
| 3300017969|Ga0181585_10927164 | Not Available | 558 | Open in IMG/M |
| 3300017986|Ga0181569_10211565 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae | 1362 | Open in IMG/M |
| 3300018036|Ga0181600_10198404 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae | 1073 | Open in IMG/M |
| 3300018036|Ga0181600_10288292 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae | 831 | Open in IMG/M |
| 3300018041|Ga0181601_10203976 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae | 1158 | Open in IMG/M |
| 3300018049|Ga0181572_10410716 | Not Available | 845 | Open in IMG/M |
| 3300018049|Ga0181572_10477530 | All Organisms → cellular organisms → Bacteria | 770 | Open in IMG/M |
| 3300018049|Ga0181572_10809384 | Not Available | 558 | Open in IMG/M |
| 3300018410|Ga0181561_10461524 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 572 | Open in IMG/M |
| 3300018410|Ga0181561_10469865 | Not Available | 566 | Open in IMG/M |
| 3300018417|Ga0181558_10225178 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae | 1060 | Open in IMG/M |
| 3300018421|Ga0181592_10589956 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales | 755 | Open in IMG/M |
| 3300018421|Ga0181592_11048477 | Not Available | 523 | Open in IMG/M |
| 3300018426|Ga0181566_11128521 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
| 3300018428|Ga0181568_10571826 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae | 894 | Open in IMG/M |
| 3300018876|Ga0181564_10494946 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 656 | Open in IMG/M |
| 3300019261|Ga0182097_1439121 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae | 712 | Open in IMG/M |
| 3300019274|Ga0182073_1508814 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 766 | Open in IMG/M |
| 3300019274|Ga0182073_1581126 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae | 884 | Open in IMG/M |
| 3300019276|Ga0182067_1465154 | All Organisms → cellular organisms → Bacteria | 990 | Open in IMG/M |
| 3300019277|Ga0182081_1501215 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae | 970 | Open in IMG/M |
| 3300019282|Ga0182075_1621933 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae | 1044 | Open in IMG/M |
| 3300019283|Ga0182058_1656238 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae | 884 | Open in IMG/M |
| 3300020051|Ga0181555_1224362 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium HIMB11 | 702 | Open in IMG/M |
| 3300020053|Ga0181595_10041466 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2626 | Open in IMG/M |
| 3300020054|Ga0181594_10468350 | Not Available | 517 | Open in IMG/M |
| 3300020168|Ga0181588_10006274 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae | 9438 | Open in IMG/M |
| 3300020178|Ga0181599_1058404 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae | 1887 | Open in IMG/M |
| 3300020189|Ga0181578_10120795 | All Organisms → cellular organisms → Bacteria | 1430 | Open in IMG/M |
| 3300020191|Ga0181604_10022728 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium HIMB11 | 4152 | Open in IMG/M |
| 3300020194|Ga0181597_10350228 | Not Available | 639 | Open in IMG/M |
| 3300020194|Ga0181597_10408676 | Not Available | 568 | Open in IMG/M |
| 3300020810|Ga0181598_1272394 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae | 613 | Open in IMG/M |
| 3300021356|Ga0213858_10104858 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium HIMB11 | 1380 | Open in IMG/M |
| 3300021364|Ga0213859_10021521 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae | 2999 | Open in IMG/M |
| 3300021364|Ga0213859_10052614 | Not Available | 1936 | Open in IMG/M |
| 3300021373|Ga0213865_10489527 | Not Available | 527 | Open in IMG/M |
| 3300021379|Ga0213864_10410025 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae | 683 | Open in IMG/M |
| 3300021379|Ga0213864_10487034 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium HIMB11 | 618 | Open in IMG/M |
| 3300021425|Ga0213866_10416229 | Not Available | 653 | Open in IMG/M |
