


| Basic Information | |
|---|---|
| Family ID | F057782 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 136 |
| Average Sequence Length | 48 residues |
| Representative Sequence | HPPTPYTLSPLLKGGEGRGEGGSYTHVPCPFGALLVTLYHLKSKAFLM |
| Number of Associated Samples | 53 |
| Number of Associated Scaffolds | 136 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 8.82 % |
| % of genes near scaffold ends (potentially truncated) | 93.38 % |
| % of genes from short scaffolds (< 2000 bps) | 71.32 % |
| Associated GOLD sequencing projects | 49 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.30 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (60.294 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring Phototrophic Mat (62.500 % of family members) |
| Environment Ontology (ENVO) | Unclassified (94.853 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Unclassified (63.971 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 25.00% β-sheet: 0.00% Coil/Unstructured: 75.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.30 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 136 Family Scaffolds |
|---|---|---|
| PF13585 | CHU_C | 3.68 |
| PF13715 | CarbopepD_reg_2 | 1.47 |
| PF12773 | DZR | 1.47 |
| PF00303 | Thymidylat_synt | 1.47 |
| PF13424 | TPR_12 | 1.47 |
| PF01266 | DAO | 1.47 |
| PF02401 | LYTB | 1.47 |
| PF01433 | Peptidase_M1 | 1.47 |
| PF07228 | SpoIIE | 1.47 |
| PF13020 | NOV_C | 1.47 |
| PF02742 | Fe_dep_repr_C | 1.47 |
| PF13784 | Fic_N | 1.47 |
| PF00425 | Chorismate_bind | 0.74 |
| PF01420 | Methylase_S | 0.74 |
| PF13368 | Toprim_C_rpt | 0.74 |
| PF17164 | DUF5122 | 0.74 |
| PF01195 | Pept_tRNA_hydro | 0.74 |
| PF00994 | MoCF_biosynth | 0.74 |
| PF13568 | OMP_b-brl_2 | 0.74 |
| PF06245 | DUF1015 | 0.74 |
| PF00583 | Acetyltransf_1 | 0.74 |
| PF02737 | 3HCDH_N | 0.74 |
| PF13592 | HTH_33 | 0.74 |
| PF02548 | Pantoate_transf | 0.74 |
| PF00155 | Aminotran_1_2 | 0.74 |
| PF01041 | DegT_DnrJ_EryC1 | 0.74 |
| PF02910 | Succ_DH_flav_C | 0.74 |
| PF16363 | GDP_Man_Dehyd | 0.74 |
| PF13620 | CarboxypepD_reg | 0.74 |
| PF02698 | DUF218 | 0.74 |
| PF12631 | MnmE_helical | 0.74 |
| PF07715 | Plug | 0.74 |
| PF02628 | COX15-CtaA | 0.74 |
| PF01029 | NusB | 0.74 |
| PF01227 | GTP_cyclohydroI | 0.74 |
| PF01694 | Rhomboid | 0.74 |
| PF02661 | Fic | 0.74 |
| PF07661 | MORN_2 | 0.74 |
| PF00801 | PKD | 0.74 |
| PF02224 | Cytidylate_kin | 0.74 |
| PF01926 | MMR_HSR1 | 0.74 |
| PF13414 | TPR_11 | 0.74 |
| PF03721 | UDPG_MGDP_dh_N | 0.74 |
| PF01894 | UPF0047 | 0.74 |
| PF13641 | Glyco_tranf_2_3 | 0.74 |
| PF12437 | GSIII_N | 0.74 |
| PF13906 | AA_permease_C | 0.74 |
| PF00691 | OmpA | 0.74 |
| PF04012 | PspA_IM30 | 0.74 |
| PF01016 | Ribosomal_L27 | 0.74 |
| PF01503 | PRA-PH | 0.74 |
| PF06739 | SBBP | 0.74 |
| PF12850 | Metallophos_2 | 0.74 |
| PF07690 | MFS_1 | 0.74 |
| PF02913 | FAD-oxidase_C | 0.74 |
| PF08530 | PepX_C | 0.74 |
| PF01863 | YgjP-like | 0.74 |
| PF01370 | Epimerase | 0.74 |
| PF02021 | UPF0102 | 0.74 |
| PF13491 | FtsK_4TM | 0.74 |
| PF01476 | LysM | 0.74 |
| PF05118 | Asp_Arg_Hydrox | 0.74 |
| COG ID | Name | Functional Category | % Frequency in 136 Family Scaffolds |
|---|---|---|---|
| COG0761 | 4-Hydroxy-3-methylbut-2-enyl diphosphate reductase IspH | Lipid transport and metabolism [I] | 2.94 |
| COG0207 | Thymidylate synthase | Nucleotide transport and metabolism [F] | 1.47 |
| COG0240 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 1.47 |
| COG0308 | Aminopeptidase N, contains DUF3458 domain | Amino acid transport and metabolism [E] | 1.47 |
| COG0677 | UDP-N-acetyl-D-mannosaminuronate dehydrogenase | Cell wall/membrane/envelope biogenesis [M] | 1.47 |
| COG1004 | UDP-glucose 6-dehydrogenase | Cell wall/membrane/envelope biogenesis [M] | 1.47 |
| COG1250 | 3-hydroxyacyl-CoA dehydrogenase | Lipid transport and metabolism [I] | 1.47 |
| COG1321 | Mn-dependent transcriptional regulator MntR, DtxR family | Transcription [K] | 1.47 |
| COG1842 | Phage shock protein A | Transcription [K] | 1.47 |
| COG0193 | Peptidyl-tRNA hydrolase | Translation, ribosomal structure and biogenesis [J] | 0.74 |
| COG0211 | Ribosomal protein L27 | Translation, ribosomal structure and biogenesis [J] | 0.74 |
| COG0277 | FAD/FMN-containing lactate dehydrogenase/glycolate oxidase | Energy production and conversion [C] | 0.74 |
| COG0283 | Cytidylate kinase | Nucleotide transport and metabolism [F] | 0.74 |
| COG0287 | Prephenate dehydrogenase | Amino acid transport and metabolism [E] | 0.74 |
| COG0399 | dTDP-4-amino-4,6-dideoxygalactose transaminase | Cell wall/membrane/envelope biogenesis [M] | 0.74 |
| COG0413 | Ketopantoate hydroxymethyltransferase | Coenzyme transport and metabolism [H] | 0.74 |
| COG0432 | Thiamin phosphate synthase YjbQ, UPF0047 family | Coenzyme transport and metabolism [H] | 0.74 |
| COG0436 | Aspartate/methionine/tyrosine aminotransferase | Amino acid transport and metabolism [E] | 0.74 |
| COG0520 | Selenocysteine lyase/Cysteine desulfurase | Amino acid transport and metabolism [E] | 0.74 |
| COG0626 | Cystathionine beta-lyase/cystathionine gamma-synthase | Amino acid transport and metabolism [E] | 0.74 |
| COG0705 | Membrane-associated serine protease, rhomboid family | Posttranslational modification, protein turnover, chaperones [O] | 0.74 |
| COG0732 | Restriction endonuclease S subunit | Defense mechanisms [V] | 0.74 |
| COG0792 | Predicted endonuclease distantly related to archaeal Holliday junction resolvase, YraN/UPF0102 family | Replication, recombination and repair [L] | 0.74 |
