


| Basic Information | |
|---|---|
| Family ID | F057604 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 136 |
| Average Sequence Length | 42 residues |
| Representative Sequence | EAARGMQLLNKKYFPWKQLLGFFASFSRRERTVFVIRPG |
| Number of Associated Samples | 115 |
| Number of Associated Scaffolds | 136 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.74 % |
| % of genes near scaffold ends (potentially truncated) | 99.26 % |
| % of genes from short scaffolds (< 2000 bps) | 94.85 % |
| Associated GOLD sequencing projects | 108 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.29 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (93.382 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (24.265 % of family members) |
| Environment Ontology (ENVO) | Unclassified (32.353 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (56.618 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 37.31% β-sheet: 0.00% Coil/Unstructured: 62.69% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.29 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 136 Family Scaffolds |
|---|---|---|
| PF09723 | Zn-ribbon_8 | 10.29 |
| PF01008 | IF-2B | 9.56 |
| PF02615 | Ldh_2 | 8.09 |
| PF00144 | Beta-lactamase | 5.15 |
| PF07676 | PD40 | 4.41 |
| PF00903 | Glyoxalase | 1.47 |
| PF02897 | Peptidase_S9_N | 1.47 |
| PF00072 | Response_reg | 0.74 |
| PF00581 | Rhodanese | 0.74 |
| PF02621 | VitK2_biosynth | 0.74 |
| PF00174 | Oxidored_molyb | 0.74 |
| PF01243 | Putative_PNPOx | 0.74 |
| PF07045 | DUF1330 | 0.74 |
| PF00557 | Peptidase_M24 | 0.74 |
| PF04389 | Peptidase_M28 | 0.74 |
| PF00239 | Resolvase | 0.74 |
| PF01053 | Cys_Met_Meta_PP | 0.74 |
| PF02517 | Rce1-like | 0.74 |
| PF01022 | HTH_5 | 0.74 |
| PF12681 | Glyoxalase_2 | 0.74 |
| PF00069 | Pkinase | 0.74 |
| PF01545 | Cation_efflux | 0.74 |
| COG ID | Name | Functional Category | % Frequency in 136 Family Scaffolds |
|---|---|---|---|
| COG0182 | 5-methylthioribose/5-deoxyribulose 1-phosphate isomerase (methionine salvage pathway), a paralog of eIF-2B alpha subunit | Amino acid transport and metabolism [E] | 9.56 |
| COG1184 | Translation initiation factor 2B subunit, eIF-2B alpha/beta/delta family | Translation, ribosomal structure and biogenesis [J] | 9.56 |
| COG2055 | Malate/lactate/ureidoglycolate dehydrogenase, LDH2 family | Energy production and conversion [C] | 8.09 |
| COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 5.15 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 5.15 |
| COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 5.15 |
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 2.94 |
| COG1505 | Prolyl endopeptidase PreP, S9A serine peptidase family | Amino acid transport and metabolism [E] | 1.47 |
| COG1770 | Protease II | Amino acid transport and metabolism [E] | 1.47 |
| COG0053 | Divalent metal cation (Fe/Co/Zn/Cd) efflux pump | Inorganic ion transport and metabolism [P] | 0.74 |
| COG0075 | Archaeal aspartate aminotransferase or a related aminotransferase, includes purine catabolism protein PucG | Amino acid transport and metabolism [E] | 0.74 |
| COG0156 | 7-keto-8-aminopelargonate synthetase or related enzyme | Coenzyme transport and metabolism [H] | 0.74 |
| COG0399 | dTDP-4-amino-4,6-dideoxygalactose transaminase | Cell wall/membrane/envelope biogenesis [M] | 0.74 |
| COG0436 | Aspartate/methionine/tyrosine aminotransferase | Amino acid transport and metabolism [E] | 0.74 |
| COG0520 | Selenocysteine lyase/Cysteine desulfurase | Amino acid transport and metabolism [E] | 0.74 |
| COG0626 | Cystathionine beta-lyase/cystathionine gamma-synthase | Amino acid transport and metabolism [E] | 0.74 |
| COG1230 | Co/Zn/Cd efflux system component | Inorganic ion transport and metabolism [P] | 0.74 |
| COG1266 | Membrane protease YdiL, CAAX protease family | Posttranslational modification, protein turnover, chaperones [O] | 0.74 |
| COG1427 | Chorismate dehydratase (menaquinone biosynthesis, futalosine pathway) | Coenzyme transport and metabolism [H] | 0.74 |
| COG1921 | Seryl-tRNA(Sec) selenium transferase | Translation, ribosomal structure and biogenesis [J] | 0.74 |
| COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 0.74 |
| COG1982 | Arginine/lysine/ornithine decarboxylase | Amino acid transport and metabolism [E] | 0.74 |
| COG2008 | Threonine aldolase | Amino acid transport and metabolism [E] | 0.74 |
| COG2041 | Molybdopterin-dependent catalytic subunit of periplasmic DMSO/TMAO and protein-methionine-sulfoxide reductases | Energy production and conversion [C] | 0.74 |
| COG2452 | Predicted site-specific integrase-resolvase | Mobilome: prophages, transposons [X] | 0.74 |