| 3300022063|Ga0212029_1044676 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 638 | Open in IMG/M |
| 3300022907|Ga0255775_1294421 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae | 568 | Open in IMG/M |
| 3300022909|Ga0255755_1012058 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium HIMB11 | 5399 | Open in IMG/M |
| 3300022921|Ga0255765_1359212 | Not Available | 551 | Open in IMG/M |
| 3300022937|Ga0255770_10248136 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae | 856 | Open in IMG/M |
| 3300023084|Ga0255778_10040684 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium HIMB11 | 3021 | Open in IMG/M |
| 3300023108|Ga0255784_10534607 | Not Available | 527 | Open in IMG/M |
| 3300023110|Ga0255743_10135809 | All Organisms → cellular organisms → Bacteria | 1418 | Open in IMG/M |
| 3300023116|Ga0255751_10316565 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae | 807 | Open in IMG/M |
| 3300023170|Ga0255761_10242797 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae | 981 | Open in IMG/M |
| 3300023170|Ga0255761_10570214 | Not Available | 519 | Open in IMG/M |
| 3300023172|Ga0255766_10236349 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae | 970 | Open in IMG/M |
| 3300023173|Ga0255776_10606564 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales | 531 | Open in IMG/M |
| 3300023176|Ga0255772_10612079 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300025653|Ga0208428_1156549 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 607 | Open in IMG/M |
| 3300025810|Ga0208543_1113909 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 641 | Open in IMG/M |
| 3300025818|Ga0208542_1024700 | All Organisms → cellular organisms → Bacteria | 2001 | Open in IMG/M |
| 3300026085|Ga0208880_1018859 | All Organisms → cellular organisms → Bacteria | 1464 | Open in IMG/M |
| 3300028115|Ga0233450_10270366 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae | 741 | Open in IMG/M |
| 3300031673|Ga0307377_10581373 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 804 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 62.22% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 11.85% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 5.19% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 2.22% |
| Volcanic Co2 Seeps | Environmental → Aquatic → Marine → Volcanic → Unclassified → Volcanic Co2 Seeps | 2.22% |
| Pond Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water | 2.96% |
| Marine Surface Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine Surface Water | 1.48% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 1.48% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 1.48% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 1.48% |
| Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Water | 1.48% |
| Marine Methane Seep Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Marine Methane Seep Sediment | 1.48% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.74% |
| Estuarine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Estuarine | 0.74% |
| Bioluminescent Bay | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Sediment → Bioluminescent Bay | 0.74% |
| Bioluminescent Bay | Environmental → Aquatic → Non-Marine Saline And Alkaline → Unclassified → Unclassified → Bioluminescent Bay | 0.74% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.74% |
| Macroalgal Surface | Host-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface | 0.74% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000401 | Marine microbial community from La Parguera, Puerto Rico - BB Mangrove B Liquid | Environmental | Open in IMG/M |
| 3300000422 | Marine sediment microbial community from La Parguera, Puerto Rico - BB Mangrove A Sediment | Environmental | Open in IMG/M |
| 3300000947 | Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY92 | Host-Associated | Open in IMG/M |
| 3300001956 | Marine microbial communities from Rangirora Atoll, Polynesia Archipelagos - GS051 | Environmental | Open in IMG/M |
