


| Basic Information | |
|---|---|
| Family ID | F057889 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 135 |
| Average Sequence Length | 41 residues |
| Representative Sequence | VRKNCSSDREKLLKFEAEGREFAKILRSLEQFIQTVKGQNNFW |
| Number of Associated Samples | 53 |
| Number of Associated Scaffolds | 135 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Eukaryota |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 83.70 % |
| % of genes from short scaffolds (< 2000 bps) | 98.52 % |
| Associated GOLD sequencing projects | 45 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.51 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Eukaryota (100.000 % of family members) |
| NCBI Taxonomy ID | 2759 |
| Taxonomy | All Organisms → cellular organisms → Eukaryota |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine (48.148 % of family members) |
| Environment Ontology (ENVO) | Unclassified (62.963 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (89.630 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 53.52% β-sheet: 0.00% Coil/Unstructured: 46.48% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.51 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 135 Family Scaffolds |
|---|---|---|
| PF00876 | Innexin | 2.22 |
| PF03271 | EB1 | 0.74 |
| PF11540 | Dynein_IC2 | 0.74 |
| PF04923 | Ninjurin | 0.74 |
| PF00067 | p450 | 0.74 |
| PF00378 | ECH_1 | 0.74 |
| PF00066 | Notch | 0.74 |
| PF13840 | ACT_7 | 0.74 |
| PF14969 | DUF4508 | 0.74 |
| PF12874 | zf-met | 0.74 |
| COG ID | Name | Functional Category | % Frequency in 135 Family Scaffolds |
|---|---|---|---|
| COG2124 | Cytochrome P450 | Defense mechanisms [V] | 0.74 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 100.00 % |
| Unclassified | root | N/A | 0.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002033|GOS24894_10224961 | All Organisms → cellular organisms → Eukaryota | 1542 | Open in IMG/M |
| 3300002040|GOScombined01_102442188 | All Organisms → cellular organisms → Eukaryota | 1542 | Open in IMG/M |
| 3300002040|GOScombined01_105983323 | All Organisms → cellular organisms → Eukaryota | 905 | Open in IMG/M |
| 3300007957|Ga0105742_1043947 | All Organisms → cellular organisms → Eukaryota | 602 | Open in IMG/M |
| 3300007957|Ga0105742_1056328 | All Organisms → cellular organisms → Eukaryota | 559 | Open in IMG/M |
| 3300007958|Ga0105743_1049342 | All Organisms → cellular organisms → Eukaryota | 506 | Open in IMG/M |
| 3300007972|Ga0105745_1263131 | All Organisms → cellular organisms → Eukaryota | 556 | Open in IMG/M |
| 3300008998|Ga0103502_10044191 | All Organisms → cellular organisms → Eukaryota | 1478 | Open in IMG/M |
| 3300009432|Ga0115005_11585715 | All Organisms → cellular organisms → Eukaryota | 537 | Open in IMG/M |
| 3300009436|Ga0115008_10430804 | All Organisms → cellular organisms → Eukaryota | 937 | Open in IMG/M |
| 3300009436|Ga0115008_10467631 | All Organisms → cellular organisms → Eukaryota | 898 | Open in IMG/M |
| 3300009436|Ga0115008_10539700 | All Organisms → cellular organisms → Eukaryota | 835 | Open in IMG/M |
| 3300009436|Ga0115008_10572071 | All Organisms → cellular organisms → Eukaryota | 812 | Open in IMG/M |
| 3300009436|Ga0115008_10587796 | All Organisms → cellular organisms → Eukaryota | 801 | Open in IMG/M |
| 3300009436|Ga0115008_10597390 | All Organisms → cellular organisms → Eukaryota | 794 | Open in IMG/M |
| 3300009436|Ga0115008_10660213 | All Organisms → cellular organisms → Eukaryota | 757 | Open in IMG/M |
| 3300009436|Ga0115008_10667334 | All Organisms → cellular organisms → Eukaryota | 753 | Open in IMG/M |
| 3300009436|Ga0115008_10684507 | All Organisms → cellular organisms → Eukaryota | 743 | Open in IMG/M |
| 3300009436|Ga0115008_10745658 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis | 714 | Open in IMG/M |
| 3300009436|Ga0115008_10833681 | All Organisms → cellular organisms → Eukaryota | 678 | Open in IMG/M |
| 3300009436|Ga0115008_10837569 | All Organisms → cellular organisms → Eukaryota | 676 | Open in IMG/M |
| 3300009436|Ga0115008_10876940 | All Organisms → cellular organisms → Eukaryota | 662 | Open in IMG/M |
| 3300009436|Ga0115008_10890416 | All Organisms → cellular organisms → Eukaryota | 657 | Open in IMG/M |
| 3300009436|Ga0115008_10901078 | All Organisms → cellular organisms → Eukaryota | 654 | Open in IMG/M |
| 3300009436|Ga0115008_10967071 | All Organisms → cellular organisms → Eukaryota | 633 | Open in IMG/M |