| COG1104 | Cysteine desulfurase/Cysteine sulfinate desulfinase IscS or related enzyme, NifS family | Amino acid transport and metabolism [E] | 0.74 |
| COG1434 | Lipid carrier protein ElyC involved in cell wall biogenesis, DUF218 family | Cell wall/membrane/envelope biogenesis [M] | 0.74 |
| COG1451 | UTP pyrophosphatase, metal-dependent hydrolase family | General function prediction only [R] | 0.74 |
| COG1612 | Heme A synthase | Coenzyme transport and metabolism [H] | 0.74 |
| COG1748 | Saccharopine dehydrogenase, NADP-dependent | Amino acid transport and metabolism [E] | 0.74 |
| COG1893 | Ketopantoate reductase | Coenzyme transport and metabolism [H] | 0.74 |
| COG2084 | 3-hydroxyisobutyrate dehydrogenase or related beta-hydroxyacid dehydrogenase | Lipid transport and metabolism [I] | 0.74 |
| COG2849 | Antitoxin component YwqK of the YwqJK toxin-antitoxin module | Defense mechanisms [V] | 0.74 |
| COG2873 | O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependent | Amino acid transport and metabolism [E] | 0.74 |
| COG2936 | Predicted acyl esterase | General function prediction only [R] | 0.74 |
| COG2949 | Uncharacterized periplasmic protein SanA, affects membrane permeability for vancomycin | Cell wall/membrane/envelope biogenesis [M] | 0.74 |
| COG3555 | Aspartyl/asparaginyl beta-hydroxylase, cupin superfamily | Posttranslational modification, protein turnover, chaperones [O] | 0.74 |
| COG4198 | Uncharacterized conserved protein, DUF1015 family | Function unknown [S] | 0.74 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 60.29 % |
| Unclassified | root | N/A | 39.71 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2022920013|YNPsite07_CeleraDRAF_deg1119010697304 | Not Available | 983 | Open in IMG/M |
| 3300002510|JGI24186J35511_1014414 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 1614 | Open in IMG/M |
| 3300003603|JGI26466J51736_1004019 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 3590 | Open in IMG/M |
| 3300004089|Ga0066183_1041065 | Not Available | 568 | Open in IMG/M |
| 3300005243|Ga0068643_1006953 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 2202 | Open in IMG/M |
| 3300005248|Ga0068636_1007368 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 2714 | Open in IMG/M |
| 3300005249|Ga0068645_1001659 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
| 3300005249|Ga0068645_1117442 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300005250|Ga0068635_1014305 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 605 | Open in IMG/M |
| 3300005250|Ga0068635_1076624 | Not Available | 675 | Open in IMG/M |
| 3300005411|Ga0068647_1010426 | Not Available | 1194 | Open in IMG/M |
| 3300005414|Ga0068646_1062248 | Not Available | 759 | Open in IMG/M |
| 3300005452|Ga0068706_1030296 | All Organisms → cellular organisms → Bacteria | 1104 | Open in IMG/M |
| 3300005452|Ga0068706_1048709 | Not Available | 785 | Open in IMG/M |
| 3300005452|Ga0068706_1061190 | Not Available | 673 | Open in IMG/M |
| 3300005452|Ga0068706_1063857 | Not Available | 656 | Open in IMG/M |
| 3300005452|Ga0068706_1081522 | Not Available | 566 | Open in IMG/M |
| 3300005452|Ga0068706_1083849 | Not Available | 557 | Open in IMG/M |
| 3300005452|Ga0068706_1089979 | Not Available | 536 | Open in IMG/M |
| 3300005452|Ga0068706_1098649 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 510 | Open in IMG/M |
| 3300005452|Ga0068706_1100275 | Not Available | 506 | Open in IMG/M |
| 3300005453|Ga0068705_10000365 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 23492 | Open in IMG/M |
| 3300005453|Ga0068705_10000955 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 14662 | Open in IMG/M |
| 3300005453|Ga0068705_10001757 | All Organisms → cellular organisms → Bacteria | 10892 | Open in IMG/M |
| 3300005453|Ga0068705_10005824 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 5879 | Open in IMG/M |
| 3300005453|Ga0068705_10033776 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales | 1811 | Open in IMG/M |
| 3300005453|Ga0068705_10056097 | All Organisms → cellular organisms → Bacteria | 1225 | Open in IMG/M |
| 3300005453|Ga0068705_10119529 | Not Available | 681 | Open in IMG/M |
| 3300005453|Ga0068705_10129177 | Not Available | 643 | Open in IMG/M |
| 3300005453|Ga0068705_10179488 | Not Available | 515 | Open in IMG/M |
| 3300005495|Ga0068666_1112603 | All Organisms → cellular organisms → Bacteria | 1395 | Open in IMG/M |
| 3300006068|Ga0081428_107903 | Not Available | 815 | Open in IMG/M |
| 3300006380|Ga0068664_1013574 | All Organisms → cellular organisms → Bacteria | 672 | Open in IMG/M |
| 3300006380|Ga0068664_1020106 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 2805 | Open in IMG/M |
| 3300006380|Ga0068664_1055939 | All Organisms → cellular organisms → Bacteria | 2810 | Open in IMG/M |
| 3300006380|Ga0068664_1208656 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 588 | Open in IMG/M |
| 3300010191|Ga0124914_1160607 | All Organisms → cellular organisms → Bacteria | 2181 | Open in IMG/M |
| 3300010196|Ga0124923_1235194 | Not Available | 917 | Open in IMG/M |
| 3300010272|Ga0124912_1031714 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 768 | Open in IMG/M |
| 3300025349|Ga0209670_119295 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300026280|Ga0209017_10015264 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 2436 | Open in IMG/M |