| 3300002040 | GS000c - Sargasso Station 3 | Environmental | Open in IMG/M |
| 3300003474 | Estuarine microbial communities from the Sarno estuary, Gulf of Naples, Italy - Sample Station 4 | Environmental | Open in IMG/M |
| 3300005510 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306SV45 | Environmental | Open in IMG/M |
| 3300005934 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S23_td_SurfaceB_ad_5m_LV_B | Environmental | Open in IMG/M |
| 3300006402 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006425 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006617 | Marine coastal surface water microbial communities in Port Hacking, Sydney, Australia ? TJ09 time point | Environmental | Open in IMG/M |
| 3300006621 | Marine coastal surface water microbial communities in Port Hacking, Sydney, Australia ? TJ07 time point | Environmental | Open in IMG/M |
| 3300006868 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006869 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006870 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006874 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_DNA | Environmental | Open in IMG/M |
| 3300007133 | Seawater microbiome, Papua New Guinea CO2 seep, Dobu 'bubble', water-ds | Environmental | Open in IMG/M |
| 3300007137 | Seawater microbiome, Papua New Guinea CO2 seep, Dobu 'control', water-dc | Environmental | Open in IMG/M |
| 3300007152 | Seawater microbiome, Papua New Guinea CO2 seep, Dobu 'bubble', waterEBds3 | Environmental | Open in IMG/M |
| 3300007236 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_DNA | Environmental | Open in IMG/M |
| 3300007623 | Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_A_H2O_MG | Environmental | Open in IMG/M |
| 3300007725 | Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_B_H2O_MG | Environmental | Open in IMG/M |
| 3300009000 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_B_H2O_MG | Environmental | Open in IMG/M |
| 3300009001 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MG | Environmental | Open in IMG/M |
| 3300009027 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_A_H2O_MG | Environmental | Open in IMG/M |
| 3300010300 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_DNA | Environmental | Open in IMG/M |
| 3300010389 | Marine sediment microbial communities from methane seeps within Baltimore Canyon, US Atlantic Margin - Baltimore Canyon MUC-11 12-14 cmbsf | Environmental | Open in IMG/M |
| 3300011252 | Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2014_4, permeate | Environmental | Open in IMG/M |
| 3300012523 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012528 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016729 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101402AT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016731 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041412AT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016732 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101403AT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016745 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041411BS metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016746 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101401AT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016749 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011512AT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016781 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101409CT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016791 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041412BS metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017743 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 25 SPOT_SRF_2011-08-17 | Environmental | Open in IMG/M |
| 3300017750 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 28 SPOT_SRF_2011-11-29 | Environmental | Open in IMG/M |