| 3300009436|Ga0115008_10987906 | All Organisms → cellular organisms → Eukaryota | 627 | Open in IMG/M |
| 3300009436|Ga0115008_11023608 | All Organisms → cellular organisms → Eukaryota | 617 | Open in IMG/M |
| 3300009436|Ga0115008_11235318 | All Organisms → cellular organisms → Eukaryota | 568 | Open in IMG/M |
| 3300009436|Ga0115008_11236459 | All Organisms → cellular organisms → Eukaryota | 568 | Open in IMG/M |
| 3300009436|Ga0115008_11239653 | All Organisms → cellular organisms → Eukaryota | 567 | Open in IMG/M |
| 3300009436|Ga0115008_11274032 | All Organisms → cellular organisms → Eukaryota | 560 | Open in IMG/M |
| 3300009436|Ga0115008_11293407 | All Organisms → cellular organisms → Eukaryota | 557 | Open in IMG/M |
| 3300009436|Ga0115008_11296725 | All Organisms → cellular organisms → Eukaryota | 556 | Open in IMG/M |
| 3300009436|Ga0115008_11317319 | All Organisms → cellular organisms → Eukaryota | 552 | Open in IMG/M |
| 3300009436|Ga0115008_11357417 | All Organisms → cellular organisms → Eukaryota | 545 | Open in IMG/M |
| 3300009436|Ga0115008_11373149 | All Organisms → cellular organisms → Eukaryota | 542 | Open in IMG/M |
| 3300009436|Ga0115008_11401489 | All Organisms → cellular organisms → Eukaryota | 537 | Open in IMG/M |
| 3300009436|Ga0115008_11435397 | All Organisms → cellular organisms → Eukaryota | 532 | Open in IMG/M |
| 3300009436|Ga0115008_11437663 | All Organisms → cellular organisms → Eukaryota | 532 | Open in IMG/M |
| 3300009436|Ga0115008_11476978 | All Organisms → cellular organisms → Eukaryota | 525 | Open in IMG/M |
| 3300009436|Ga0115008_11544572 | All Organisms → cellular organisms → Eukaryota | 514 | Open in IMG/M |
| 3300009436|Ga0115008_11585829 | All Organisms → cellular organisms → Eukaryota | 508 | Open in IMG/M |
| 3300009436|Ga0115008_11599892 | All Organisms → cellular organisms → Eukaryota | 505 | Open in IMG/M |
| 3300009436|Ga0115008_11608056 | All Organisms → cellular organisms → Eukaryota | 504 | Open in IMG/M |
| 3300009544|Ga0115006_11108656 | All Organisms → cellular organisms → Eukaryota | 705 | Open in IMG/M |
| 3300009544|Ga0115006_12035260 | All Organisms → cellular organisms → Eukaryota | 529 | Open in IMG/M |
| 3300009550|Ga0115013_10771966 | All Organisms → cellular organisms → Eukaryota | 661 | Open in IMG/M |
| 3300009790|Ga0115012_11363154 | All Organisms → cellular organisms → Eukaryota | 603 | Open in IMG/M |
| 3300013010|Ga0129327_10809001 | All Organisms → cellular organisms → Eukaryota | 532 | Open in IMG/M |
| 3300013010|Ga0129327_10824121 | All Organisms → cellular organisms → Eukaryota | 528 | Open in IMG/M |
| 3300013010|Ga0129327_10888231 | All Organisms → cellular organisms → Eukaryota | 511 | Open in IMG/M |
| 3300017697|Ga0180120_10174726 | All Organisms → cellular organisms → Eukaryota | 900 | Open in IMG/M |
| 3300017767|Ga0181406_1210178 | All Organisms → cellular organisms → Eukaryota | 576 | Open in IMG/M |
| 3300018657|Ga0192889_1058056 | All Organisms → cellular organisms → Eukaryota | 524 | Open in IMG/M |
| 3300018704|Ga0192954_1002983 | All Organisms → cellular organisms → Eukaryota | 1521 | Open in IMG/M |
| 3300018704|Ga0192954_1006388 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda | 1209 | Open in IMG/M |
| 3300018704|Ga0192954_1017360 | All Organisms → cellular organisms → Eukaryota | 874 | Open in IMG/M |
| 3300018707|Ga0192876_1058315 | All Organisms → cellular organisms → Eukaryota | 591 | Open in IMG/M |
| 3300018707|Ga0192876_1060279 | All Organisms → cellular organisms → Eukaryota | 573 | Open in IMG/M |
| 3300018717|Ga0192964_1106144 | All Organisms → cellular organisms → Eukaryota | 504 | Open in IMG/M |
| 3300018770|Ga0193530_1014979 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda | 1456 | Open in IMG/M |
| 3300018792|Ga0192956_1132018 | All Organisms → cellular organisms → Eukaryota | 573 | Open in IMG/M |
| 3300018834|Ga0192877_1110663 | All Organisms → cellular organisms → Eukaryota | 709 | Open in IMG/M |
| 3300018845|Ga0193042_1042540 | All Organisms → cellular organisms → Eukaryota | 1375 | Open in IMG/M |
| 3300018845|Ga0193042_1088209 | All Organisms → cellular organisms → Eukaryota | 848 | Open in IMG/M |
| 3300018845|Ga0193042_1158662 | All Organisms → cellular organisms → Eukaryota | 501 | Open in IMG/M |
| 3300018903|Ga0193244_1055205 | All Organisms → cellular organisms → Eukaryota | 733 | Open in IMG/M |
| 3300018909|Ga0193160_10056369 | All Organisms → cellular organisms → Eukaryota | 631 | Open in IMG/M |