| 3300026280|Ga0209017_10045149 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Thermoanaerobacterales → Thermoanaerobacteraceae → unclassified Thermoanaerobacteraceae → Thermoanaerobacteraceae bacterium | 1026 | Open in IMG/M |
| 3300026509|Ga0209809_1027617 | All Organisms → cellular organisms → Bacteria | 2075 | Open in IMG/M |
| 3300026509|Ga0209809_1030402 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 1928 | Open in IMG/M |
| 3300026509|Ga0209809_1091726 | Not Available | 794 | Open in IMG/M |
| 3300027279|Ga0209691_1005902 | All Organisms → cellular organisms → Bacteria | 4807 | Open in IMG/M |
| 3300027279|Ga0209691_1066424 | Not Available | 648 | Open in IMG/M |
| 3300028761|Ga0272447_1015811 | All Organisms → cellular organisms → Bacteria | 1781 | Open in IMG/M |
| 3300028761|Ga0272447_1045574 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 698 | Open in IMG/M |
| 3300031245|Ga0308395_1001718 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 13652 | Open in IMG/M |
| 3300031245|Ga0308395_1004940 | All Organisms → cellular organisms → Bacteria | 6353 | Open in IMG/M |
| 3300031245|Ga0308395_1007477 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 4693 | Open in IMG/M |
| 3300031245|Ga0308395_1028708 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1686 | Open in IMG/M |
| 3300031245|Ga0308395_1102333 | Not Available | 654 | Open in IMG/M |
| 3300031508|Ga0308394_1003549 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 6362 | Open in IMG/M |
| 3300031508|Ga0308394_1124256 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300031509|Ga0308399_1011844 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 2377 | Open in IMG/M |
| 3300031509|Ga0308399_1044110 | Not Available | 1006 | Open in IMG/M |
| 3300031509|Ga0308399_1115577 | Not Available | 524 | Open in IMG/M |
| 3300031509|Ga0308399_1117930 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 517 | Open in IMG/M |
| 3300031512|Ga0308397_1004848 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 5415 | Open in IMG/M |
| 3300031512|Ga0308397_1063977 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 857 | Open in IMG/M |
| 3300031512|Ga0308397_1069384 | All Organisms → cellular organisms → Bacteria | 808 | Open in IMG/M |
| 3300031512|Ga0308397_1110865 | Not Available | 580 | Open in IMG/M |
| 3300031513|Ga0308412_1058400 | Not Available | 1295 | Open in IMG/M |
| 3300031513|Ga0308412_1077878 | All Organisms → cellular organisms → Bacteria | 1044 | Open in IMG/M |
| 3300031516|Ga0308398_1005036 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 5361 | Open in IMG/M |
| 3300031516|Ga0308398_1052126 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 1006 | Open in IMG/M |
| 3300031516|Ga0308398_1096523 | Not Available | 649 | Open in IMG/M |
| 3300031516|Ga0308398_1111671 | Not Available | 586 | Open in IMG/M |
| 3300031517|Ga0308392_1005861 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 4107 | Open in IMG/M |
| 3300031517|Ga0308392_1068260 | Not Available | 775 | Open in IMG/M |
| 3300031518|Ga0308389_1019143 | Not Available | 2533 | Open in IMG/M |
| 3300031518|Ga0308389_1112468 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 599 | Open in IMG/M |
| 3300031567|Ga0308391_1092677 | Not Available | 634 | Open in IMG/M |
| 3300031567|Ga0308391_1110712 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 567 | Open in IMG/M |
| 3300031568|Ga0308393_1001774 | All Organisms → cellular organisms → Bacteria | 9697 | Open in IMG/M |
| 3300031568|Ga0308393_1001775 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 9694 | Open in IMG/M |
| 3300031568|Ga0308393_1026225 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 1513 | Open in IMG/M |
| 3300031568|Ga0308393_1090316 | Not Available | 660 | Open in IMG/M |
| 3300031568|Ga0308393_1113686 | Not Available | 569 | Open in IMG/M |
| 3300031767|Ga0308401_1028845 | Not Available | 1196 | Open in IMG/M |
| 3300031767|Ga0308401_1058798 | Not Available | 768 | Open in IMG/M |
| 3300031767|Ga0308401_1089040 | Not Available | 596 | Open in IMG/M |
| 3300031776|Ga0308415_1098758 | Not Available | 590 | Open in IMG/M |
| 3300031783|Ga0308418_1003266 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 7612 | Open in IMG/M |
| 3300031783|Ga0308418_1011033 | All Organisms → cellular organisms → Bacteria | 3170 | Open in IMG/M |
| 3300031783|Ga0308418_1022102 | All Organisms → cellular organisms → Bacteria | 1880 | Open in IMG/M |
| 3300031812|Ga0308411_10006621 | All Organisms → cellular organisms → Bacteria | 7426 | Open in IMG/M |
| 3300031812|Ga0308411_10093818 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 1170 | Open in IMG/M |
| 3300031830|Ga0308409_1003442 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 6164 | Open in IMG/M |
| 3300031830|Ga0308409_1010959 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 2882 | Open in IMG/M |
| 3300031830|Ga0308409_1060828 | Not Available | 911 | Open in IMG/M |
| 3300031830|Ga0308409_1127487 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
| 3300031830|Ga0308409_1140588 | Not Available | 508 | Open in IMG/M |
| 3300031865|Ga0308408_1000924 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 15202 | Open in IMG/M |
| 3300031865|Ga0308408_1016469 | Not Available | 2142 | Open in IMG/M |
| 3300031865|Ga0308408_1036388 | Not Available | 1266 | Open in IMG/M |
| 3300031865|Ga0308408_1076087 | Not Available | 773 | Open in IMG/M |
| 3300031865|Ga0308408_1085738 | Not Available | 714 | Open in IMG/M |
| 3300031865|Ga0308408_1133054 | Not Available | 534 | Open in IMG/M |