| COG2873 | O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependent | Amino acid transport and metabolism [E] | 0.74 |
| COG3915 | Uncharacterized conserved protein | Function unknown [S] | 0.74 |
| COG3965 | Predicted Co/Zn/Cd cation transporter, cation efflux family | Inorganic ion transport and metabolism [P] | 0.74 |
| COG4100 | Cystathionine beta-lyase family protein involved in aluminum resistance | Inorganic ion transport and metabolism [P] | 0.74 |
| COG4449 | Predicted protease, Abi (CAAX) family | General function prediction only [R] | 0.74 |
| COG5470 | Uncharacterized conserved protein, DUF1330 family | Function unknown [S] | 0.74 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 93.38 % |
| Unclassified | root | N/A | 6.62 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002568|C688J35102_120985894 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 6400 | Open in IMG/M |
| 3300002917|JGI25616J43925_10232390 | Not Available | 698 | Open in IMG/M |
| 3300004080|Ga0062385_11049486 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
| 3300004091|Ga0062387_101361751 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium 13_1_20CM_4_60_6 | 563 | Open in IMG/M |
| 3300005174|Ga0066680_10595947 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 692 | Open in IMG/M |
| 3300005332|Ga0066388_103502757 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 801 | Open in IMG/M |
| 3300005545|Ga0070695_101560466 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 550 | Open in IMG/M |
| 3300005555|Ga0066692_10330860 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 966 | Open in IMG/M |
| 3300005556|Ga0066707_10819022 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
| 3300005576|Ga0066708_10674825 | Not Available | 656 | Open in IMG/M |
| 3300005591|Ga0070761_10687931 | Not Available | 640 | Open in IMG/M |
| 3300005598|Ga0066706_11325187 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
| 3300005921|Ga0070766_10462365 | Not Available | 839 | Open in IMG/M |
| 3300006059|Ga0075017_101447571 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 541 | Open in IMG/M |
| 3300006173|Ga0070716_101659581 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 526 | Open in IMG/M |
| 3300006176|Ga0070765_100285965 | All Organisms → cellular organisms → Bacteria | 1521 | Open in IMG/M |
| 3300006176|Ga0070765_101128241 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 741 | Open in IMG/M |
| 3300006176|Ga0070765_101995906 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300006176|Ga0070765_102050062 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 535 | Open in IMG/M |
| 3300006804|Ga0079221_10268435 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 981 | Open in IMG/M |
| 3300007255|Ga0099791_10196406 | All Organisms → cellular organisms → Bacteria | 950 | Open in IMG/M |
| 3300007265|Ga0099794_10310437 | All Organisms → cellular organisms → Bacteria | 817 | Open in IMG/M |
| 3300009012|Ga0066710_101701955 | All Organisms → cellular organisms → Bacteria | 960 | Open in IMG/M |
| 3300009038|Ga0099829_11347600 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 590 | Open in IMG/M |
| 3300009088|Ga0099830_10818020 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 769 | Open in IMG/M |
| 3300009089|Ga0099828_11013256 | All Organisms → cellular organisms → Bacteria | 740 | Open in IMG/M |
| 3300009089|Ga0099828_11161560 | Not Available | 685 | Open in IMG/M |
| 3300010046|Ga0126384_12443584 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 506 | Open in IMG/M |
| 3300010048|Ga0126373_10428292 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1353 | Open in IMG/M |
| 3300010337|Ga0134062_10116955 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1159 | Open in IMG/M |
| 3300010396|Ga0134126_10520388 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1369 | Open in IMG/M |
| 3300010865|Ga0126346_1206772 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 542 | Open in IMG/M |
| 3300010880|Ga0126350_12111336 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 735 | Open in IMG/M |
| 3300011120|Ga0150983_12596649 | Not Available | 1201 | Open in IMG/M |
| 3300011269|Ga0137392_11459255 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300011270|Ga0137391_10590610 | All Organisms → cellular organisms → Bacteria | 932 | Open in IMG/M |
| 3300011271|Ga0137393_10638585 | All Organisms → cellular organisms → Bacteria | 913 | Open in IMG/M |
| 3300012199|Ga0137383_11024858 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 600 | Open in IMG/M |
| 3300012206|Ga0137380_10363013 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1290 | Open in IMG/M |