| 3300017818 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101401AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017824 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011501BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017949 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071406AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017950 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041413US metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017951 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101413BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017952 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071405CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017956 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071403BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017957 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101407AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017958 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071405AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017964 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071410BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017968 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071409AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017969 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071407BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017986 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101405AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018036 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041406US metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018041 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041407BS metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018049 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101408AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018410 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011510BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018417 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011507BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018421 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018426 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101402AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018428 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101404AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018876 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011513CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300019261 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041413BS (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019274 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071405CT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019276 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101413AT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019277 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071412AT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019282 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071407BT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019283 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101404CT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020051 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011504AT metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020053 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041401AS metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020054 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071413BT metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020168 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071409BT metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020178 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041405US metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020189 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071401CT metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020191 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041410US metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020194 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041403US metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020810 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041404US metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300021356 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO245 | Environmental | Open in IMG/M |
| 3300021364 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO304 | Environmental | Open in IMG/M |
| 3300021373 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO282 | Environmental | Open in IMG/M |
| 3300021379 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO247 | Environmental | Open in IMG/M |
| 3300021425 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO284 | Environmental | Open in IMG/M |
| 3300022063 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v2) | Environmental | Open in IMG/M |
| 3300022907 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011511BT metaG | Environmental | Open in IMG/M |
| 3300022909 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011501BT metaG | Environmental | Open in IMG/M |
| 3300022921 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041407BS metaG | Environmental | Open in IMG/M |
| 3300022937 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071404AT metaG | Environmental | Open in IMG/M |
| 3300023084 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071405CT metaG | Environmental | Open in IMG/M |
| 3300023108 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101403AT metaG | Environmental | Open in IMG/M |
| 3300023110 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101405AT metaG | Environmental | Open in IMG/M |
| 3300023116 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412BT metaG | Environmental | Open in IMG/M |
| 3300023170 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071407BT metaG | Environmental | Open in IMG/M |
| 3300023172 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071403BT metaG | Environmental | Open in IMG/M |
| 3300023173 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071413AT metaG | Environmental | Open in IMG/M |
| 3300023176 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071411BT metaG | Environmental | Open in IMG/M |
| 3300025653 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025818 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300026085 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S23_td_SurfaceB_ad_5m_LV_B (SPAdes) | Environmental | Open in IMG/M |
| 3300028115 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011501CT (spades assembly) | Environmental | Open in IMG/M |
| 3300031673 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-3 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| BB_Man_B_Liq_inBBDRAFT_10172493 | 3300000401 | Bioluminescent Bay | LWITFMIVFTIAVLVDPARMSKAAAVPMMCGSLSALVGAYFGFSGVAAKK* |
| BB_Man_A_Liq_inBBDRAFT_10061412 | 3300000422 | Bioluminescent Bay | VSTIAVLIDPARMAEADAVLMMMYGSLSALVDAYFGFSRVVAIK* |
| BBAY92_100490693 | 3300000947 | Macroalgal Surface | MYTRTQHARPSLGITIVSAITLLVDPARMTEEDAVPIMTYGSLSALVIVYFGFSGGAAKK |
| GOS2266_10132624 | 3300001956 | Marine | MIVSTITILIETARMAEANAAPIMMHGSLLALVGAYFGFSGGAAKK* |
| GOScombined01_1014002394 | 3300002040 | Marine | MIVSTITILIETPRMAEANAAPIMMHGSLLALVGAYFGFSGGAAKK* |
| NAP4_11126771 | 3300003474 | Estuarine | MMIVSTIAVLVDPARMSKADAVPMMCGSLSALVGAYFGFSGVAAKK* |
| Ga0066825_102319762 | 3300005510 | Marine | STIAVLIDPARMAEADAVLMMMYGSLSALVGAYFGFSGGAVKK* |
| Ga0066377_100125691 | 3300005934 | Marine | MERTALGMMIVSTIAVLIEPARMTEADAVPLMMMYGSLSALVGAYFGFSVGDAKK* |
| Ga0075511_16383532 | 3300006402 | Aqueous | MAEANAVLMMMYGSRSALVSAYFSFSGWAVKKSN* |
| Ga0075486_10190853 | 3300006425 | Aqueous | LIDPARMAEANAVLMMMYGSRSALVSAYFSFSGWAVKKSN* |
| Ga0101443_1001772 | 3300006617 | Marine Surface Water | MIVSTIAALIDPARMAKADAALMMMYGSRSAMVSVYFGFSGVAAKK* |