| 3300018930|Ga0192955_10036219 | All Organisms → cellular organisms → Eukaryota | 1061 | Open in IMG/M |
| 3300018930|Ga0192955_10041203 | All Organisms → cellular organisms → Eukaryota | 1017 | Open in IMG/M |
| 3300018930|Ga0192955_10042309 | All Organisms → cellular organisms → Eukaryota | 1008 | Open in IMG/M |
| 3300018930|Ga0192955_10108765 | All Organisms → cellular organisms → Eukaryota | 696 | Open in IMG/M |
| 3300018930|Ga0192955_10109305 | All Organisms → cellular organisms → Eukaryota | 695 | Open in IMG/M |
| 3300018930|Ga0192955_10172550 | All Organisms → cellular organisms → Eukaryota | 557 | Open in IMG/M |
| 3300018930|Ga0192955_10173394 | All Organisms → cellular organisms → Eukaryota | 556 | Open in IMG/M |
| 3300018961|Ga0193531_10088880 | All Organisms → cellular organisms → Eukaryota | 1209 | Open in IMG/M |
| 3300018961|Ga0193531_10276011 | All Organisms → cellular organisms → Eukaryota | 592 | Open in IMG/M |
| 3300018974|Ga0192873_10177597 | All Organisms → cellular organisms → Eukaryota | 933 | Open in IMG/M |
| 3300018974|Ga0192873_10325747 | All Organisms → cellular organisms → Eukaryota | 645 | Open in IMG/M |
| 3300018974|Ga0192873_10337866 | All Organisms → cellular organisms → Eukaryota | 628 | Open in IMG/M |
| 3300018979|Ga0193540_10036371 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda | 1160 | Open in IMG/M |
| 3300018979|Ga0193540_10136367 | All Organisms → cellular organisms → Eukaryota | 688 | Open in IMG/M |
| 3300018979|Ga0193540_10221790 | All Organisms → cellular organisms → Eukaryota | 514 | Open in IMG/M |
| 3300018981|Ga0192968_10053103 | All Organisms → cellular organisms → Eukaryota | 1112 | Open in IMG/M |
| 3300018981|Ga0192968_10079198 | All Organisms → cellular organisms → Eukaryota | 888 | Open in IMG/M |
| 3300018981|Ga0192968_10147888 | All Organisms → cellular organisms → Eukaryota | 609 | Open in IMG/M |
| 3300018982|Ga0192947_10194183 | All Organisms → cellular organisms → Eukaryota | 669 | Open in IMG/M |
| 3300019000|Ga0192953_10130648 | All Organisms → cellular organisms → Eukaryota | 623 | Open in IMG/M |
| 3300019010|Ga0193044_10075023 | All Organisms → cellular organisms → Eukaryota | 1114 | Open in IMG/M |
| 3300019010|Ga0193044_10190057 | All Organisms → cellular organisms → Eukaryota | 656 | Open in IMG/M |
| 3300019010|Ga0193044_10203635 | All Organisms → cellular organisms → Eukaryota | 627 | Open in IMG/M |
| 3300019010|Ga0193044_10232138 | All Organisms → cellular organisms → Eukaryota | 575 | Open in IMG/M |
| 3300019010|Ga0193044_10245060 | All Organisms → cellular organisms → Eukaryota | 554 | Open in IMG/M |
| 3300019010|Ga0193044_10266519 | All Organisms → cellular organisms → Eukaryota | 523 | Open in IMG/M |
| 3300019012|Ga0193043_10115081 | All Organisms → cellular organisms → Eukaryota | 1179 | Open in IMG/M |
| 3300019012|Ga0193043_10134710 | All Organisms → cellular organisms → Eukaryota | 1062 | Open in IMG/M |
| 3300019012|Ga0193043_10226521 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus | 725 | Open in IMG/M |
| 3300019012|Ga0193043_10354267 | All Organisms → cellular organisms → Eukaryota | 511 | Open in IMG/M |
| 3300019017|Ga0193569_10056836 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda | 1661 | Open in IMG/M |
| 3300019017|Ga0193569_10058105 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda | 1646 | Open in IMG/M |
| 3300019017|Ga0193569_10114966 | All Organisms → cellular organisms → Eukaryota | 1218 | Open in IMG/M |
| 3300019017|Ga0193569_10121496 | All Organisms → cellular organisms → Eukaryota | 1183 | Open in IMG/M |
| 3300019020|Ga0193538_10071493 | All Organisms → cellular organisms → Eukaryota | 1279 | Open in IMG/M |
| 3300019020|Ga0193538_10128414 | All Organisms → cellular organisms → Eukaryota | 918 | Open in IMG/M |
| 3300019020|Ga0193538_10166817 | All Organisms → cellular organisms → Eukaryota | 773 | Open in IMG/M |
| 3300019022|Ga0192951_10389353 | All Organisms → cellular organisms → Eukaryota | 528 | Open in IMG/M |
| 3300019024|Ga0193535_10053494 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 1250 | Open in IMG/M |
| 3300019024|Ga0193535_10142589 | All Organisms → cellular organisms → Eukaryota | 779 | Open in IMG/M |
| 3300019100|Ga0193045_1065672 | All Organisms → cellular organisms → Eukaryota | 563 | Open in IMG/M |
| 3300019111|Ga0193541_1016076 | All Organisms → cellular organisms → Eukaryota | 1100 | Open in IMG/M |