| 3300012206|Ga0137380_10890337 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 765 | Open in IMG/M |
| 3300012207|Ga0137381_10355878 | All Organisms → cellular organisms → Bacteria | 1276 | Open in IMG/M |
| 3300012349|Ga0137387_11203582 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
| 3300012351|Ga0137386_11176003 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 538 | Open in IMG/M |
| 3300012357|Ga0137384_10335779 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1254 | Open in IMG/M |
| 3300012361|Ga0137360_10869652 | All Organisms → cellular organisms → Bacteria | 777 | Open in IMG/M |
| 3300012361|Ga0137360_10968823 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 734 | Open in IMG/M |
| 3300012362|Ga0137361_10619968 | All Organisms → cellular organisms → Bacteria | 991 | Open in IMG/M |
| 3300012362|Ga0137361_10710599 | All Organisms → cellular organisms → Bacteria | 918 | Open in IMG/M |
| 3300012363|Ga0137390_11118054 | All Organisms → cellular organisms → Bacteria | 737 | Open in IMG/M |
| 3300012917|Ga0137395_10721730 | All Organisms → cellular organisms → Bacteria | 721 | Open in IMG/M |
| 3300012917|Ga0137395_11107207 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
| 3300012923|Ga0137359_10838248 | All Organisms → cellular organisms → Bacteria | 795 | Open in IMG/M |
| 3300012927|Ga0137416_10832388 | All Organisms → cellular organisms → Bacteria | 818 | Open in IMG/M |
| 3300012929|Ga0137404_10051157 | All Organisms → cellular organisms → Bacteria | 3167 | Open in IMG/M |
| 3300012930|Ga0137407_10695237 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 958 | Open in IMG/M |
| 3300012964|Ga0153916_11279641 | All Organisms → cellular organisms → Bacteria | 811 | Open in IMG/M |
| 3300012971|Ga0126369_12952012 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 557 | Open in IMG/M |
| 3300012986|Ga0164304_11125003 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
| 3300014201|Ga0181537_11243100 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 502 | Open in IMG/M |
| 3300014495|Ga0182015_10425868 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 854 | Open in IMG/M |
| 3300014501|Ga0182024_11241858 | All Organisms → cellular organisms → Bacteria | 868 | Open in IMG/M |
| 3300015054|Ga0137420_1405919 | All Organisms → cellular organisms → Bacteria | 1065 | Open in IMG/M |
| 3300015087|Ga0167637_1014169 | All Organisms → cellular organisms → Bacteria | 1167 | Open in IMG/M |
| 3300017656|Ga0134112_10490775 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300017933|Ga0187801_10009223 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3202 | Open in IMG/M |
| 3300017955|Ga0187817_10985946 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 540 | Open in IMG/M |
| 3300017972|Ga0187781_10220650 | All Organisms → cellular organisms → Bacteria | 1339 | Open in IMG/M |
| 3300017974|Ga0187777_10293002 | All Organisms → cellular organisms → Bacteria | 1111 | Open in IMG/M |
| 3300017974|Ga0187777_10462396 | Not Available | 883 | Open in IMG/M |
| 3300017993|Ga0187823_10193058 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → unclassified Pirellulales → Pirellulales bacterium | 664 | Open in IMG/M |
| 3300018433|Ga0066667_10725600 | All Organisms → cellular organisms → Bacteria | 836 | Open in IMG/M |
| 3300018468|Ga0066662_11281691 | All Organisms → cellular organisms → Bacteria | 749 | Open in IMG/M |
| 3300020579|Ga0210407_10922193 | All Organisms → cellular organisms → Bacteria | 669 | Open in IMG/M |
| 3300020579|Ga0210407_11225419 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
| 3300020581|Ga0210399_10218482 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1587 | Open in IMG/M |
| 3300020581|Ga0210399_10928583 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 704 | Open in IMG/M |
| 3300020582|Ga0210395_11008883 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 616 | Open in IMG/M |
| 3300021088|Ga0210404_10652355 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
| 3300021168|Ga0210406_10183248 | All Organisms → cellular organisms → Bacteria | 1743 | Open in IMG/M |
| 3300021168|Ga0210406_10232838 | All Organisms → cellular organisms → Bacteria | 1517 | Open in IMG/M |
| 3300021170|Ga0210400_10202476 | All Organisms → cellular organisms → Bacteria | 1614 | Open in IMG/M |
| 3300021170|Ga0210400_11430352 | Not Available | 550 | Open in IMG/M |
| 3300021171|Ga0210405_10621273 | All Organisms → cellular organisms → Bacteria | 840 | Open in IMG/M |
| 3300021401|Ga0210393_10381833 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1148 | Open in IMG/M |
| 3300021405|Ga0210387_10053422 | All Organisms → cellular organisms → Bacteria | 3257 | Open in IMG/M |