| 3300031865|Ga0308408_1133263 | Not Available | 533 | Open in IMG/M |
| 3300031875|Ga0308405_1019623 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 2245 | Open in IMG/M |
| 3300031875|Ga0308405_1132673 | Not Available | 581 | Open in IMG/M |
| 3300031878|Ga0308404_1045630 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Chlorobi → Chlorobia → Chlorobiales → Candidatus Thermochlorobacteriaceae → Candidatus Thermochlorobacter → Candidatus Thermochlorobacter aerophilum | 898 | Open in IMG/M |
| 3300031878|Ga0308404_1076227 | Not Available | 661 | Open in IMG/M |
| 3300031948|Ga0308406_1015168 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 2063 | Open in IMG/M |
| 3300031948|Ga0308406_1035747 | All Organisms → cellular organisms → Bacteria | 1186 | Open in IMG/M |
| 3300031948|Ga0308406_1075630 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 712 | Open in IMG/M |
| 3300031948|Ga0308406_1099018 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
| 3300031948|Ga0308406_1125648 | Not Available | 505 | Open in IMG/M |
| 3300031966|Ga0308420_1165356 | Not Available | 654 | Open in IMG/M |
| 3300031966|Ga0308420_1166113 | Not Available | 652 | Open in IMG/M |
| 3300031980|Ga0308403_1090848 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
| 3300032034|Ga0308407_1011117 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 2642 | Open in IMG/M |
| 3300032034|Ga0308407_1012936 | All Organisms → cellular organisms → Bacteria | 2376 | Open in IMG/M |
| 3300032034|Ga0308407_1038128 | Not Available | 1146 | Open in IMG/M |
| 3300032034|Ga0308407_1088762 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 642 | Open in IMG/M |
| 3300032034|Ga0308407_1105801 | Not Available | 569 | Open in IMG/M |
| 3300032045|Ga0308400_1122259 | Not Available | 518 | Open in IMG/M |
| 3300032045|Ga0308400_1124081 | Not Available | 513 | Open in IMG/M |
| 3300032049|Ga0308416_1036831 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1068 | Open in IMG/M |
| 3300032056|Ga0308310_1033842 | Not Available | 1569 | Open in IMG/M |
| 3300032056|Ga0308310_1043672 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 1301 | Open in IMG/M |
| 3300032056|Ga0308310_1052024 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 1145 | Open in IMG/M |
| 3300032056|Ga0308310_1055371 | All Organisms → cellular organisms → Bacteria | 1093 | Open in IMG/M |
| 3300032056|Ga0308310_1125483 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 583 | Open in IMG/M |
| 3300032056|Ga0308310_1151586 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300032058|Ga0308419_1012247 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 4430 | Open in IMG/M |
| 3300032058|Ga0308419_1171452 | Not Available | 549 | Open in IMG/M |
| 3300032356|Ga0308414_1044258 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 1931 | Open in IMG/M |
| 3300033484|Ga0326763_1000980 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 9365 | Open in IMG/M |
| 3300033886|Ga0308413_002281 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 9939 | Open in IMG/M |
| 3300033886|Ga0308413_017385 | All Organisms → cellular organisms → Bacteria | 2590 | Open in IMG/M |
| 3300033886|Ga0308413_169643 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300034696|Ga0370516_141510 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 749 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Hot Spring Phototrophic Mat | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring Phototrophic Mat | 62.50% |
| Anoxygenic And Chlorotrophic | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Anoxygenic And Chlorotrophic | 16.91% |
| Anoxygenic And Chlorotrophic Microbial Mat | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Anoxygenic And Chlorotrophic Microbial Mat | 13.97% |
| Microbial Mat | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Microbial Mat | 1.47% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.74% |
| Hot Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring | 0.74% |
| Hot Spring Water | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring Water | 0.74% |
| Thermal Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Thermal Spring | 0.74% |
| Hotsprings | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Neutral → Hotsprings | 0.74% |
| Hot Spring Water | Environmental → Aquatic → Thermal Springs → Unclassified → Unclassified → Hot Spring Water | 0.74% |
| Hot Spring | Environmental → Aquatic → Thermal Springs → Unclassified → Unclassified → Hot Spring | 0.74% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2022920013 | Hot spring microbial communities from Yellowstone National Park, Wyoming, USA - YNP7 Chocolate Pots | Environmental | Open in IMG/M |
| 3300002510 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP Bryant MS upper layer 2012 | Environmental | Open in IMG/M |
| 3300003603 | Archaeal communities from Yellowstone National Park, Wyoming, USA - Perpetual Spouter C (PS_C) MetaG | Environmental | Open in IMG/M |
| 3300004089 | Freshwater microbial communities from Yellowstone National Park, Wyoming, USA - Fairy Falls C (FF_Mn_C) (version 2) | Environmental | Open in IMG/M |