| 3300019126|Ga0193144_1054648 | All Organisms → cellular organisms → Eukaryota | 682 | Open in IMG/M |
| 3300019151|Ga0192888_10058296 | All Organisms → cellular organisms → Eukaryota | 1312 | Open in IMG/M |
| 3300019151|Ga0192888_10065581 | All Organisms → cellular organisms → Eukaryota | 1236 | Open in IMG/M |
| 3300019151|Ga0192888_10072939 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera | 1167 | Open in IMG/M |
| 3300019151|Ga0192888_10197995 | All Organisms → cellular organisms → Eukaryota | 611 | Open in IMG/M |
| 3300019152|Ga0193564_10042414 | All Organisms → cellular organisms → Eukaryota | 1397 | Open in IMG/M |
| 3300019152|Ga0193564_10165572 | All Organisms → cellular organisms → Eukaryota | 686 | Open in IMG/M |
| 3300027833|Ga0209092_10326195 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Cyclopoida → Cyclopettidae → Paracyclopina → Paracyclopina nana | 823 | Open in IMG/M |
| 3300027833|Ga0209092_10476919 | All Organisms → cellular organisms → Eukaryota | 641 | Open in IMG/M |
| 3300027833|Ga0209092_10505121 | All Organisms → cellular organisms → Eukaryota | 617 | Open in IMG/M |
| 3300027833|Ga0209092_10637126 | All Organisms → cellular organisms → Eukaryota | 529 | Open in IMG/M |
| 3300030702|Ga0307399_10640313 | All Organisms → cellular organisms → Eukaryota | 526 | Open in IMG/M |
| 3300031522|Ga0307388_10825646 | All Organisms → cellular organisms → Eukaryota | 623 | Open in IMG/M |
| 3300031737|Ga0307387_10001365 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea | 4745 | Open in IMG/M |
| 3300031737|Ga0307387_10412704 | All Organisms → cellular organisms → Eukaryota | 825 | Open in IMG/M |
| 3300031739|Ga0307383_10385063 | All Organisms → cellular organisms → Eukaryota | 688 | Open in IMG/M |
| 3300031739|Ga0307383_10452057 | All Organisms → cellular organisms → Eukaryota | 636 | Open in IMG/M |
| 3300031743|Ga0307382_10026004 | All Organisms → cellular organisms → Eukaryota | 2019 | Open in IMG/M |
| 3300031750|Ga0307389_10631383 | All Organisms → cellular organisms → Eukaryota | 695 | Open in IMG/M |
| 3300031750|Ga0307389_10736798 | All Organisms → cellular organisms → Eukaryota | 644 | Open in IMG/M |
| 3300031750|Ga0307389_10837089 | All Organisms → cellular organisms → Eukaryota | 605 | Open in IMG/M |
| 3300032088|Ga0315321_10298238 | All Organisms → cellular organisms → Eukaryota | 1029 | Open in IMG/M |
| 3300032713|Ga0314690_10631478 | All Organisms → cellular organisms → Eukaryota | 523 | Open in IMG/M |
| 3300032752|Ga0314700_10557756 | All Organisms → cellular organisms → Eukaryota | 607 | Open in IMG/M |
| 3300033572|Ga0307390_10762926 | All Organisms → cellular organisms → Eukaryota | 609 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 48.15% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 41.48% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 2.96% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 2.96% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 1.48% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 1.48% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 0.74% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 0.74% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002033 | Marine microbial communities from the Sargasso Sea - GS000a &b | Environmental | Open in IMG/M |
| 3300002040 | GS000c - Sargasso Station 3 | Environmental | Open in IMG/M |
| 3300007957 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1459A_3.0um | Environmental | Open in IMG/M |
| 3300007958 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1459BC_3.0um | Environmental | Open in IMG/M |
| 3300007972 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460ABC_3.0um | Environmental | Open in IMG/M |
| 3300008998 | Eukaryotic communities of water from different depths collected during the Tara Oceans expedition - TARA_A100000548 | Environmental | Open in IMG/M |
| 3300009432 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M Metagenome | Environmental | Open in IMG/M |
| 3300009436 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M Metagenome | Environmental | Open in IMG/M |
| 3300009544 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean- Svalbard ARC20M Metagenome | Environmental | Open in IMG/M |
| 3300009550 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - South Atlantic ANT15 Metagenome | Environmental | Open in IMG/M |
| 3300009790 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT10 Metagenome | Environmental | Open in IMG/M |