| 3300021420|Ga0210394_10801338 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 823 | Open in IMG/M |
| 3300021420|Ga0210394_11225679 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 643 | Open in IMG/M |
| 3300021476|Ga0187846_10309054 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_58_21 | 653 | Open in IMG/M |
| 3300021478|Ga0210402_11142887 | All Organisms → cellular organisms → Bacteria | 706 | Open in IMG/M |
| 3300021478|Ga0210402_11358556 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 638 | Open in IMG/M |
| 3300021479|Ga0210410_10154742 | All Organisms → cellular organisms → Bacteria | 2044 | Open in IMG/M |
| 3300021479|Ga0210410_11057714 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 701 | Open in IMG/M |
| 3300021479|Ga0210410_11796136 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300021861|Ga0213853_10729690 | All Organisms → cellular organisms → Bacteria | 1310 | Open in IMG/M |
| 3300022531|Ga0242660_1184705 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
| 3300024323|Ga0247666_1097828 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_4_58_4 | 583 | Open in IMG/M |
| 3300024330|Ga0137417_1483251 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1681 | Open in IMG/M |
| 3300026294|Ga0209839_10035358 | All Organisms → cellular organisms → Bacteria | 1872 | Open in IMG/M |
| 3300026294|Ga0209839_10271776 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 526 | Open in IMG/M |
| 3300026312|Ga0209153_1110293 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1039 | Open in IMG/M |
| 3300026328|Ga0209802_1302327 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300026330|Ga0209473_1076442 | All Organisms → cellular organisms → Bacteria | 1418 | Open in IMG/M |
| 3300026496|Ga0257157_1031081 | All Organisms → cellular organisms → Bacteria | 881 | Open in IMG/M |
| 3300026529|Ga0209806_1185669 | All Organisms → cellular organisms → Bacteria | 745 | Open in IMG/M |
| 3300026540|Ga0209376_1208498 | All Organisms → cellular organisms → Bacteria | 881 | Open in IMG/M |
| 3300026551|Ga0209648_10426403 | All Organisms → cellular organisms → Bacteria | 845 | Open in IMG/M |
| 3300027070|Ga0208365_1025317 | All Organisms → cellular organisms → Bacteria | 772 | Open in IMG/M |
| 3300027074|Ga0208092_108134 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 641 | Open in IMG/M |
| 3300027671|Ga0209588_1086417 | All Organisms → cellular organisms → Bacteria | 1012 | Open in IMG/M |
| 3300027698|Ga0209446_1031997 | All Organisms → cellular organisms → Bacteria | 1321 | Open in IMG/M |
| 3300027775|Ga0209177_10262053 | All Organisms → cellular organisms → Bacteria | 643 | Open in IMG/M |
| 3300027846|Ga0209180_10432597 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 743 | Open in IMG/M |
| 3300027857|Ga0209166_10482468 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 638 | Open in IMG/M |
| 3300027862|Ga0209701_10581542 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 597 | Open in IMG/M |
| 3300027895|Ga0209624_10236820 | All Organisms → cellular organisms → Bacteria | 1213 | Open in IMG/M |
| 3300028016|Ga0265354_1027524 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 546 | Open in IMG/M |
| 3300028037|Ga0265349_1000316 | All Organisms → cellular organisms → Bacteria | 6008 | Open in IMG/M |
| 3300028047|Ga0209526_10822750 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
| 3300028536|Ga0137415_10690626 | All Organisms → cellular organisms → Bacteria | 833 | Open in IMG/M |
| 3300028906|Ga0308309_11915150 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 500 | Open in IMG/M |
| 3300030813|Ga0265750_1053557 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 616 | Open in IMG/M |
| 3300030878|Ga0265770_1011366 | Not Available | 1306 | Open in IMG/M |
| 3300030879|Ga0265765_1000549 | All Organisms → cellular organisms → Bacteria | 3020 | Open in IMG/M |
| 3300031708|Ga0310686_118002375 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → unclassified Pirellulales → Pirellulales bacterium | 641 | Open in IMG/M |
| 3300031715|Ga0307476_11401610 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 508 | Open in IMG/M |
| 3300031754|Ga0307475_10382745 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1130 | Open in IMG/M |
| 3300031754|Ga0307475_10660018 | All Organisms → cellular organisms → Bacteria | 835 | Open in IMG/M |
| 3300031754|Ga0307475_11104161 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
| 3300031754|Ga0307475_11372417 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
| 3300031820|Ga0307473_10459775 | All Organisms → cellular organisms → Bacteria | 850 | Open in IMG/M |