| 3300005243 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_0900_T MetaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005248 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_1900_T MetaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005249 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_1200_T MetaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005250 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_1800_T MetaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005411 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_1400(2)_T MetaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005414 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_1300(2)_T MetaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005452 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS-B MetaG | Environmental | Open in IMG/M |
| 3300005453 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS-T MetaG | Environmental | Open in IMG/M |
| 3300005495 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_1400(2)_B MetaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006068 | Hotspring Microbial Communities from Mammoth Norris Corridor Bijah Spring, Yellowstone National Park, Wyoming, USA ? Sample 4, Mini-Metagenomics | Environmental | Open in IMG/M |
| 3300006380 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_1200_B MetaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010191 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_1900_T MetaT (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300010196 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_1200_T MetaT (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300010272 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_1700_T MetaT (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300025349 | Thermal spring microbial communities from Yellowstone National Park, Wyoming, USA - Perpetual Spouter B (PS_B) MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026280 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP Bryant MS undermat 2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300026509 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS-T MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027279 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS-B MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028761 | Hot spring microbial mat communities from Yellowstone National Park, WY, United States - YNP-CB-013-3 | Environmental | Open in IMG/M |
| 3300031245 | Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20050930_P4 | Environmental | Open in IMG/M |
| 3300031508 | Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20050701_me2 | Environmental | Open in IMG/M |
| 3300031509 | Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20060914_OS12-60 | Environmental | Open in IMG/M |
| 3300031512 | Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20051001_T8 | Environmental | Open in IMG/M |
| 3300031513 | Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20070728_OST1-BottomLayer | Environmental | Open in IMG/M |
| 3300031516 | Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20051001_T9 | Environmental | Open in IMG/M |
| 3300031517 | Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20050624_m2 | Environmental | Open in IMG/M |
| 3300031518 | Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20040719_148 | Environmental | Open in IMG/M |
| 3300031567 | Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20050623_t1 | Environmental | Open in IMG/M |
| 3300031568 | Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20050630_ee2 | Environmental | Open in IMG/M |
| 3300031767 | Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20060913_OS-M1 | Environmental | Open in IMG/M |
| 3300031776 | Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20090730_OS55 | Environmental | Open in IMG/M |
| 3300031783 | Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20090729_R4cd | Environmental | Open in IMG/M |
| 3300031812 | Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20070728_OST2-BottomLayer | Environmental | Open in IMG/M |
| 3300031830 | Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20060912_MSe4 | Environmental | Open in IMG/M |
| 3300031865 | Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20060912_MSe3 | Environmental | Open in IMG/M |
| 3300031875 | Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20060912_MS13 | Environmental | Open in IMG/M |
| 3300031878 | Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20060914_OS-M4 | Environmental | Open in IMG/M |
| 3300031948 | Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20060911_MSe1 | Environmental | Open in IMG/M |
| 3300031966 | Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20090730_MS55 | Environmental | Open in IMG/M |
| 3300031980 | Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20060914_OS-M3 | Environmental | Open in IMG/M |
| 3300032034 | Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20060911_MSe2 | Environmental | Open in IMG/M |
| 3300032045 | Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20060914_OS12-65 | Environmental | Open in IMG/M |
| 3300032049 | Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20090730_OS60 | Environmental | Open in IMG/M |
| 3300032056 | Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20090730_MS65 | Environmental | Open in IMG/M |
| 3300032058 | Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20090730_MS50 | Environmental | Open in IMG/M |
| 3300032356 | Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20090730_OS50 | Environmental | Open in IMG/M |
| 3300033484 | Hot spring water microbial communities from Norris Geyser Basin, Yellowstone National Park, WY, United States - NOR.PS_P | Environmental | Open in IMG/M |