| 3300013010 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.8_DNA | Environmental | Open in IMG/M |
| 3300017697 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_DNA (version 2) | Environmental | Open in IMG/M |
| 3300017767 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 29 SPOT_SRF_2011-12-20 | Environmental | Open in IMG/M |
| 3300018657 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_068 - TARA_N000000705 (ERX1789382-ERR1719418) | Environmental | Open in IMG/M |
| 3300018704 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001396 (ERX1782253-ERR1711956) | Environmental | Open in IMG/M |
| 3300018707 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_067 - TARA_N000000746 (ERX1789613-ERR1719509) | Environmental | Open in IMG/M |
| 3300018717 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001362 (ERX1789634-ERR1719196) | Environmental | Open in IMG/M |
| 3300018770 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002783 (ERX1789454-ERR1719490) | Environmental | Open in IMG/M |
| 3300018792 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001398 (ERX1782120-ERR1711892) | Environmental | Open in IMG/M |
| 3300018834 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_067 - TARA_N000000746 (ERX1789722-ERR1719319) | Environmental | Open in IMG/M |
| 3300018845 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_081 - TARA_N000001426 (ERX1809760-ERR1740122) | Environmental | Open in IMG/M |
| 3300018903 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_080 - TARA_N000001499 (ERX1789636-ERR1719512) | Environmental | Open in IMG/M |
| 3300018909 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_025 - TARA_A100000402 (ERX1782377-ERR1712208) | Environmental | Open in IMG/M |
| 3300018930 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001396 (ERX1782254-ERR1712008) | Environmental | Open in IMG/M |
| 3300018961 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002783 (ERX1789414-ERR1719458) | Environmental | Open in IMG/M |
| 3300018974 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000809 (ERX1782160-ERR1711971) | Environmental | Open in IMG/M |
| 3300018979 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_153 - TARA_N000002817 (ERX1782403-ERR1712037) | Environmental | Open in IMG/M |
| 3300018981 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001440 (ERX1782157-ERR1712238) | Environmental | Open in IMG/M |
| 3300018982 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001384 (ERX1782271-ERR1711935) | Environmental | Open in IMG/M |
| 3300019000 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001394 (ERX1782320-ERR1712129) | Environmental | Open in IMG/M |
| 3300019010 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_081 - TARA_N000001428 (ERX1809462-ERR1739838) | Environmental | Open in IMG/M |
| 3300019012 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_081 - TARA_N000001426 (ERX1809764-ERR1740129) | Environmental | Open in IMG/M |
| 3300019017 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002781 | Environmental | Open in IMG/M |
| 3300019020 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_153 - TARA_N000002813 (ERX1789673-ERR1719264) | Environmental | Open in IMG/M |
| 3300019022 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001390 (ERX1782474-ERR1712194) | Environmental | Open in IMG/M |
| 3300019024 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002797 (ERX1789427-ERR1719237) | Environmental | Open in IMG/M |
| 3300019100 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_081 - TARA_N000001428 (ERX1809468-ERR1739839) | Environmental | Open in IMG/M |
| 3300019111 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_153 - TARA_N000002817 (ERX1782321-ERR1712210) | Environmental | Open in IMG/M |
| 3300019126 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_022 - TARA_A100000695 (ERX1782402-ERR1712043) | Environmental | Open in IMG/M |
| 3300019151 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_068 - TARA_N000000705 (ERX1789682-ERR1719501) | Environmental | Open in IMG/M |
| 3300019152 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_150 - TARA_N000002717 | Environmental | Open in IMG/M |
| 3300027833 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M Metagenome (SPAdes) | Environmental | Open in IMG/M |