| 3300031823|Ga0307478_11572986 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300031962|Ga0307479_11300622 | All Organisms → cellular organisms → Bacteria | 688 | Open in IMG/M |
| 3300031996|Ga0308176_10712234 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1042 | Open in IMG/M |
| 3300032205|Ga0307472_101019519 | All Organisms → cellular organisms → Bacteria | 777 | Open in IMG/M |
| 3300032892|Ga0335081_12640294 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300033513|Ga0316628_103293327 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → unclassified Pirellulales → Pirellulales bacterium | 586 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 24.26% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 16.91% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 7.35% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 6.62% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 5.15% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.41% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.68% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.68% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.21% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.21% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.21% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.21% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.47% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.47% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.47% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 1.47% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.47% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 1.47% |
| Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 0.74% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.74% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.74% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.74% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.74% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.74% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.74% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.74% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.74% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.74% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.74% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.74% |
| Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 0.74% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.74% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300002917 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_100cm | Environmental | Open in IMG/M |
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010865 | Boreal forest soil eukaryotic communities from Alaska, USA - C3-3 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010880 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012964 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 4 metaG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300014201 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaG | Environmental | Open in IMG/M |
| 3300014495 | Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015087 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G6A, Proglacial plain, adjacent to northern proglacial tributary) | Environmental | Open in IMG/M |
| 3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
| 3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300017993 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_3 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021476 | Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2) | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021861 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022531 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-28-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300024323 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK07 | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300026294 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 (SPAdes) | Environmental | Open in IMG/M |
| 3300026312 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 (SPAdes) | Environmental | Open in IMG/M |
| 3300026328 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes) | Environmental | Open in IMG/M |
| 3300026330 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes) | Environmental | Open in IMG/M |
| 3300026496 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-69-A | Environmental | Open in IMG/M |
| 3300026529 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes) | Environmental | Open in IMG/M |