| Ga0101441_1191236 | 3300006621 | Marine Surface Water | MIVSTIAVLIDPARMAEADAVLMMMYGSLSALVCAYFGFSVGAAKK* |
| Ga0075481_100196777 | 3300006868 | Aqueous | LRLWNTLTIVATFAVLIDPARMAEANAVLMMYGSRSALVSAYFSFSGWAVKKSN* |
| Ga0075477_102296913 | 3300006869 | Aqueous | TALGMMIVSTIAVLIDPARMAEEDAVLMMMYGSLSALVGAYFGFSGVAAKQ* |
| Ga0075479_102600961 | 3300006870 | Aqueous | IDPARMAEADAVLMMMYGSLSALVGAYFGFSGAGKK* |
| Ga0075479_102816323 | 3300006870 | Aqueous | TIAVLIDPARMAEADAVLMMMYGSLSALVGAYFGFSGVAAKK* |
| Ga0075475_104484861 | 3300006874 | Aqueous | PARMAEADAVLMMMYGSLSALVGAYFGFSGGAANKNAS* |
| Ga0101671_10479172 | 3300007133 | Volcanic Co2 Seeps | MIVSTITILIEPARMAEANAAPIMMHGSLLALVGAYFGFSGGAAKK* |
| Ga0101673_10205231 | 3300007137 | Volcanic Co2 Seeps | MIVSTIIILTETARMAEADATPIMMHGSLLALVGAYFGFSGGAAKK* |
| Ga0101672_10062011 | 3300007152 | Volcanic Co2 Seeps | MIVLTITILIETARMAEADAAPIMMHGSLLALVGAYFGYFGRTVYK* |
| Ga0075463_102013551 | 3300007236 | Aqueous | IDPARMAEANAVLMMMYGSRSALVSAYFSFSGWAVKKSN* |
| Ga0102948_10405404 | 3300007623 | Water | VSTIVVLIDPARMAEADAVLIVMYGSLSALVDAYFGFSRVVAIK* |
| Ga0102951_10824193 | 3300007725 | Water | VSTIAVLIDPARMAEADAVLIVMYGSLSALVDAYFGFSRVVAIK* |
| Ga0102960_12499881 | 3300009000 | Pond Water | MMIVSTIAVLIDPARMAEEDAVLMMMYGSLSALVGAYFGFSG |
| Ga0102963_10913112 | 3300009001 | Pond Water | VSTIAVLIDPARMAEADAVLMVMYGSLSALVDAYFGFSRVVAIK* |
| Ga0102963_11505364 | 3300009001 | Pond Water | TIVATFAVLIDPARMAEANAVLMMMYGSRSALVSAYFSFSGWAVKKSN* |
| Ga0102957_11618021 | 3300009027 | Pond Water | MMIVSTIAVLIDPARMAEEDAVLMMMYGSLSALVGAYFGFSGVAAKQ* |
| Ga0129351_11721293 | 3300010300 | Freshwater To Marine Saline Gradient | AVLIDPARMAEADAVLMMMYGSLSALVGAYFGFSGAGKK* |
| Ga0129351_13123033 | 3300010300 | Freshwater To Marine Saline Gradient | MIVSTIAVLVDPARMSKADAVPMMCGSLSALVGAYFGLSGVAAKK* |
| Ga0136549_100192204 | 3300010389 | Marine Methane Seep Sediment | LRLWNTLTIVATFAVLIDPARMAEANAVLMMMYGSRSALVSAYFSFSGWAVKKSN* |
| Ga0136549_104275212 | 3300010389 | Marine Methane Seep Sediment | TALGMMIVSMIAVLIDPARMAEADAVLMMMYGSLSALVSAYFGFSGVAAKK* |
| Ga0151674_10752644 | 3300011252 | Marine | MMVAATIAVIVDPARMAQADAQMMMMYGSLSALVGAFFAVGHKEV* |
| Ga0129350_12329951 | 3300012523 | Aqueous | KFVTLCSLAGVKRLWTTEMIVSTIAVLIDPARTAEEDAVLMMMYGSLSALVGAYFGYSGVATRK* |
| Ga0129352_108173261 | 3300012528 | Aqueous | LRLWITFMILSTIAVLIDPARMAEADAVLMMMYGSLSALVSAYFGFSGVAAKK* |
| Ga0129352_108588744 | 3300012528 | Aqueous | LIDPARMAEADAVLMMMYGSLSALVSAYFSFSGGATKK* |
| Ga0129352_109410891 | 3300012528 | Aqueous | LRLWITLTIVSTIAALIDPARMAEADAVLMVMYGSLSALVDAYFGFSRVVAIK* |
| Ga0182056_10026812 | 3300016729 | Salt Marsh | MMIVSTIAVLIDPARMAEEDAVLMMMYGSLSALVGAYFGFSGGATRK |
| Ga0182094_11338222 | 3300016731 | Salt Marsh | MMIVSTIAVFVDPARMSKADAVPMMCGSLSALVGPYFGFSGGAAMK |
| Ga0182057_12956253 | 3300016732 | Salt Marsh | LRLWITLTIVSTIAVLIDPARMAEADAVLIVMYGSLSALVDAYFGFSRVVAIK |
| Ga0182093_13475434 | 3300016745 | Salt Marsh | MMIVSTIAVFVDLARMSKADAVPMMCGSLSALVGPYFGFFGGAAKK |
| Ga0182055_12411366 | 3300016746 | Salt Marsh | TIAVLIDPARMAKTNAVLMMMYGSLSALVGAYFGFSGGAAK |
| Ga0182053_10159303 | 3300016749 | Salt Marsh | LIDPARMAEANAVLMMMYGSRSALVSAYFSFSGWAVKKSN |
| Ga0182063_11438602 | 3300016781 | Salt Marsh | MMIVSTIAMLIDPARMAEEDAVLMMMYGSLSALVGAYFGFSGVAAKQ |
| Ga0182095_11981523 | 3300016791 | Salt Marsh | STIAVLIDPARMAEADAVLMMMYGSLSALVGAYFGFSGVAAKNT |
| Ga0182095_12334093 | 3300016791 | Salt Marsh | STIAVLIDPARMAEADAVLMMMYGSLSALVGAYFGFSGGAAK |
| Ga0181402_11821351 | 3300017743 | Seawater | MAEADSVLMAQYIALSGLVGAYFGFSGMMAKKDQEMK |
| Ga0181405_11897581 | 3300017750 | Seawater | IIDPKRMAEADSMIMAMYISLSGLVGAYFGFSGMVAKKDQAAK |
| Ga0181565_104832643 | 3300017818 | Salt Marsh | MMIVSTIAVLIDPARMAEEDAVLMMMYGSLSALVGAYFGFSGVAAKQ |
| Ga0181565_106164471 | 3300017818 | Salt Marsh | MMIVPTIAVLVDPARMSKADALPMMCGSLSAFVGAYFGFSGVASKK |
| Ga0181565_107314293 | 3300017818 | Salt Marsh | VATFAVLIDPARMAEADAVLMTMYRSLSALVSAYFSFSGGAVKKSN |
| Ga0181565_108657721 | 3300017818 | Salt Marsh | MAWSALGMMIISTIAVLIDPARVAEADAVLMMMYGSLSALVDAYFGFSGGAVKK |