| 3300030702 | Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-14 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031522 | Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-3.R2 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031737 | Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-3.R1 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031739 | Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R3 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031743 | Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R2 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031750 | Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-3.R3 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300032088 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 21515 | Environmental | Open in IMG/M |
| 3300032713 | Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim5_22May_sur (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300032752 | Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim7_26May_deep (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300033572 | Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-4.R1 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| GOS24894_102249613 | 3300002033 | Marine | VRKNCSSDREIEAEGREFAKVLRSLEQFIQTVKGQNNFW |
| GOScombined01_1024421883 | 3300002040 | Marine | VRKNCSSDREIEAEGREFAKVLRSLEQFIQTVKGQNNFW* |
| GOScombined01_1059833233 | 3300002040 | Marine | IVRPTVRKNCSSDREIEAEGREFAKVLRSLEQFIQTVKGQNNFW* |
| Ga0105742_10439471 | 3300007957 | Estuary Water | CEKKKSGDRKKLLKFEAEGQEFAISLEQFIETVKGQNNFW* |
| Ga0105742_10563281 | 3300007957 | Estuary Water | VRKNCYNDREKLLKFEAEGREFAKFLRSLEQFIQTVKGQNNFWYTE |
| Ga0105743_10493421 | 3300007958 | Estuary Water | VRKKCSSDREKLLKFEAEGQEFAKILRSSEQFIQT |
| Ga0105745_12631311 | 3300007972 | Estuary Water | EKLLKFKAESREFAKFLRSLNRTIYSNSAVKGHNNFWKQNAF* |
| Ga0103502_100441911 | 3300008998 | Marine | VRKNCSSYQEKLLKFGAEGHDFAKFLRSLGQFVQTVK |
| Ga0115005_115857151 | 3300009432 | Marine | EKLLKFEAEGREFAKFLRSLEQFVQTAKGQTNFW* |
| Ga0115008_104308041 | 3300009436 | Marine | PTVRKNCSSDREKLLKFKAEGGEFSKSSRSLEQFIQTVKGQNNFL* |
| Ga0115008_104676311 | 3300009436 | Marine | VRKKCLRDSEKLLKLEAEGQEFAQILRSLEQLVQTVKG |
| Ga0115008_105397001 | 3300009436 | Marine | VRKDCSNDREKLLKLEAEGREFAKFLRSLEQFIQAVKGQNN |
| Ga0115008_105720712 | 3300009436 | Marine | RKNCSSDQEKILKFEAEGREFSNILRSQEQFIQAMKGQNNW* |
| Ga0115008_105877961 | 3300009436 | Marine | TVRKNCSTD*EKLLKFEAEGREFAKILRSLEQFIQTVKGQNNFW* |
| Ga0115008_105973901 | 3300009436 | Marine | VRKNCSSDREKLLKFESEGREFANILRLLEQFIQT |
| Ga0115008_106602131 | 3300009436 | Marine | VRKNCSSDQEKLLKFEAEGREFAKILRSLEQFIQTVKGQNN |
| Ga0115008_106673341 | 3300009436 | Marine | KKNLLKFETEGGEIAKILRSQEQFTQTVKGQNSF* |
| Ga0115008_106845071 | 3300009436 | Marine | KSDREKVFIFEAEGREFEKFLRSLEQSIQTVNNFW* |
| Ga0115008_107456581 | 3300009436 | Marine | VRKNCSSDREKLLKFEAEGRVFAKFLRSLEQFIQTVKGQNNFWQQNPF* |
| Ga0115008_108336811 | 3300009436 | Marine | VRKNCSSDQEILLKFDAEGREFVKFLKSQEQFIQTVKGHSEQFRVTE |
| Ga0115008_108375691 | 3300009436 | Marine | PKLFLHTVRKNCSSDREKLLTCEAEGREFAKLLRSLDQFI* |
| Ga0115008_108769401 | 3300009436 | Marine | NYSSD*ENILKFEAEG*ECSKFLRSPEQFIQTVKGQNNLW* |
| Ga0115008_108904161 | 3300009436 | Marine | SSDREKLLKFEAEG*EFANILKSLKQFFQTVEGQNNFW* |
| Ga0115008_109010781 | 3300009436 | Marine | KNCSSD*ENLLKFEAEGREFAKLLRSLEQFIQAVKVSNNFC* |
| Ga0115008_109670711 | 3300009436 | Marine | VRKNCSSDREKLLKSEAEHREFAKLLRSLEQFIQTVKGQNN |
| Ga0115008_109879062 | 3300009436 | Marine | CSSDREKLLKFEAEGREFSKFLRSLEQFIQTVKGQNNLW* |
| Ga0115008_110236081 | 3300009436 | Marine | TVRKKCSSDREILLKFEAEGQEFAKILRSLEHFIHTVKVQKNFW* |
| Ga0115008_112353181 | 3300009436 | Marine | MRKIFFSDREKLLKFEAEGQEFENYLRSLEQFIQTVKGQNNF |
| Ga0115008_112364591 | 3300009436 | Marine | TYCKRKKSSDQEKLLKFKTEGREFAKFLRSLEQFIKKVKGQNNFW* |
| Ga0115008_112396531 | 3300009436 | Marine | MRKNCSTDQEKLLKFVAEGRVFAKILRHLEQFIQTVKGQNNF |
| Ga0115008_112740321 | 3300009436 | Marine | KCSSDLEKLLKFEAEDQEFVEFL*SLEQFIQTVKGQNNFW* |
| Ga0115008_112934071 | 3300009436 | Marine | QEKLLKFESEGREFAKILRSHGQFIQTVKGQNNSW* |
| Ga0115008_112967251 | 3300009436 | Marine | VRKKCCSDQEKKMEFEAEGREFATHYRSLEQLIQTVKGQNNFLTEVFL |
| Ga0115008_113173191 | 3300009436 | Marine | PTVRKNCFGDREKLLKFEAEGREFEKFLRSLEQFIQTVKGKNNFW* |
| Ga0115008_113574172 | 3300009436 | Marine | EKNCARDREKLQKFKTEGQEFAKILRSLEQFIQTVKGQNNFWYKNAFLTCS* |
| Ga0115008_113731491 | 3300009436 | Marine | TVRKNCSSDREKLLKFEAEGREFAKFLRSLEQIIQIAKGQKYFW* |
| Ga0115008_114014891 | 3300009436 | Marine | PTVRKNCSSDREKLLKFEAEGREFSNFLRLLEQFIQTVKGQNNFW* |