| 3300026540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027070 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF004 (SPAdes) | Environmental | Open in IMG/M |
| 3300027074 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF014 (SPAdes) | Environmental | Open in IMG/M |
| 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027698 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028016 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 | Host-Associated | Open in IMG/M |
| 3300028037 | Soil microbial communities from Maridalen valley, Oslo, Norway - NSE1 | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300030813 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSE1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030879 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300033513 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_C | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| C688J35102_1209858945 | 3300002568 | Soil | GVEFEYGMQLLNKKYFPWKQLLDFFAKFRPRERAVIAITPVDARK* |
| JGI25616J43925_102323901 | 3300002917 | Grasslands Soil | GMQLLNKKYFPWKQMLDFFASFRRRERTVFVIRSAETEVVK* |
| Ga0062385_110494861 | 3300004080 | Bog Forest Soil | VTGPEADRGMQLLNKKYFPLKQILGFFAAFRPRQRTVFAIRPA* |
| Ga0062387_1013617512 | 3300004091 | Bog Forest Soil | EILPGERAARGIQLLNRKYFPVKQILGFFASFSRRERVVFAIRPA* |
| Ga0066680_105959471 | 3300005174 | Soil | EEAAKGMRLLNRKYLPLKQLLDFFAMFRQRERTVFALRIV* |
| Ga0066388_1035027572 | 3300005332 | Tropical Forest Soil | SEAEHGMKELNKKYVPWKQLLDFFASFRKRERTVFAIRPA* |
| Ga0070695_1015604662 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | FPYGMRLLNKKYFPWKQLLDFFAKFRPHERAVIAIMPAKAWK* |
| Ga0066692_103308603 | 3300005555 | Soil | ARGVQLLNKKYFPWKQLLDFFAKFRNRQHTVFVLRSA* |
| Ga0066707_108190222 | 3300005556 | Soil | QAQIVTGEEDARGVRLLNKKYFPWKQLLDFFAKFRNRKHTVFVLRPA* |
| Ga0066708_106748251 | 3300005576 | Soil | HGMQLLNKKYVPWKQLLDFFAMFRKRERTVFVIRPT* |
| Ga0070761_106879311 | 3300005591 | Soil | RAEILSGDVALHATRLLNRKYFPLKQILGFFALFSRRERVVMALRPA* |
| Ga0066706_113251871 | 3300005598 | Soil | GEEAARGMQLLNRKYFPWKQLLGFFASFSRRGRTVFVIRPA* |
| Ga0070766_104623651 | 3300005921 | Soil | MGLLNKRYFPLKQLLGFFAQFSRRPRIVIALHPA* |
| Ga0075017_1014475711 | 3300006059 | Watersheds | RGMALLNKKYFPWKQLLGFFALFSNRERIVFVIRPV* |
| Ga0070716_1016595811 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | ERGMQLLNKKYWPWKQILDFFSRFGKHGRVMFAIREAK* |
| Ga0070765_1002859653 | 3300006176 | Soil | GEIASQAMRLLNKKYFPLKQLLGFFAVFSRRERIVMAIRPA* |
| Ga0070765_1011282411 | 3300006176 | Soil | EEATYGMRLLNLKYFPWKQLLGFVALFSRRERIVMAIRPE* |
| Ga0070765_1019959061 | 3300006176 | Soil | ARAVTGEEAARGMRLLNSKYFPLKQILGFFAFFSRRERVVFAIRPA* |
| Ga0070765_1020500621 | 3300006176 | Soil | DANAEIVTGEIASQAMKLLNKKYFPLKQILGFFALFSRRERIVMAIRPA* |
| Ga0079221_102684351 | 3300006804 | Agricultural Soil | HGMQLLNRKYLPWKQLLDFFAMFRKRERTVFVIRPA* |
| Ga0099791_101964061 | 3300007255 | Vadose Zone Soil | PEAEHGMRLLNKKYVPWKQLLDFFAMFRQRERTVFVIRPA* |
| Ga0099794_103104371 | 3300007265 | Vadose Zone Soil | GAEAEHGMKLLNKKYMPWKQLLDFFSFFSRNKRVVFLIRPA* |
| Ga0066710_1017019552 | 3300009012 | Grasslands Soil | EAEHGMKLLNKKYAPWKHLLDFFAKFRKRERTVFVIRPV |
| Ga0099829_113476001 | 3300009038 | Vadose Zone Soil | IVTGDAAQHGMGLLNKKYIPWKQLLDFFSSFSRHTRVVFAIRPA* |
| Ga0099830_108180201 | 3300009088 | Vadose Zone Soil | VTGAEAEHGMGLLNQKYVPWKQLLDFFARFRERERTVFAIRPV* |
| Ga0099828_110132561 | 3300009089 | Vadose Zone Soil | EAARGMQLLNKKYFPWKQLLGFFASFSRRERTVFVIRPG* |
| Ga0099828_111615601 | 3300009089 | Vadose Zone Soil | MRLLNEKYLPWKQLLDFFAKFRKRERTVFVIRPAENEATK* |
| Ga0126384_124435841 | 3300010046 | Tropical Forest Soil | GTEFSYGMQLLNKKYFPWKQVLDFFASFVRREHAMIAISPV* |
| Ga0126373_104282921 | 3300010048 | Tropical Forest Soil | ARVEILAGMEAQHGMQLLNQKYAPWKQLLDFFAMFRKRERTVFLIRPN* |
| Ga0134062_101169551 | 3300010337 | Grasslands Soil | AARGMQLLNRKYFPWKQLLGFFASFSRRGRTVFVIRPA* |
| Ga0134126_105203881 | 3300010396 | Terrestrial Soil | MRLLNKKYFPWKQLLDFFAKFLPHERAVIAIMPAKAWK* |
| Ga0126346_12067721 | 3300010865 | Boreal Forest Soil | DANAEIVTGESASQAMKLLNKKYFPLKQLLGFFALFSRRERIVMAIRPA* |
| Ga0126350_121113361 | 3300010880 | Boreal Forest Soil | ESASQAMKLLNKKYFPLKQLLGFFALFSRRERIVMAIRPA* |
| Ga0150983_125966492 | 3300011120 | Forest Soil | GMGLLNKKYFPWKQILSLFALFSRRERVVMAIHPA* |
| Ga0137392_114592551 | 3300011269 | Vadose Zone Soil | EHGMKLLNKKYMPWKQLLDFFSFFSRNKRVVFLIRPA* |
| Ga0137391_105906102 | 3300011270 | Vadose Zone Soil | EIISGEDAARGIQLLNKKYFPWKQLLAVFASLSRRERIVFAIRPA* |
| Ga0137393_106385851 | 3300011271 | Vadose Zone Soil | AEHGMTLLNKKYFPWKQLLGFFSLFSRNKPVVFLIRPA* |
| Ga0137383_110248581 | 3300012199 | Vadose Zone Soil | HGMRLLNQKYVPWKQLLDFFARFRERERTVFAIRPA* |
| Ga0137380_103630131 | 3300012206 | Vadose Zone Soil | IVTGAEAEHGMRLLNQKYVPWKQLLDFFARFRERERTVFAIRPA* |