| Ga0181552_105419272 | 3300017824 | Salt Marsh | MIVSTIAVLIDPARMAEADAVLMVMYGSLSARVDAYFGFSGGTVKK |
| Ga0181552_105846092 | 3300017824 | Salt Marsh | LRLWITLTIVSTIAVLIDPARMAEADAVLMMCGSLSALVGAYFGFSGGAVKKSN |
| Ga0181584_104553483 | 3300017949 | Salt Marsh | MMIVSTIAVLIDPARMAEEDAVLMMMMYGSLSALVGAYFGFSGVAAKQ |
| Ga0181607_103114572 | 3300017950 | Salt Marsh | STIAVLIDPARMAEADAVLMMMYGSLSALVGAYFGFSGGAVKK |
| Ga0181577_103537832 | 3300017951 | Salt Marsh | VTLEGGSLAGVKRLWTSLMIVSTIAVLMDPARMAEADAVLMMMYGSLSALVGAYFGSSGGATKK |
| Ga0181577_104695421 | 3300017951 | Salt Marsh | IDPARMAEADAVLMMMYGSLSALVGAYFGFSGVAKSK |
| Ga0181577_109482951 | 3300017951 | Salt Marsh | RMAEADAVLMTIYGSLSALVSAYFSFSGGAVKKST |
| Ga0181583_108191872 | 3300017952 | Salt Marsh | LIDPARMAEADAVLMMMYGSLSALVDSYFGFSGGAVKK |
| Ga0181583_108262131 | 3300017952 | Salt Marsh | GVKRLWTTLTIVSTIAVLIDPARMAEAGAVLMMMYGSLSALVGAYFGFSGVAAKNT |
| Ga0181580_108757981 | 3300017956 | Salt Marsh | IDPARMAEADAVLMVMYGSLSALVDAYFGFSGGAVQK |
| Ga0181571_106583802 | 3300017957 | Salt Marsh | PARMAEADAVLMMMYGSLSALVGAYFGFSGVAAKNT |
| Ga0181571_106789601 | 3300017957 | Salt Marsh | LGMMIVSTIAVLIDPARMAKTDAVLMMMYGSLSALVGAYFGFSGGATRK |
| Ga0181571_108225381 | 3300017957 | Salt Marsh | PARMAEANAVLMMMYGSRSALVSAYFSFSGWAVKKSN |
| Ga0181582_104229063 | 3300017958 | Salt Marsh | VSTIAVLVDPARMAEADAVLMMMYGSLSALVGAYFGFSGGAKSK |
| Ga0181582_104988863 | 3300017958 | Salt Marsh | LIDPTRMAEADAVLMMMYGSLSALVGAYFGFSGGAAKK |
| Ga0181582_106006233 | 3300017958 | Salt Marsh | DPARMAEADAVLMMMYGSLSALVGAYFGFSGGAATK |
| Ga0181582_107402662 | 3300017958 | Salt Marsh | STIAVLIDPARMAEEDAVLMMMYGSLSALVGAYFGFSGGAKGN |
| Ga0181589_105663503 | 3300017964 | Salt Marsh | GMMIVSTIAVLIDPARMAEEDAVLMMMYGSLSALVGAYFGFSGVAAKQ |
| Ga0181589_107566313 | 3300017964 | Salt Marsh | LWITLTIVSTIAVLIDPARMAEADAVLMMMYGSLSALVDAYFGFSGGAVKK |
| Ga0181587_101018835 | 3300017968 | Salt Marsh | VATFAVLIDPARMAEADAVLMTMYRSLSALVSAYFSFSGGAVKKST |
| Ga0181587_108646591 | 3300017968 | Salt Marsh | IVPTIAVLVDPARMSKADALPMMCGSLSAFVGAYFGFSGVASKK |
| Ga0181585_104086643 | 3300017969 | Salt Marsh | IVSTIADLIDPTRMAEADAVLMMMYGSLSALVGAYFGFSGGAAKK |
| Ga0181585_107407621 | 3300017969 | Salt Marsh | IDPARMAEEDAVLMMMYGSLSALVGAYFGFSGGATRK |
| Ga0181585_107759011 | 3300017969 | Salt Marsh | MIVSTIAVLIDPARMAEADAVLMVMYGSLSALVDAYFGFSGGTVNK |
| Ga0181585_109271642 | 3300017969 | Salt Marsh | TIAVLIDPARMAEADAVLIVMYGSLSALVDAYFGFSGGAVKK |
| Ga0181569_102115652 | 3300017986 | Salt Marsh | MMIVSTIAVFVDPARMSKADALPMMCGSLSAFVGAYFGFSGVASKK |
| Ga0181600_101984042 | 3300018036 | Salt Marsh | VATFAVLIDPARMAEADAVLMTIYGSLSALVSAYFSFSGGAVKKST |
| Ga0181600_102882921 | 3300018036 | Salt Marsh | MAEADAILMMMYGSLSALVGAYFGFSGVAANKNAS |
| Ga0181601_102039762 | 3300018041 | Salt Marsh | VATFAVLIDPARMAEADAVLMTIYGSLSALVSAYFSFSGGAVKKSN |
| Ga0181572_104107161 | 3300018049 | Salt Marsh | TIAVLIDPARMAEADAVLMMMYGSLSALVGAYFGFSGGAAKK |
| Ga0181572_104775301 | 3300018049 | Salt Marsh | TIAVLIDPARMAEADAVLMMMYGSLSALVGAYFGFSGVAAKK |
| Ga0181572_108093843 | 3300018049 | Salt Marsh | DPARMDEADAVLMVMYGSLSALVDAYFGFSGGAVKK |
| Ga0181561_104615241 | 3300018410 | Salt Marsh | SLMIVSRIAVLMDPARMAEADAVLMYGSLSALVGAYFGFSGGAAK |
| Ga0181561_104698652 | 3300018410 | Salt Marsh | RLWTSLMIVSTIAVLIDPARMAEADAVLMMMYGSLSALVDAYFGFSGGAVKK |
| Ga0181558_102251783 | 3300018417 | Salt Marsh | IDPARMAEADAVLMMMYGSLSALVGAYFGFSGVAAKNT |
| Ga0181592_105899562 | 3300018421 | Salt Marsh | VTLCGLAGVKRLWTSLMIVSTIAVLMDPARMAEADAVLMMMYGSLSALVDAYFGFSGGTVKK |
| Ga0181592_110484771 | 3300018421 | Salt Marsh | MIVSTIAVLIDPARMAEADAVLMVMYGSLSALVDA |
| Ga0181566_111285211 | 3300018426 | Salt Marsh | RMAEANAVLMMMYGSRSALVSAYFSFSGGAVKKSN |
| Ga0181568_105718264 | 3300018428 | Salt Marsh | TIAVLIDPARMAEADAVLMMMYGSLSALVGAYFGFSGVAANKNAS |
| Ga0181564_104949461 | 3300018876 | Salt Marsh | TIAVLIDPARMAEADAVLMMMYGSLSALVGAYFGFSGGAAK |
| Ga0182097_14391213 | 3300019261 | Salt Marsh | FAVLIDPARMAEANAVLMMMYGSRSALVSAYFSFSGWAVKKSN |
| Ga0182073_15088143 | 3300019274 | Salt Marsh | VSTIAVLIDPARMAEADAVLIVMYGSLSALVDAYFGFSRVVAIK |