| 3300033886 | Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20090729_t10cd | Environmental | Open in IMG/M |
| 3300034696 | Hot spring water microbial communities from Yellowstone National Park, WY, United States - YNP_Buffalopool_103118 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| YNPsite07_CeleraDRAFT_314610 | 2022920013 | Hot Spring | LSPLLKGGEGRGEGGSYTRMPCPFGALLVTLYQFKSKAFLM |
| JGI24186J35511_10144143 | 3300002510 | Anoxygenic And Chlorotrophic Microbial Mat | CIELVLHPPTPYTLSPLLKGGEGWGEGGAYTHVPCPFGALRVTLYHLKSKAFLM* |
| JGI26466J51736_10040191 | 3300003603 | Hot Spring | MVLHPPTPYTLSPLLKGGKGRGEEGSYTHVPCLFGALLGTLYHLQSKTF* |
| Ga0066183_10410652 | 3300004089 | Freshwater | PYTLSPLLKGGEGRGEGGSYTHVPYPFGTLLVTLYHSKSKAFLM* |
| Ga0068643_10069532 | 3300005243 | Anoxygenic And Chlorotrophic Microbial Mat | TLSPLPKGGEGRGEGGSYTRMPCPFGALLVTLYHFKSKA* |
| Ga0068636_10073681 | 3300005248 | Anoxygenic And Chlorotrophic Microbial Mat | HPPTPYTLSPLLKGGEGRGEGGSYTHVPCPFGALLVTLYHLKSKAFLM* |
| Ga0068645_10016591 | 3300005249 | Anoxygenic And Chlorotrophic Microbial Mat | RGRSKCPSYHPPTPYTLSPLLKGGEGRGEGGSYTHVPCPFGALLVTLYHFKSKAFLM* |
| Ga0068645_11174421 | 3300005249 | Anoxygenic And Chlorotrophic Microbial Mat | PPTPYTLSPLLKGGEGRGEGGSYTHVPCPFGALLVTLYHLKSKAFLM* |
| Ga0068635_10143052 | 3300005250 | Anoxygenic And Chlorotrophic Microbial Mat | TPYTLSPLPKGGEGRGEGGSYTRMPCPFGALLVTLYHFKSKA* |
| Ga0068635_10766242 | 3300005250 | Anoxygenic And Chlorotrophic Microbial Mat | LHIKKALASKWYYHSLVLHPPTPYTLSPLEKGGEGRGEGGSYTHVPCPFGALLVTLCHFKSKAFLM* |
| Ga0068647_10104263 | 3300005411 | Anoxygenic And Chlorotrophic Microbial Mat | TLSPLLKGGEGRGEGGSYTRMPCPFGALLVTLYHLKSKAFLM* |
| Ga0068646_10622482 | 3300005414 | Anoxygenic And Chlorotrophic Microbial Mat | SYHPPTPYTFSPLLKGGEGQGEGGAYTHVPCPFGALLVTLYHSKSKAFLM* |
| Ga0068706_10302961 | 3300005452 | Anoxygenic And Chlorotrophic | MVLHPPTPYTLSPLFKGGEGRGEGGSYTHVPYPFGALLVTLY |
| Ga0068706_10487091 | 3300005452 | Anoxygenic And Chlorotrophic | MLSPLLKGGEGRGEGGSYTYVPCPFRALLVTLYHFEAKAFLM* |
| Ga0068706_10611901 | 3300005452 | Anoxygenic And Chlorotrophic | YHPPTPYTLSPLLKGGEGRGEGGSYTHVPCPFGALLVTLYHLKSKAFLM* |
| Ga0068706_10638572 | 3300005452 | Anoxygenic And Chlorotrophic | HPPTPYTLSPLLKGGEGRGEGGSYTHVPCPFGALLVTLCQFSAKGF* |
| Ga0068706_10815221 | 3300005452 | Anoxygenic And Chlorotrophic | LSPLLKGGEGRGEGGSYTHVPCPFGALLVTLYHLKSKAFSM* |
| Ga0068706_10838492 | 3300005452 | Anoxygenic And Chlorotrophic | PPTPYTLSPLLKGGEGRGEGGSYTHVPCPFGALLVTLYHFKSKASLM* |
| Ga0068706_10899791 | 3300005452 | Anoxygenic And Chlorotrophic | YTLSPLLKGGEGRGEGGSYTHVPCPFGALLVTLYHLKSKALLI* |
| Ga0068706_10986491 | 3300005452 | Anoxygenic And Chlorotrophic | PTPYTLSPLLKGGEGRGEGGSYTHVPCPFGVLLVTLYQILAKGF* |
| Ga0068706_11002751 | 3300005452 | Anoxygenic And Chlorotrophic | YHPPTPYTLSPLLKGGEGRGEGGSYTHVPCPFGALLVTLYHFKSKAFLM* |
| Ga0068705_1000036524 | 3300005453 | Anoxygenic And Chlorotrophic | MALLPLVLHPPTPYTLSPLLKGGEGRGEGGSYTHVPCPFGALLVALS* |
| Ga0068705_1000095516 | 3300005453 | Anoxygenic And Chlorotrophic | LHPPTPYTLSPLLKGGEGRGEGGSYTHVPCPFGALLVTLYQYF* |
| Ga0068705_100017579 | 3300005453 | Anoxygenic And Chlorotrophic | MVLHPPTPYTLSPLLKGGEGRGEGGAYTHVSCPLGALLVTLYHLKSKAFLM* |
| Ga0068705_100058241 | 3300005453 | Anoxygenic And Chlorotrophic | HPPTPYTLSPLLKGGEGRGEGGSYTHVPCPFGALLVTLYQLDAKGF* |
| Ga0068705_100337763 | 3300005453 | Anoxygenic And Chlorotrophic | LHPPTPYTLSPLLKGGEGRGEGGSYTHVPCPFGALLVTLYHFKSKAFLT* |
| Ga0068705_100560971 | 3300005453 | Anoxygenic And Chlorotrophic | HPPTPYTLSPLLKGGEGRGEGGSYTHVPCPFGALLVTLYPFKSKAFLM* |
| Ga0068705_101195292 | 3300005453 | Anoxygenic And Chlorotrophic | VLHPPTPYTLSPLPKGGEGRGEGGSYTRMPYPFGALLVSLCQFSAKGF* |
| Ga0068705_101291773 | 3300005453 | Anoxygenic And Chlorotrophic | PLLKGGEGRGEGGSYTHVPCSFGALLVTLYHFKSKAFWM* |
| Ga0068705_101794881 | 3300005453 | Anoxygenic And Chlorotrophic | TLSPLLKGGEGRGEGGSDTHVPCPFGALLVTLYHFKSKAFLL* |
| Ga0068666_11126031 | 3300005495 | Anoxygenic And Chlorotrophic Microbial Mat | PYTLSPLLKGGEGRGEGGSYTHVPCPFGALLVTLYHFKSKAFLM* |
| Ga0081428_1079033 | 3300006068 | Hotsprings | HPPTPYTLSPLPKGGEGRGEGGSDTYMPCPFGVLLVTLYHSKSKAFWM* |
| Ga0068664_10135742 | 3300006380 | Anoxygenic And Chlorotrophic Microbial Mat | CPSYHPPTPYTLSPLLKGGEGRGEGGSYTHVPCLFGTLLVTLYHLKSCEEEVGTPA* |
| Ga0068664_10201063 | 3300006380 | Anoxygenic And Chlorotrophic Microbial Mat | VGRGRSKCPSYHPPTPYTLSPLLKGGEGRGEGGSDTHVPCPFGALLVTLYHFKSKAFLM* |
| Ga0068664_10559393 | 3300006380 | Anoxygenic And Chlorotrophic Microbial Mat | SLVLHPPTPYTLSPLLKGGEGRGEGGSYTHVPCPFGALLVTLYPFKSKAFLM* |
| Ga0068664_12086562 | 3300006380 | Anoxygenic And Chlorotrophic Microbial Mat | PSYHPPTPYTLSPLLKGGEGRGEGGADTHVPCPFGAFLMTLYYFKSKAFLM* |
| Ga0124914_11606071 | 3300010191 | Anoxygenic And Chlorotrophic Microbial Mat | PSYHPPTPYTLSPLLKGGEGRGEGGSYTHVPCPFGALLVTLYHFKSKAFLM* |
| Ga0124923_12351941 | 3300010196 | Anoxygenic And Chlorotrophic Microbial Mat | SYHPPTPYTLSPLLKGGEGRGEGGSYTHVPCPFGALLVTLSQRPS* |
| Ga0124912_10317142 | 3300010272 | Anoxygenic And Chlorotrophic Microbial Mat | SLVLHPPTPYTLSPLLKGGEGRGEGGAYTHVPCPFGALLVTLYHFKSKAFLM* |
| Ga0209670_1192951 | 3300025349 | Thermal Spring | PLLEGREARGEGGAYTHVPSPFGALLVALYQFSAKGL |
| Ga0209017_100152642 | 3300026280 | Anoxygenic And Chlorotrophic Microbial Mat | YTLSPLLKGGEGRVEGGSYTHVPCPFGALLVTLYHFKSKAFLI |
| Ga0209017_100451491 | 3300026280 | Anoxygenic And Chlorotrophic Microbial Mat | LFKGGEGWGEGGSYTHVPCPFGALLVTLYHLKSKAFLM |
| Ga0209809_10276173 | 3300026509 | Anoxygenic And Chlorotrophic | HPPTPYTLSPLLKGGEGRGEGGSYTHVPCPFGALLVTLYPFKSKAFLM |