| Ga0137380_108903371 | 3300012206 | Vadose Zone Soil | GMGLLNQKYVPWKQLLDFFARFRKRERTVFAIRPA* |
| Ga0137381_103558784 | 3300012207 | Vadose Zone Soil | ARGMQLLNRKYFPWKQLLGFFASFSRRERTVFEIRPA* |
| Ga0137387_112035821 | 3300012349 | Vadose Zone Soil | MQLLNRKYLPWKQLLDFFAMFRKRERTVFVIHPA* |
| Ga0137386_111760032 | 3300012351 | Vadose Zone Soil | AEAQHGMQLLNRKYFPVKQLLDFLAMFRRRERTVFLIRPA* |
| Ga0137384_103357793 | 3300012357 | Vadose Zone Soil | VTGAEAEHGMGLLNQKYVPWKQLLDFFARFRKRERTVFAIRPA* |
| Ga0137360_108696522 | 3300012361 | Vadose Zone Soil | EIISGEEAVRGMQLLNKKYFPWKQLLAVFAFFSSRERIVFAIRPA* |
| Ga0137360_109688232 | 3300012361 | Vadose Zone Soil | CGTQLLKKKYFPWKQLLDFFAKFRNRDHTVFVLRPA* |
| Ga0137361_106199681 | 3300012362 | Vadose Zone Soil | TGEEAARGMQLLNKKYFPWKQLLGFFASFSRRGRTVFVIHPA* |
| Ga0137361_107105993 | 3300012362 | Vadose Zone Soil | AEAEHGMKLLNKKYMPWKQFLDFFSFFSRNKRVVFLIRPA* |
| Ga0137390_111180542 | 3300012363 | Vadose Zone Soil | VTGAEAEHGMKLLNKKYMPWKQLLDFFSFFSRNKRVVFLIRPA* |
| Ga0137395_107217303 | 3300012917 | Vadose Zone Soil | EAAARGMQLLNKKYFPWKQLLGFFASFSRRGRTVFAIRPADVTK* |
| Ga0137395_111072072 | 3300012917 | Vadose Zone Soil | ARGMQLLNRKYFPWKQLLGFFASFSRRGRTVFVIRPA* |
| Ga0137359_108382482 | 3300012923 | Vadose Zone Soil | EEAEHGMKLLNKKYSPWRQILGFFSLFSRQKRVVFVIRPA* |
| Ga0137416_108323882 | 3300012927 | Vadose Zone Soil | EARVAILTGEEAARGMRLLNKKYFPWKQMLDFFAMFRRRERTVFAIRPA* |
| Ga0137404_100511573 | 3300012929 | Vadose Zone Soil | HGMKLLNKKYVPWKQLLDFFASFRRRERIVFAIRPA* |
| Ga0137407_106952372 | 3300012930 | Vadose Zone Soil | RGMQLLNKKYWPWKQLLDFFASFRRRERIVFAIRPA* |
| Ga0153916_112796411 | 3300012964 | Freshwater Wetlands | MRLLDRKYVPWKQLLDFFAMFRRRQRIVMAIRPE* |
| Ga0126369_129520121 | 3300012971 | Tropical Forest Soil | PARAEILSGKEANHGMQLLNRKYLPWKQVLDFFAMFRKRERTVFVIRPV* |
| Ga0164304_111250032 | 3300012986 | Soil | TGAEAENGMRFLNKKYLPWKQLLDFFASFRRRERIVFVIRPV* |
| Ga0181537_112431002 | 3300014201 | Bog | DATAEIVAKQEAARGMRLLNKKYFPLKQILGFFALFSRQPRLVIALRPG* |
| Ga0182015_104258681 | 3300014495 | Palsa | RRGKILGEWIDATAQIVTKEEAVRGMRLLNQKYFPLKQILGFFALFSRQPRLVIALRPG* |
| Ga0182024_112418581 | 3300014501 | Permafrost | GEEAARGMRLLNKKYFPLKQILGFFALFSRGERIVIALRPA* |
| Ga0137420_14059191 | 3300015054 | Vadose Zone Soil | IVTGEEAARGMQLLNRKYFPWKQLLGFFASFSRRERTVFVIRPA* |
| Ga0167637_10141691 | 3300015087 | Glacier Forefield Soil | GTQLLNRKYFPWKQVLGFFAMFSRRERVVMALRPV* |
| Ga0134112_104907752 | 3300017656 | Grasslands Soil | VTGEEDARGVRLLNNKYFPWKQLLDFFAKFRNRQHTVFVLRPA |
| Ga0187801_100092233 | 3300017933 | Freshwater Sediment | LSGTKAAHGMEMLNKKYVPWKQLLDFFAMFRKRERTVFAIRPA |
| Ga0187817_109859462 | 3300017955 | Freshwater Sediment | ITGELASQAMRLLNKKYFPLKQILGFFALFSRRERVVMAIRPA |
| Ga0187781_102206501 | 3300017972 | Tropical Peatland | AEADHGMQLLNKKYAPWKQLLDFFARFRPRERIVFAIRPA |
| Ga0187777_102930021 | 3300017974 | Tropical Peatland | EEAARGMGLITKKYAPWTYLLNFFAKFRRRERVVMAITPA |
| Ga0187777_104623962 | 3300017974 | Tropical Peatland | GMELLNRKYFPWKQLLGVAAFFSRRERVVMALRPV |
| Ga0187823_101930581 | 3300017993 | Freshwater Sediment | AEIITGETASQAMRLLNKKYFPLKQILGFFALFSRRERVVMAIRPA |
| Ga0066667_107256002 | 3300018433 | Grasslands Soil | VTGEEAARGMQLLNRKYFPWKQLLGFFASFSRRGRTVFVIRPA |
| Ga0066662_112816911 | 3300018468 | Grasslands Soil | QAQIVTGEEDARGVQLLNKKYFPWKQLLDFFAKFRNRQHTAFVLRPA |
| Ga0210407_109221931 | 3300020579 | Soil | RAEIITGAEAEHGMKLLNKKYIPWKQLLDFFSFFSHNKRVVFLIRPA |
| Ga0210407_112254192 | 3300020579 | Soil | DAEHGMQLLNKKYMPWKQLLDFFSIFSRNKRVVFLIRPA |
| Ga0210399_102184823 | 3300020581 | Soil | LGEWAEASVEIVTGDESARAMGLLNKKYFPWKQILGFFALFSRRERIVMAIRPA |
| Ga0210399_109285832 | 3300020581 | Soil | AMGLLNKKYFPWKQILGFFALFSRRERIVMAIRPA |
| Ga0210395_110088831 | 3300020582 | Soil | IVSGEEAARGTQLLNKKYFPWKQLLGFFASFSRRERIVFALHPA |
| Ga0210404_106523551 | 3300021088 | Soil | DAEHGMQLLNKKYMPWKQLLDFFSIFSRNKRIVFLIRPG |
| Ga0210406_101832481 | 3300021168 | Soil | SDAKAEIITGDIASQAMKLLNKKYFPLKQILSFFAFFSRRERVVMAIRPA |
| Ga0210406_102328383 | 3300021168 | Soil | EIVTGAEAEHGMKLLNKKYIPWKQLLDFFSFFSRNKRVMFLIRPA |
| Ga0210400_102024761 | 3300021170 | Soil | RAEILTGDEAARGMQLLNKKYFPLKQILGFFAAFSRRERTVFALLPA |
| Ga0210400_114303521 | 3300021170 | Soil | ADAKGEIVTGEVASQAMRLLNKKYFPLKQILGFFALFSRRERVVMAIRPA |
| Ga0210405_106212731 | 3300021171 | Soil | EWAEASAEILTGDESARAMGLLNKKYFPWKQILGFFALFSRRERIVMAIRPV |
| Ga0210393_103818331 | 3300021401 | Soil | EANAEIVTGETASQAMKLLNKKYFPLKQLLGFFALFSRRERIVMAIRPA |
| Ga0210387_100534221 | 3300021405 | Soil | GMGLLNKKYFPWKQVLGFFALFSRRPRIVIALHPA |
| Ga0210394_108013382 | 3300021420 | Soil | ETASQAMRLLNKKYFPLKQILSFFAFFSRRERVVMAIRPA |
| Ga0210394_112256791 | 3300021420 | Soil | IVTGADASYGTQLLNQKYFPWKQILAFFASFSRRGRTVFVLRPASGN |