| Ga0115008_114353971 | 3300009436 | Marine | VRKNCSPDREKLLKFEAEGREFENFLRSLEQFIQTVKGQNIFW |
| Ga0115008_114376631 | 3300009436 | Marine | VRKNCSIDRKKVLKYKAEGREFAKFLRQLEQFIQAVKGQNN |
| Ga0115008_114769781 | 3300009436 | Marine | SDREKLLKFEAEGQEFAKILQSLEQCIQTVKGQNNFW* |
| Ga0115008_115445721 | 3300009436 | Marine | CSSD*ENILKFEAEGKEFAKFLRSLEEFIQTVKS* |
| Ga0115008_115858291 | 3300009436 | Marine | EIILKFKVEGREFAITLRSLEQFIETVKGQNNFW* |
| Ga0115008_115998921 | 3300009436 | Marine | VRKKCSSDREKILKFEAEGREFANILRSLKQFIQTVKGQ |
| Ga0115008_116080561 | 3300009436 | Marine | VRKNCSSDREKLLKFEIEDREFAKILKSLEQFIQNIERSEQF |
| Ga0115006_111086561 | 3300009544 | Marine | VRENCSSDCEKLLKLKAEGREFAKNFRSLELFIQTVKGQNNFW* |
| Ga0115006_120352601 | 3300009544 | Marine | VRKNCSRDQEKLCKFEAEGQEFAIFLISLEQFIQIVKGQDNFW* |
| Ga0115013_107719662 | 3300009550 | Marine | F*PTVRKNCFSD*EKLLKFETEG*EFAKFLRSLEQFIQTVDGQ* |
| Ga0115012_113631541 | 3300009790 | Marine | VRKNYSSDREKLMKFEAEGREFAKFLRSLEQFIQTVRGQNNFW* |
| Ga0129327_108090011 | 3300013010 | Freshwater To Marine Saline Gradient | VKKNCTIDREKVWKFEAEGLEFAKCLRSLQQFIQTVKGQTVFGNRILF* |
| Ga0129327_108241211 | 3300013010 | Freshwater To Marine Saline Gradient | D*ETLLEFDAEGRDFAKFLR*LEQFIQTVKGQNNFW* |
| Ga0129327_108882311 | 3300013010 | Freshwater To Marine Saline Gradient | KLFRPTVRKKCSGDCEKLLKFLAFSLEFAKILGSLEQFIQAVKGQNNIW* |
| Ga0180120_101747261 | 3300017697 | Freshwater To Marine Saline Gradient | LLKFEAEGQESGKFLRSLKRFIQTVKGQNNFGNRMFF |
| Ga0181406_12101781 | 3300017767 | Seawater | VRKNCASDPEKLLKFEAEGQEVAKCLRTLEQSIQAVKGQNNFW |
| Ga0192889_10580561 | 3300018657 | Marine | PTVRKNCSSDREKLLKFEAEGREFAKFLRSLEQFIQTER |
| Ga0192954_10029832 | 3300018704 | Marine | VRKNDPSDVEKLLKFKVRDRELAKFLRSLEPFIQTVKGPTNFRNGMLF |
| Ga0192954_10063882 | 3300018704 | Marine | MRKNCSSDREKLLEFEAEGREFAKFLRYLEQFIQTVKGLKN |
| Ga0192954_10173602 | 3300018704 | Marine | LPKLCXPIVRKTCSSDXEKLLKFEAEDLKFAKILRSIKQFIQAVKGQNNFX |
| Ga0192876_10583151 | 3300018707 | Marine | IVRKNCFSDREKLLKFKAEGREFAKFLRSLGQFIQTVKGQKKFW |
| Ga0192876_10602791 | 3300018707 | Marine | DREKLLKFEAEGREFAKFLRSLEQFIQTVKGQNNFW |
| Ga0192964_11061441 | 3300018717 | Marine | VRKNCSSDREKLLKFEAEGREFAKILRSLEQFIQTVKGQNN |
| Ga0193530_10149791 | 3300018770 | Marine | TVKKKCSRDPEILLKLEAEGREFAKILRSLEHFIRTVKGQNYSW |
| Ga0192956_11320181 | 3300018792 | Marine | KNSSSDREKLLKFEAGGREFAKFLRSLEQFIQTVKGQDNFW |
| Ga0192877_11106631 | 3300018834 | Marine | PILRKSCSSDREKLLKFEAEGXDFGKFLSSLNQFIQTVKG |
| Ga0193042_10425401 | 3300018845 | Marine | VRKNCSCDREKILKFEAEGRESGKILRSLEQFAQTVKGQNNFW |
| Ga0193042_10882091 | 3300018845 | Marine | VRNNRSSDGEKLLKFEAEGREFSKFLRSLEQFIQIVKGQNNPW |
| Ga0193042_11586621 | 3300018845 | Marine | VRKKCSNDRENFLKFKADGREFAKTVRSLEQFIQTVKDQNNVW |
| Ga0193244_10552052 | 3300018903 | Marine | RKNCSSDXEKFLKFEAEGREFAKFLRSLEQFIQTVKGQNNFW |
| Ga0193160_100563691 | 3300018909 | Marine | CSRYREKLLKFEDEGREFAKFLGSLEQFIQTVKGQINFL |
| Ga0192955_100362192 | 3300018930 | Marine | VRKNDPSDVEKLLKFKVRDRELAKFLRSLEPFIQTVKGPTNFRNRMLF |
| Ga0192955_100412032 | 3300018930 | Marine | DREKLLKFEAEGREFAKKLRSLEQFIQTVKGRNNF |
| Ga0192955_100423091 | 3300018930 | Marine | RKNCSSDREKLLKFEAEGREFAKILRSLEQFIQTVKG |
| Ga0192955_101087651 | 3300018930 | Marine | CSSDREKLLKFEAEGREFGKFLRSLEQFIQTVKGQNNLW |
| Ga0192955_101093051 | 3300018930 | Marine | SDREKLLKFEAEGREFAKLLRSLEQFIQAVKGQNNFW |
| Ga0192955_101725501 | 3300018930 | Marine | RKNCSSDXEKLLKFEAEGXDFANFLSSLNQFIQTVKS |
| Ga0192955_101733941 | 3300018930 | Marine | VRKNCSSDQEKLLRFEAEGLEISKNLRSLEQFNQTVKGQNNLW |
| Ga0193531_100888801 | 3300018961 | Marine | KNRSSDXEKLLKFEAEGQEFAKILRSLEQFVXTEKGQKIFW |
| Ga0193531_102760111 | 3300018961 | Marine | SDQEKLLKFEAEGREFAKLLRSLEQLVQTVKVQNNFW |
| Ga0192873_101775971 | 3300018974 | Marine | VRKNHSSDREKLLKFEAEGQELAKFLRSLEQFIQTVKVQNNFC |
| Ga0192873_103257471 | 3300018974 | Marine | RKKCSSDQEKLLKFKAEGREFAKILRSLEKFIHTV |
| Ga0192873_103378662 | 3300018974 | Marine | TKIVLTYCGKKCSSDQEKLLKFKAEGREFLKFLRSLEKFIQTVKG |
| Ga0193540_100363712 | 3300018979 | Marine | VRKNCSSDREKLLKFEAEGQEFAKFLRSREQFIQTVKGQNNFW |
| Ga0193540_101363672 | 3300018979 | Marine | VTKNCSSDCEKLLKFEAEGGEFAKYLRSLEQFIQTVKGQ |
| Ga0193540_102217902 | 3300018979 | Marine | VRKNCSSDREKLLKFEAEGREFSKFLRSLEQFIQTAKGQNNSW |
| Ga0192968_100531032 | 3300018981 | Marine | VRKNCSSDQEKLLKFEAEGREFAKILRSLEQFIQTVKGQNNF |
| Ga0192968_100791981 | 3300018981 | Marine | RKNCSSDREKLLKFEAEGQEFANFLRSLKQFIQTVKGQNNFW |