| Ga0209809_10304021 | 3300026509 | Anoxygenic And Chlorotrophic | SPLLKGGEGRGEGGAYTHVPCPFGALLVTLYHFKSKAFLM |
| Ga0209809_10917261 | 3300026509 | Anoxygenic And Chlorotrophic | MSLLPSPHSYTLSPLLKGGEGRGEGGSYIHVPCPFGALLVTLYHFKSKAFLM |
| Ga0209691_10059023 | 3300027279 | Anoxygenic And Chlorotrophic | MVLHPPTPYTLSPLFKGGEGRGEGGSYTHVPYPFGALLVTLYHLKSKAFLM |
| Ga0209691_10664243 | 3300027279 | Anoxygenic And Chlorotrophic | LSPLEKGGEGRGEGGSYTHVPCPFGALLVTLCHFKSKAFLM |
| Ga0272447_10158111 | 3300028761 | Microbial Mat | LVLHPPTPYTLSPLLKGGEGRGEGGSYTHVPCPFGALLVTLYHFNSKAFLM |
| Ga0272447_10455742 | 3300028761 | Microbial Mat | MVLHPPTPYTLSPLLKRGEGRGERGSYTHVPYPFGALLVTLYHFKSNAF |
| Ga0308395_100171815 | 3300031245 | Hot Spring Phototrophic Mat | RYQPKMALLPLVLHPPTPYTLSPLLKGGEGRGEGGSYTPMPCPFGALLVTLYHLNSKAFL |
| Ga0308395_10049401 | 3300031245 | Hot Spring Phototrophic Mat | MALLPLVLHPPTPYTLSPLLKGGEGRGEGGSYTHVPCPFGALLVTLYHQIFSKRFL |
| Ga0308395_10074771 | 3300031245 | Hot Spring Phototrophic Mat | PYTLSPLLKGGEGRGEGGSYTPMPCPFGALLVTLYHFKSKAFLM |
| Ga0308395_10287081 | 3300031245 | Hot Spring Phototrophic Mat | GRSKCPSYHPPTPYTLSPLLKGGEGRGEGGSDTHVPCPFGALFVTLYHFKSKAFLM |
| Ga0308395_11023331 | 3300031245 | Hot Spring Phototrophic Mat | LFKGGEGRGEGGSYTHVPYPFGALLVTLYHLKSKAFLM |
| Ga0308394_10035491 | 3300031508 | Hot Spring Phototrophic Mat | YHSLVLHPPTPYTLSPLLKGGEGRGEGGSYTHVPCPFGALLVTLYHLKSKAFLM |
| Ga0308394_11242562 | 3300031508 | Hot Spring Phototrophic Mat | QPKMALLPLVLHPPTPYTLSPLLKGGEGRGEGGSYTPMPCPFGALLVTLYHLNSKAFLM |
| Ga0308399_10118441 | 3300031509 | Hot Spring Phototrophic Mat | MALLPLVLHPPTPYTLSPLLKGGEGRGEGGSYTHVPCPFGALLV |
| Ga0308399_10441101 | 3300031509 | Hot Spring Phototrophic Mat | PYTLSPLLKGGEGRGEGGSYTHVPCPFGALLVTLYPFKSKAFLM |
| Ga0308399_11155772 | 3300031509 | Hot Spring Phototrophic Mat | KGGEGRGEGGSYTHVPCPFGALLVTLYHFKSKAFLM |
| Ga0308399_11179301 | 3300031509 | Hot Spring Phototrophic Mat | LLHPPTPYTLSPLLKGGEGRGEGGSYTRMLCPLGALLVTLYHSKSKAFLM |
| Ga0308397_10048481 | 3300031512 | Hot Spring Phototrophic Mat | ELVLHPPTPYTLSPLLKGGEGWGEGGAYTHVPCPFGALRVTLYHLKSKAFLM |
| Ga0308397_10639771 | 3300031512 | Hot Spring Phototrophic Mat | TPYTLSPLLKGGEGRGEGGSYTHVPCPFGALLVTLYHLKSKALLI |
| Ga0308397_10693842 | 3300031512 | Hot Spring Phototrophic Mat | SKCPSYHPPTPYTLSPLLKGGEGRGEGGSYTHVPCLFGTLLVTLYHLKSCEEEVGTPA |
| Ga0308397_11108651 | 3300031512 | Hot Spring Phototrophic Mat | GRGRSKCPAYHPPTPYTLSPLLKGGEGRGEGGSYTHVPCPFGALLVTLYDLKSKAFLL |
| Ga0308412_10584001 | 3300031513 | Hot Spring Phototrophic Mat | PPTPYTLSPLLKGGEDRGEGGAYTRVPCPFGALLVTLYHFKSKAFLM |
| Ga0308412_10778782 | 3300031513 | Hot Spring Phototrophic Mat | PLVLHPPTPYTLSPLLKGGEGRGEGGSDTPMPCPFGALLVTLYHLNSKAFLM |
| Ga0308398_10050365 | 3300031516 | Hot Spring Phototrophic Mat | MVLHPPTPYTLSPLLKGGEGRGEGGAYTHVSCPLGALLVTLYHLKSKAFLM |
| Ga0308398_10521261 | 3300031516 | Hot Spring Phototrophic Mat | MGRGRSKCPSYHPPTPYTLSPLLKGGEGRGEGGSYTHVPCPFGALLVTLYHFKSKAFLM |
| Ga0308398_10965232 | 3300031516 | Hot Spring Phototrophic Mat | KGGEGRGEGGSDTHVPCPFGALLVTLYHFKSKAFLM |
| Ga0308398_11116711 | 3300031516 | Hot Spring Phototrophic Mat | MLSPLLKGGEGRGEGGSYTYVPCPFRALLVTLYHFEAKA |
| Ga0308392_10058615 | 3300031517 | Hot Spring Phototrophic Mat | SPLLKGGEGRGEGGSDTHVPCPFGALFVTLYHFKSKAFLM |
| Ga0308392_10682601 | 3300031517 | Hot Spring Phototrophic Mat | VGRGCSKCPSYHPPTPYTLSRLLKGGEGRGEGGSYTHVPCPFEALLVTLYHLKSKAFLM |
| Ga0308389_10191434 | 3300031518 | Hot Spring Phototrophic Mat | VLHPPTPYTLSPLLKGGEGRGEGGSYTHVPCPFGALLVTLYHLKSKAFLM |
| Ga0308389_11124682 | 3300031518 | Hot Spring Phototrophic Mat | VLHPPTPYALSPLLKGGEGRGEGGSYTHVPCPFGALLVTLYQIFSKWVSEWEEEH |
| Ga0308391_10926772 | 3300031567 | Hot Spring Phototrophic Mat | SYHSLVLHPPTPYTLSPLFKGGEGRGEGGSYTHVPYPFGALLVTLYHFEAKAFLM |
| Ga0308391_11107122 | 3300031567 | Hot Spring Phototrophic Mat | KCPSYHPPTPYTLSPLLKGGEGRGEGGSDTHVPCPFGALLVTLYHFKSKAFLM |
| Ga0308393_100177414 | 3300031568 | Hot Spring Phototrophic Mat | SKCPSYHSLVLHPPTPYTLSPLPKGGEGRGEGGSYTHVPCPFGALLVTLYHFKSKAFLM |
| Ga0308393_10017752 | 3300031568 | Hot Spring Phototrophic Mat | MGHLETLCIELVLHPPTPYTLSPLEKGGEGRGEGGSHTPMPCPFGALLVTLYYFKSKAFL |
| Ga0308393_10262252 | 3300031568 | Hot Spring Phototrophic Mat | YHPPTPYTLSPLLKGGEGRGEGGSYTHVPCPFGALLVTLYHFKSKASLM |
| Ga0308393_10903161 | 3300031568 | Hot Spring Phototrophic Mat | PTPYTLSPLLKGGEGRGEGGSDTHVPCPFGALLLTLYHFKSKAFLM |
| Ga0308393_11136862 | 3300031568 | Hot Spring Phototrophic Mat | CPSYHSLVLHPPTPYTLSPLLKGGEGRGEGGSYTHVPCPFGALLVTLYPFKSKAFLM |
| Ga0308401_10288451 | 3300031767 | Hot Spring Phototrophic Mat | KGGEGRGEGGSYTHVPCPFGALLVTLYHLKSKAFLM |
| Ga0308401_10587981 | 3300031767 | Hot Spring Phototrophic Mat | SKCPSYHPPTPYTLSPLEKGGKGRGEGGSYTHVPCPLGTLLVTLYHFNPKAFLM |
| Ga0308401_10890401 | 3300031767 | Hot Spring Phototrophic Mat | KCPSYHSLVLHPPTPYTLSPLLKGGEGRGEGGSYTHVPCPFGALLVTLYHFNSCEEEVGMPA |
| Ga0308415_10987581 | 3300031776 | Hot Spring Phototrophic Mat | AGALKMSLLPSPHSYTLSPLLKGGEGRGEGGSYIHVPCPFGALLVTLYHFKSKAFLM |
| Ga0308418_10032661 | 3300031783 | Hot Spring Phototrophic Mat | LKGGEGRGEGGSDTHVPCPFGALFVTLYHFKSKAFLM |
| Ga0308418_10110332 | 3300031783 | Hot Spring Phototrophic Mat | MSLLPSPTLYTLSPLLKGGEGRGEGGAYTHLPCPFGALLVTLYHLKSKAFLI |
| Ga0308418_10221021 | 3300031783 | Hot Spring Phototrophic Mat | TLSPLLKGGEGRGEGGSYTHVPCPFGALLVTLYHLKSKALLI |
| Ga0308411_100066215 | 3300031812 | Hot Spring Phototrophic Mat | YHPPTPYTLSPLLKGGEGRGEGGAYTHVPCPFGALLVTLYHLKSKAFLM |