| Ga0182073_15811261 | 3300019274 | Salt Marsh | ARMAEANAVLMMMYGSRSALVSAYFSFSGWAVKKSN |
| Ga0182067_14651541 | 3300019276 | Salt Marsh | ARMAEADAVLMMMYGSLSALVGAYFGFSGAGKKVRPANPLA |
| Ga0182081_15012151 | 3300019277 | Salt Marsh | IAVLIDPARMAEADAVLMYGSLSALVDAYFGFSRVVAIK |
| Ga0182075_16219333 | 3300019282 | Salt Marsh | LWNTLTIVATFAVLIDPARMAEANAVLMMMYGSRSALVSAYFSFSGWAVKKSN |
| Ga0182058_16562382 | 3300019283 | Salt Marsh | VSTIAVLIDPARMAEADAVLMYGSLSALVDAYFGFSRVVAIK |
| Ga0181555_12243621 | 3300020051 | Salt Marsh | VSTIAVLIDPARMAEADAVLMMCGSLSALVGAYFGFSGGAVKKSN |
| Ga0181595_100414665 | 3300020053 | Salt Marsh | MMIVSTIAVFVDPARMSKADAVPMMCGSLSALVGPYFGFSGGAAKK |
| Ga0181594_104683501 | 3300020054 | Salt Marsh | MIVSTIAVLIDPARMAEADAVLMVMYGSLSALVDAYFGFSGGTVKK |
| Ga0181588_100062742 | 3300020168 | Salt Marsh | LRLWNTLTIVATFAVLIDPARMAEANAVLMMMYGSRSALVSAYFSFSGWAVKKSN |
| Ga0181599_10584044 | 3300020178 | Salt Marsh | MMIVSTIAVFVDPARMSKADAVPMMCGSLSALVGPYFGFFGGAAKK |
| Ga0181578_101207955 | 3300020189 | Salt Marsh | VLIDPARMAKTDAVLMMMYGSLSALVGAYFGFSGGATRK |
| Ga0181604_100227281 | 3300020191 | Salt Marsh | ARMAEADAVLMMMYGSLSALVGAYFGFSGVAANKNAS |
| Ga0181597_103502281 | 3300020194 | Salt Marsh | MIVSTIAVLIDPARMAEADAVLMMMYGSLSALVDAYFGFSGGAVKK |
| Ga0181597_104086761 | 3300020194 | Salt Marsh | VSTIAVLIDPARMAEADAVLMMMYGSLSALVGAYFGFSG |
| Ga0181598_12723941 | 3300020810 | Salt Marsh | NKRRMAXTALGMMIVSTIAVFVDPARMSKADAVPMMCGSLSALVGPYFGFFGGAAKK |
| Ga0213858_101048585 | 3300021356 | Seawater | PARMAEADAVLMMMYGSLSALVGAYFGFSGVAANKNAS |
| Ga0213859_100215217 | 3300021364 | Seawater | MMIVSTIAVLVDPARMSKADAVPMMCGSLSALVGAYFGFSGVAAKK |
| Ga0213859_100526143 | 3300021364 | Seawater | VSTIAVLIDPARMAEADAVLMMMYGSLSALVDAYFGFSRVVAIK |
| Ga0213865_104895271 | 3300021373 | Seawater | VSTIAVLIDPARMAEADAVLMMMYGSLSALVGAYFGFSGVAAKK |
| Ga0213864_104100252 | 3300021379 | Seawater | VSTIAVLIDPARMAEADAVLMMMYGSLSALVGAYFGFSGGATKK |
| Ga0213864_104870341 | 3300021379 | Seawater | VDLARMAEADAVLMMMKGSLSVLVGAYFGFSGGARMK |
| Ga0213866_104162291 | 3300021425 | Seawater | MIVSTFAVFIDPARMAEADAVLMMMYGSLSALVGAYFGFSGGAVQK |
| Ga0212029_10446763 | 3300022063 | Aqueous | AAVIYDPERMAKAEAILMMMYGSLSALVGAYFGFANMGRQE |
| Ga0255775_12944211 | 3300022907 | Salt Marsh | STIAVLIDPARMAEADAVLMMMYGSLSALVGAYFGFSGVAANKNAS |
| Ga0255755_10120583 | 3300022909 | Salt Marsh | MMIVSTIAVLIDPARMAEEDAVLMMMYGSLSALVGAYFGFSGGVAKK |
| Ga0255765_13592121 | 3300022921 | Salt Marsh | LIDPARMAEADAVLMMMYGSLSALVGAYFGFSGGAAKK |
| Ga0255770_102481364 | 3300022937 | Salt Marsh | MAEADAVLMMMYGSLSALVGAYFGFSGVAANKNAS |
| Ga0255778_100406841 | 3300023084 | Salt Marsh | IADLIDPTRMAEADAVLMMMYGSLSALVGAYFGFSGGAAKK |
| Ga0255784_105346071 | 3300023108 | Salt Marsh | LIDPARMAEADAVLMMMYGSLSALVDAYFGFSGGAVKK |
| Ga0255743_101358091 | 3300023110 | Salt Marsh | IDPARMAEADAVLMMMYGSLSALVGAYFGFSGGAAK |
| Ga0255751_103165651 | 3300023116 | Salt Marsh | ARIAEADAVLMMMYGSLSALVGAYFGFSGVAANKNAS |
| Ga0255761_102427971 | 3300023170 | Salt Marsh | VLIDPARMAEADAVLMMMYGSLSALVGAYFGFSGVAANKNAS |
| Ga0255761_105702141 | 3300023170 | Salt Marsh | LTIAVLIDPARMAEADAVLMMMYGSLSALVGAYFGFSGGAAKK |
| Ga0255766_102363491 | 3300023172 | Salt Marsh | VSTIAVLIDPARMAEADAVLMMMYGSLSALVGAYFGFSGVAANKNAS |
| Ga0255776_106065641 | 3300023173 | Salt Marsh | VLIDPARMAEADAVLMVMYGSLSALVDAYFGFSGGTVKK |
| Ga0255772_106120792 | 3300023176 | Salt Marsh | PARMAEADAVLMTMYGSLSALVSAYFSFSGGAVKKST |
| Ga0208428_11565492 | 3300025653 | Aqueous | VSTIAVLIDPARMAEADAVLMVMYGSLSALVDAYFGFSRVVAIK |
| Ga0208543_11139093 | 3300025810 | Aqueous | IDPARMAEANAVLMMMYGSRSALVSAYFSFSGWAVKKSN |
| Ga0208542_10247004 | 3300025818 | Aqueous | MMIVTTLAVIYDPVRMNQASAVLMMMYGSLSAVVGAYFGFSAGIKKQ |
| Ga0208880_10188592 | 3300026085 | Marine | MERTALGMMIVSTIAVLIEPARMTEADAVPLMMMYGSLSALVGAYFGFSGGAVKK |
| Ga0233450_102703661 | 3300028115 | Salt Marsh | VLIDPARMAEADAVLMMMYGSLSALVGAYFGFSGGAAK |
| Ga0307377_105813733 | 3300031673 | Soil | AMMIVSTLAVIYDPARMAQAEAVLMMMYGSLSALVGAYFGFASTGQGK |
| ⦗Top⦘ |