| Ga0187846_103090542 | 3300021476 | Biofilm | AHGMALLNKKYVPWKQLLDFFARFRSRERTVFLIQPS |
| Ga0210402_111428871 | 3300021478 | Soil | TEIVMGDEAGYGMKLLNKKYFPWKQLLAFFAWFSRRGRTVMAIRPT |
| Ga0210402_113585562 | 3300021478 | Soil | GMRLLNGKYVPWKQLLDFFSKFKRRGRVVFAIHPV |
| Ga0210410_101547423 | 3300021479 | Soil | RGMRLLNKKYFPLKQILGFFALFSRRARVVIAIRPA |
| Ga0210410_110577142 | 3300021479 | Soil | GMRLLNGKYVPWKQLLDFFSKFKRRGRVVFAIRPV |
| Ga0210410_117961362 | 3300021479 | Soil | GNVLGEWVDAHAEMVTGTEAAHGMKLLNKKYFPLKQILGFFASFSHRERIVFAIRPA |
| Ga0213853_107296902 | 3300021861 | Watersheds | EEAEHGTKLLNKKYFPWKQILAFFASFSRRGRTVMAIRPT |
| Ga0242660_11847051 | 3300022531 | Soil | EEAARGMRLLNKKYFPWRQMLDFFAMFRRRERTVFAIRPA |
| Ga0247666_10978281 | 3300024323 | Soil | ATTVSGEEAARGMKLLNKKYFPWRQILGFFSMFSRSKRVVFVIRPA |
| Ga0137417_14832513 | 3300024330 | Vadose Zone Soil | TSEEAARGMRLLNKKYFPWKQMLNFFAMFRRRERTVFAIRPV |
| Ga0209839_100353581 | 3300026294 | Soil | QGVRLLNKKYFPWKQILAFFALFSRQPRIVIALTPA |
| Ga0209839_102717762 | 3300026294 | Soil | KAEVVSGEEATQGLRLLDKKYFPWKQIMNFFAMFRRQGRDVLSIRLP |
| Ga0209153_11102931 | 3300026312 | Soil | QHGMQLLNKKYVPWKQLLDFFAMFRKHERVVFLIRPA |
| Ga0209802_13023271 | 3300026328 | Soil | GMKLLNKKYAPWKQLLDFFAKFRKRERTVFVIQPV |
| Ga0209473_10764422 | 3300026330 | Soil | SGTEAAHGMQLLNKKYLPWKQLLDFFAMFRKRERTVFVIRPA |
| Ga0257157_10310813 | 3300026496 | Soil | LTGEEAARGMRLLNKKYFPWKQMLDFFAMFRRRERTVFAIRPA |
| Ga0209806_11856692 | 3300026529 | Soil | GEEDARGVQLLNKKYFPWKQLLDFFAKFRNRQHTVFVLRSA |
| Ga0209376_12084982 | 3300026540 | Soil | EAHHGMQLLNKKYFPWKQLLDFFAMFRKRGRTVFMIRPAL |
| Ga0209648_104264031 | 3300026551 | Grasslands Soil | EAEHGMQLLNKKYVPWKQLLDFFARFRKRERTVFAIRPA |
| Ga0208365_10253171 | 3300027070 | Forest Soil | QAEIVTGEEAARGMRLLNKRYFPLKQLLGFFALFSRRPRIVIALHPA |
| Ga0208092_1081341 | 3300027074 | Forest Soil | DADRGMQLLNRKYVPWKQLLDFFARFRPRARTVFFIHPA |
| Ga0209588_10864171 | 3300027671 | Vadose Zone Soil | EIVTGAEAEKGMQLLNKKYVPWKQMLDFFASFRRRERIVFAIRPA |
| Ga0209446_10319971 | 3300027698 | Bog Forest Soil | EFVEARAEILSGDVAAHGMQLLNRKYFPWKQILGFFALFSRRERLVMALRPASLS |
| Ga0209177_102620533 | 3300027775 | Agricultural Soil | ILSGTEAEHGMQLLNKKYLPWKQLLDFFAMFRKRERTVFVIRPA |
| Ga0209180_104325971 | 3300027846 | Vadose Zone Soil | GMGLLNKKYIPWKQLLDFFSSFSRHTRVVFAIRPA |
| Ga0209166_104824681 | 3300027857 | Surface Soil | EAQLGLRLLNRKYFPWKQLLNFFALFSRQARIVFAIRPA |
| Ga0209701_105815422 | 3300027862 | Vadose Zone Soil | SGQEADHGMKLLNKKYFPWKQLLGFFASFSRRERIVFVLRPA |
| Ga0209624_102368201 | 3300027895 | Forest Soil | TKEEAVRGMRLLNKRYFPLKQILGFFALFSRQPRLVIALRPG |
| Ga0265354_10275241 | 3300028016 | Rhizosphere | AEIVTGEVASQGLKLLNKKYFPLKQILGFFALFSRRERVVMSIRPAQ |
| Ga0265349_10003166 | 3300028037 | Soil | EFVDAKAEIVTGEVASQGLKLLNKKYFPLKQILGFFALFSRRERIVMSIRPA |
| Ga0209526_108227501 | 3300028047 | Forest Soil | GMRLLNKKYFPWKQLLGFFALFSRRERIVIALHRA |
| Ga0137415_106906264 | 3300028536 | Vadose Zone Soil | GMKLLNKKYLPWKQLLDFFSFFSRNKRVVFLIRPA |
| Ga0308309_119151501 | 3300028906 | Soil | RAMKLLNKKYFPLKQILGFFALFSRRERIVMAIRPA |
| Ga0265750_10535572 | 3300030813 | Soil | EIVTGEVASQGLKLLNKKYFPLKQILGFFALFSRRERVVMSIRPAQ |
| Ga0265770_10113662 | 3300030878 | Soil | LGEFVDAKAEIVTGEVASQGLKLLNKKYFPLKQILGFFALFSRRERIVMSIRPA |
| Ga0265765_10005491 | 3300030879 | Soil | DAKAEIVTGEVASQGLKLLNKKYFPLKQILGFFALFSRRERIVMSIRPA |
| Ga0310686_1180023752 | 3300031708 | Soil | VDAKAEIVTGEVASQGLKLLNKKYFPLKQILGFFALFSRRERIVMSIRPA |
| Ga0307476_114016101 | 3300031715 | Hardwood Forest Soil | QAMKLLNKKYFPLKQILSFFALFSRRERIVMAIRPA |
| Ga0307475_103827451 | 3300031754 | Hardwood Forest Soil | WAPARAEILTGSEAKHGMQLLNKKYFPWKELLDFFAMFGKRQGTVFMLRPGQGM |
| Ga0307475_106600181 | 3300031754 | Hardwood Forest Soil | EAEHGMTLLNKKYFPWKQLLAFFSLFSRAKRVVFLIRPA |
| Ga0307475_111041611 | 3300031754 | Hardwood Forest Soil | RAEIVTGEEDACGTQLLKKKYFPWKQLLDFFAKFRNRDHTVFVLRPA |
| Ga0307475_113724171 | 3300031754 | Hardwood Forest Soil | GAEAEHGMKLLNKKYMPWKQLLDFFSFFSRNKRVVFLIRPE |
| Ga0307473_104597751 | 3300031820 | Hardwood Forest Soil | RAEIVTGGEAEHGMKLLNKKYVPWKQMLDFFASFRRRERIVFAMRPA |
| Ga0307478_115729862 | 3300031823 | Hardwood Forest Soil | VTGAEAEHGMTLLNKKYFPWKQLLAFFSLFSRAKRVVFLIRPA |
| Ga0307479_113006222 | 3300031962 | Hardwood Forest Soil | HGMTLLNKKYMPWKQLLDFFSIFSRNKRIVFLIRPG |
| Ga0308176_107122343 | 3300031996 | Soil | RIVTGEEAARGMRLLDRKYFPWKQMLRAFALFGRRRERVAIAIRPG |
| Ga0307472_1010195191 | 3300032205 | Hardwood Forest Soil | SDTEAAHGMQLLNKKYLPWKQLLDFFAMFRKRERTVFVIRPS |
| Ga0335081_126402942 | 3300032892 | Soil | AARGMRLLNAKYAPWKQLLDFFSRFKPRGRVVFVIHPA |
| Ga0316628_1032933272 | 3300033513 | Soil | VGALGMGLLNKKYFPWKHFLGLFALLSRRERVVMRIRPA |
| ⦗Top⦘ |