| Ga0308411_100938183 | 3300031812 | Hot Spring Phototrophic Mat | PTPYTLSPLLKGGEGRGEGGSYTHVPCPFGALLVTLYHFKSKAFLM |
| Ga0308409_10034428 | 3300031830 | Hot Spring Phototrophic Mat | RSKCPSYHSLVLHPPTPYTLSPLLKGGEGRDEGGSDTHVPCPFGALLLTLYHFKSKAFLM |
| Ga0308409_10109591 | 3300031830 | Hot Spring Phototrophic Mat | PTPYTLSPLLKGGEGRGEGGSDTHVPCPFGALFVTLYHFKSKAFLM |
| Ga0308409_10608282 | 3300031830 | Hot Spring Phototrophic Mat | MVLHPPTPYTLSPLFKGGEGRGEGGSYTHVPYPFGALLVTLYHLK |
| Ga0308409_11274872 | 3300031830 | Hot Spring Phototrophic Mat | PYTLSPLLKGGEGRGEGGSYTHVPYPFGALLVTSQRPS |
| Ga0308409_11405881 | 3300031830 | Hot Spring Phototrophic Mat | PLFKGGEGRGEGGSYTHVPYPFGALLVTLYHFKSKAFLM |
| Ga0308408_10009241 | 3300031865 | Hot Spring Phototrophic Mat | YTLSPLLKGGEGRGEGGSDTHVPCPFGALFVTLYHFKSKAFLM |
| Ga0308408_10164691 | 3300031865 | Hot Spring Phototrophic Mat | KLLLHPPTPYTLSPLLKGGEGRGEGGSYTHVPCPFGALLVTLYHLKSKAFLM |
| Ga0308408_10363882 | 3300031865 | Hot Spring Phototrophic Mat | TIPPTPYTLSPLLKGGEDRGEGGAYTRVPCPFGALLVTLYHFKSKAFLM |
| Ga0308408_10760871 | 3300031865 | Hot Spring Phototrophic Mat | VLHPPTPYTLSPLLKGGEGRGEGGSDTHVPCPFGVLLVTLYHVKSKAFLM |
| Ga0308408_10857381 | 3300031865 | Hot Spring Phototrophic Mat | GRGRAKCPSYRPPTPYTLSPLLKGGEGRGEGGSYTHVPCPFGALLVTLYHLMSKAFLM |
| Ga0308408_11330542 | 3300031865 | Hot Spring Phototrophic Mat | HPPTPYTLSPLFKGGEGRGEGGSYTHVPYPFGALLVTLYHFKSKAFLM |
| Ga0308408_11332631 | 3300031865 | Hot Spring Phototrophic Mat | KCPAYHSLVLHPPTPYTPSPLLKGGEGRGEGGSYTHVPCPFGTLLVTLYHFKSKAFLM |
| Ga0308405_10196231 | 3300031875 | Hot Spring Phototrophic Mat | LLKGGEGQGEGGAYTHVPCPFGALLVTLYHSKSKAFLM |
| Ga0308405_11326731 | 3300031875 | Hot Spring Phototrophic Mat | LLKGGEGRGEGGSYTHVPCPFGALLVTLYHLKSKAFLM |
| Ga0308404_10456301 | 3300031878 | Hot Spring Phototrophic Mat | VLHPPTPYTLSPLLKGGEGRGEGGSYTHVPCPFGALLVTLYHFKSKAFLM |
| Ga0308404_10762271 | 3300031878 | Hot Spring Phototrophic Mat | TPYTLSPLLKGGEGRGEGGSYTHVPCPFGALLVTLYHFKSKAFLM |
| Ga0308406_10151682 | 3300031948 | Hot Spring Phototrophic Mat | MLLILFPYTLSPLLQGGEGRGEGGSYTHVPCPFGALLVTLYHFKSKAFLM |
| Ga0308406_10357472 | 3300031948 | Hot Spring Phototrophic Mat | KMALLPLVLHPPTPYTLSPLLKGGEGRGEGGSYTPMPCPFGALLVTLYHLNSKAFLM |
| Ga0308406_10756301 | 3300031948 | Hot Spring Phototrophic Mat | SYHPPTPYTLSPLFKGGEGRGEGGSYTHVPYPFGALLVTLYHLKSKAFLM |
| Ga0308406_10990182 | 3300031948 | Hot Spring Phototrophic Mat | RSKCPSYHPPTPYTLSPLLKGGEGRGEGGSYTHVPCLFGTLLVTLYHLKSCEEEVGTPA |
| Ga0308406_11256481 | 3300031948 | Hot Spring Phototrophic Mat | PTPYTLSPLLKGGEGRGEGGLYTHVPCPFGALLVTLYHLKSKAFLM |
| Ga0308420_11653561 | 3300031966 | Hot Spring Phototrophic Mat | LHPPTPYTLSPLLKGGEGRGEGGSYTHVPCPFGALLVTLYHFKSKAFLM |
| Ga0308420_11661131 | 3300031966 | Hot Spring Phototrophic Mat | SKCPSYHPPTPYTLSPLLKGGEGRGEGGSYTHVPCPFGALLVTLYHFRSKAFLM |
| Ga0308403_10908482 | 3300031980 | Hot Spring Phototrophic Mat | ETLYRKLVLHPPTPYTLSPLLKGGEGGSYTHVPCPFGALLVTL |
| Ga0308407_10111174 | 3300032034 | Hot Spring Phototrophic Mat | TPYTLSPLLKGGEGRGEGRSYTHVPCPFGALLVTLYHFKSKAFLM |
| Ga0308407_10129361 | 3300032034 | Hot Spring Phototrophic Mat | YHPPTPYTLSPLLKGGEGRGEGGSYTPMPCPFGALLVTLYHLNSKAFLM |
| Ga0308407_10381284 | 3300032034 | Hot Spring Phototrophic Mat | YTLSPLLKGGEGRGEGGSYTHVPCPFGALLVTLYHFKSKAFLM |
| Ga0308407_10887621 | 3300032034 | Hot Spring Phototrophic Mat | LSPLFKGGEGRGEGGSYTHVPYPFGALLVTLYHLKSKAFLM |
| Ga0308407_11058011 | 3300032034 | Hot Spring Phototrophic Mat | TPYTLPPLLKGGEGRGEGGSYTHVPCPFGALLVTLYHLKSKAFLM |
| Ga0308400_11222591 | 3300032045 | Hot Spring Phototrophic Mat | MSLLPLDPPTPSTLSPLLKGGEGRGEGGSHTHVPCPFGALLVTLYHFKSMAF |
| Ga0308400_11240811 | 3300032045 | Hot Spring Phototrophic Mat | YHSLVLHPPTPYTLSPLEKGGEGRGEGGSYTHVPCSFGAILVTLYHFKSKAFLM |
| Ga0308416_10368312 | 3300032049 | Hot Spring Phototrophic Mat | MSLLPFGNPVLHPPTPYTLSPLLKGGEGRGEGGAYTHVPCPFGALLVTLYH |
| Ga0308310_10338421 | 3300032056 | Hot Spring Phototrophic Mat | LSPLLKGGEGRGEGGSYTHVPCPFGALLVTLYHLKSKAFLM |
| Ga0308310_10436721 | 3300032056 | Hot Spring Phototrophic Mat | TLSPLLKGGEGRGEGGSYTHVPCPFGALLVTLYHFKSKAFLM |
| Ga0308310_10520241 | 3300032056 | Hot Spring Phototrophic Mat | VLHPPTPYTLSPLLKGGEGRGEGGSYTHVPCPFGALLVTLYHSKSCEEEVGMPA |
| Ga0308310_10553711 | 3300032056 | Hot Spring Phototrophic Mat | PPTPYTLSPLPKGGEGRGEGGSDTHLPCPFGALLVTLYPLKSKAFWM |
| Ga0308310_11254832 | 3300032056 | Hot Spring Phototrophic Mat | LLKGGEGRGEGGSYTRVPCPFGALLVTLYHLKSKAFLM |
| Ga0308310_11515861 | 3300032056 | Hot Spring Phototrophic Mat | MVLHPPTPYTLSPLLKGGESWGEEGSYTRMPCLFGALLVTLYQFSAKGF |
| Ga0308419_10122471 | 3300032058 | Hot Spring Phototrophic Mat | TPYTLSPLLKGGEGRGEGGSYTHVPCPFGALLVTLYHFKSKALLM |
| Ga0308419_11714521 | 3300032058 | Hot Spring Phototrophic Mat | HPPTPYTLSPLLKGGEGRGEGGSDTHVPCPFGALLVTLYHLKSKAFLM |
| Ga0308414_10442581 | 3300032356 | Hot Spring Phototrophic Mat | SLVLHPPTPYTLSPLLKGGEGRGEGGSYTHVPCPFGALLVTLYHFKSKAFLM |
| Ga0326763_10009801 | 3300033484 | Hot Spring Water | MVLHPPTPYTLSPLLKGGKGRGEEGLYPHVSCLFGALLGTLYHLQSKT |
| Ga0308413_002281_9804_9938 | 3300033886 | Hot Spring Phototrophic Mat | PYTLSPLPKGGEGRGEGGSYTHVPCPFGALLVTLYHFKSKAFLM |
| Ga0308413_017385_1_177 | 3300033886 | Hot Spring Phototrophic Mat | YHPPTPYTLSPLLKGGEGRGEGGSYTHVPCPFGALLVTLYHFKSKAFLKCEEEVGMPA |
| Ga0308413_169643_340_501 | 3300033886 | Hot Spring Phototrophic Mat | IELVLHPPTPYTLSPLLKGGEGRGEGGSYTHLPCPFGALLVTLYHSNSKAFLM |
| Ga0370516_141510_607_747 | 3300034696 | Hot Spring Water | YTLSPLLKGGEGRGEGGSDTHLPCPFGALLVSLYHFICEEEVGMLA |
| ⦗Top⦘ |