| Ga0192968_101478881 | 3300018981 | Marine | VRKNCSSDREKLLKFEAEGREFAKILRSLEQFIQTVKGQNNFW |
| Ga0192947_101941831 | 3300018982 | Marine | SDREKLLKFEAEGREFAKILRSLEQFIQTVKGQNNFW |
| Ga0192953_101306481 | 3300019000 | Marine | VRKKFSSDQETLLKYEAEGQKFAKFLRSLEKFIQTVPM |
| Ga0193044_100750232 | 3300019010 | Marine | GDREKHLKFKAEGQEFAIFLRSLEQFIQTVKGQNNFG |
| Ga0193044_101900571 | 3300019010 | Marine | REKLLKFEAEGGEFAQFLRSLEQFIQTVKCQNNFW |
| Ga0193044_102036351 | 3300019010 | Marine | VRKDCSIDQEKLLKFEAEGQEFAKILKSLEKFIQTVKGQNNFW |
| Ga0193044_102321381 | 3300019010 | Marine | PTVRKNCSSDREKLLKFEVEGREFAKVLISLEQFV |
| Ga0193044_102450601 | 3300019010 | Marine | VRRNGSSVLEKLLKLEAEGREFAKLLRSLEQFIQTVKGQ |
| Ga0193044_102665191 | 3300019010 | Marine | VRKYCSSDPEKVLKIEAEGREFSNFLRSLEQFIQTVKG |
| Ga0193043_101150811 | 3300019012 | Marine | SLPQLFXPTVRKNCYSDREKNLKFEAEGQELANFLRSLE |
| Ga0193043_101347101 | 3300019012 | Marine | RCSSDSEIFLKLEAEDREFVKILRSLEQFNRPGKGQTIVVTE |
| Ga0193043_102265212 | 3300019012 | Marine | EKKKCSSEQEKLLKFEGEGQDFARFLRSLEQFTVKRPNNFW |
| Ga0193043_103542672 | 3300019012 | Marine | VRNKCSSDREKLLKLKAKGLELGKNLRSLEQFIRKVKGQNNV |
| Ga0193569_100568363 | 3300019017 | Marine | CSRDPEKLLKLEAEGREFAKILRSLEHFIRTVKGQNYSW |
| Ga0193569_100581053 | 3300019017 | Marine | CSRDPEKLLKLEAEGREFSKILRSLEQFIRTMKGQKNFW |
| Ga0193569_101149661 | 3300019017 | Marine | GKNCSSDXEKLLKFEAKGREFSRILRSVEQFVQTVKGQNNFGNRMLF |
| Ga0193569_101214962 | 3300019017 | Marine | VRKKCSNDREIFLKFKADGREFAKTVRSLEQFIQTVKDQNNVW |
| Ga0193538_100714931 | 3300019020 | Marine | MVFYYPNCSSDTEKLLKFEAEGXEFAKEIISLEQFIQTVKGQNSFW |
| Ga0193538_101284141 | 3300019020 | Marine | KKCSRDREKLLKFEAEGXEFAKFLRSLEHFIQTVKGQKNVW |
| Ga0193538_101668171 | 3300019020 | Marine | VRKNCSSDXEKLLKFEAEGREFSKFLRSLEQFIQTVKGQNIFW |
| Ga0192951_103893531 | 3300019022 | Marine | VRKNCSSDREKLLKFEAEGRNFLNVLRSLEQIIQTVKGQNNFW |
| Ga0193535_100534941 | 3300019024 | Marine | VRKSCSSDREKILKFEAVGREFEKILRSLEGFIQTVKGQKMF |
| Ga0193535_101425891 | 3300019024 | Marine | TYCEKNYSSDREKHLKFKAEGQEFAIFLRSLEQFIQTVKGQNNFG |
| Ga0193045_10656721 | 3300019100 | Marine | SRDPEILLKLEAEGREFEKLLRSLEQFIRTMKGQKNFW |
| Ga0193541_10160761 | 3300019111 | Marine | VRKNYSSDREKLLKFMAEGREFSKCLRSLEQFIQTVKGQNNFW |
| Ga0193144_10546481 | 3300019126 | Marine | VRKNYSSDREKLVKFEAEGRELANFLISLEQFIRS |
| Ga0192888_100582961 | 3300019151 | Marine | SDREKLLKFEAEGQEFAKILRSIEQFIQTVKGQTKLL |
| Ga0192888_100655811 | 3300019151 | Marine | KIVLTYCEKNCSSDQEKLLKFKAEGREFAKFLRSLERVKGQNNFW |
| Ga0192888_100729391 | 3300019151 | Marine | REKLLKFEAEGREFAKFLKSLEQSIQTVKGQNNFW |
| Ga0192888_101979952 | 3300019151 | Marine | VRKNCSSDREKLLKFEAEGREFAKFLRSLEQFIQTVK |
| Ga0193564_100424141 | 3300019152 | Marine | FXPTVRKNCSSDREKLLKFEAEGREFSKFLRSLEQFMQTAKGQNNFL |
| Ga0193564_101655722 | 3300019152 | Marine | VRKNXSSDREKLLKFKAEGREFANILISLEQFVGTVKGQNNF |
| Ga0209092_103261952 | 3300027833 | Marine | VRKNCSSDQEKLLKFQAEGREFAKFLKSLEHFFQTVKGRNNF |
| Ga0209092_104769192 | 3300027833 | Marine | IAKKECSNDQQKLLKFKAEGRELAKFLKSLVQFVQTVKGQKNFCQQDSFLACS |
| Ga0209092_105051211 | 3300027833 | Marine | SSDXEKLLKFEAEGREFAKILRSLEQFIQTVKGQNNFW |
| Ga0209092_106371261 | 3300027833 | Marine | TVQEKLLKFEAEDREIANILRSLEQFIQAVKHLNNF |
| Ga0307399_106403131 | 3300030702 | Marine | VRKNCSSDREKLLKFEAEGREFAKILRSLEQFIQTVK |
| Ga0307388_108256461 | 3300031522 | Marine | VRKNCSSDRENFLKFEAEGREFVKKLRSLEQFIQTVEGQNN |
| Ga0307387_100013651 | 3300031737 | Marine | RKNCSSDREKLLKFEAEGREFAKILRSLEQFIQTVKGQNNFW |
| Ga0307387_104127041 | 3300031737 | Marine | RKNCSSDREKLLKFEAEGREFAKILRSLEQFIQTVKGQNNFR |
| Ga0307383_103850631 | 3300031739 | Marine | KNCSSDREKLLKFEAEGREFAKILRSLGQFIQTVKGQNNFW |
| Ga0307383_104520571 | 3300031739 | Marine | VRKKCSSDTEKPLKFVAEGREFAKILRSLEQFIQTVKGQNNFW |
| Ga0307382_100260041 | 3300031743 | Marine | REKVLKFEAEGREFAKILRSLEHEQFIQTVKGQNNFW |
| Ga0307389_106313831 | 3300031750 | Marine | VRKKCSSDQEKLLKFEDEDREFSKILISHEKFIGTAKSQNNFLNRTFF |
| Ga0307389_107367981 | 3300031750 | Marine | PTVRKKCSSDREKLLKFEAEGREVSKFLRSLEQFIQTVKGQNNFC |
| Ga0307389_108370891 | 3300031750 | Marine | VRKYYSSDREKLLKFEAEGREFANFLRSLEQYIQTVKSQNAFLTF |
| Ga0315321_102982381 | 3300032088 | Seawater | CSSDREKLLKFEAEGREFAKFLRSLEQFIQTVKGQNNFW |
| Ga0314690_106314781 | 3300032713 | Seawater | VRTNCSRDQEELLRFEAEGREFAKILRSLEKFIQTVKTIFDN |
| Ga0314700_105577561 | 3300032752 | Seawater | KNCSSDQEKLLKFKPEGQEFSKILRSLEKIIQTVKG |
| Ga0307390_107629262 | 3300033572 | Marine | VTSVKLLKFEAEGREFANFLRSLEQFIQTVKGQNNFW |
| ⦗Top⦘ |