


| Basic Information | |
|---|---|
| Family ID | F057209 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 136 |
| Average Sequence Length | 47 residues |
| Representative Sequence | SLTEAIVIGWIPADAIASAQACVQGQIDSMITPPVSPANTALPWSA |
| Number of Associated Samples | 87 |
| Number of Associated Scaffolds | 136 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Viruses |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 91.91 % |
| % of genes from short scaffolds (< 2000 bps) | 81.62 % |
| Associated GOLD sequencing projects | 81 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.47 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Duplodnaviria (41.912 % of family members) |
| NCBI Taxonomy ID | 2731341 |
| Taxonomy | All Organisms → Viruses → Duplodnaviria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (35.294 % of family members) |
| Environment Ontology (ENVO) | Unclassified (65.441 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (66.912 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 32.43% β-sheet: 0.00% Coil/Unstructured: 67.57% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.47 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 136 Family Scaffolds |
|---|---|---|
| PF11351 | GTA_holin_3TM | 3.68 |
| PF07460 | NUMOD3 | 2.21 |
| PF00959 | Phage_lysozyme | 2.21 |
| PF13884 | Peptidase_S74 | 2.21 |
| PF13539 | Peptidase_M15_4 | 0.74 |
| PF07484 | Collar | 0.74 |
| PF13489 | Methyltransf_23 | 0.74 |
| PF05838 | Glyco_hydro_108 | 0.74 |
| PF11651 | P22_CoatProtein | 0.74 |
| COG ID | Name | Functional Category | % Frequency in 136 Family Scaffolds |
|---|---|---|---|
| COG3926 | Lysozyme family protein | General function prediction only [R] | 0.74 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 60.29 % |
| Unclassified | root | N/A | 39.71 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000929|NpDRAFT_10299191 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 516 | Open in IMG/M |
| 3300004793|Ga0007760_11296038 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 707 | Open in IMG/M |
| 3300005584|Ga0049082_10094568 | Not Available | 1049 | Open in IMG/M |
| 3300005584|Ga0049082_10322126 | Not Available | 513 | Open in IMG/M |
| 3300006802|Ga0070749_10097755 | All Organisms → cellular organisms → Bacteria | 1738 | Open in IMG/M |
| 3300006802|Ga0070749_10098240 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium TMED95 | 1732 | Open in IMG/M |
| 3300006802|Ga0070749_10406536 | Not Available | 750 | Open in IMG/M |
| 3300007544|Ga0102861_1057148 | All Organisms → Viruses → Predicted Viral | 1017 | Open in IMG/M |
| 3300007597|Ga0102919_1056686 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1225 | Open in IMG/M |
| 3300007670|Ga0102862_1182988 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 541 | Open in IMG/M |
| 3300007708|Ga0102859_1030655 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1444 | Open in IMG/M |
| 3300009039|Ga0105152_10342705 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 625 | Open in IMG/M |
| 3300009068|Ga0114973_10262568 | Not Available | 928 | Open in IMG/M |
| 3300009068|Ga0114973_10455028 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 666 | Open in IMG/M |
| 3300009154|Ga0114963_10239268 | Not Available | 1034 | Open in IMG/M |
| 3300009155|Ga0114968_10444333 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 702 | Open in IMG/M |
| 3300009158|Ga0114977_10056814 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2415 | Open in IMG/M |
| 3300009161|Ga0114966_10368369 | Not Available | 849 | Open in IMG/M |
| 3300009180|Ga0114979_10420012 | Not Available | 781 | Open in IMG/M |
| 3300009180|Ga0114979_10559090 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 657 | Open in IMG/M |
| 3300009180|Ga0114979_10675943 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 586 | Open in IMG/M |
| 3300009181|Ga0114969_10038933 | All Organisms → cellular organisms → Bacteria | 3239 | Open in IMG/M |
| 3300009181|Ga0114969_10506482 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 675 | Open in IMG/M |
| 3300009181|Ga0114969_10567012 | Not Available | 626 | Open in IMG/M |
| 3300009182|Ga0114959_10203993 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1023 | Open in IMG/M |
| 3300009183|Ga0114974_10274738 | Not Available | 999 | Open in IMG/M |
| 3300009184|Ga0114976_10636428 | Not Available | 539 | Open in IMG/M |
| 3300009185|Ga0114971_10046457 | All Organisms → Viruses → Predicted Viral | 2739 | Open in IMG/M |
| 3300009419|Ga0114982_1257201 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium TMED95 | 544 | Open in IMG/M |
| 3300010158|Ga0114960_10037658 | Not Available | 2959 | Open in IMG/M |
| 3300010158|Ga0114960_10193392 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1066 | Open in IMG/M |
| 3300010885|Ga0133913_12992048 | All Organisms → Viruses → Predicted Viral | 1128 | Open in IMG/M |
| 3300012754|Ga0138278_1023255 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 753 | Open in IMG/M |
| 3300012763|Ga0138289_1131528 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 684 | Open in IMG/M |
| (restricted) 3300013129|Ga0172364_10794494 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 583 | Open in IMG/M |
| (restricted) 3300013133|Ga0172362_10712809 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 673 | Open in IMG/M |
| (restricted) 3300013133|Ga0172362_11004239 | Not Available | 549 | Open in IMG/M |
| 3300013285|Ga0136642_1170985 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Achromobacter → Achromobacter xylosoxidans | 534 | Open in IMG/M |
| 3300013295|Ga0170791_13474826 | Not Available | 1444 | Open in IMG/M |
| 3300013372|Ga0177922_10110009 | Not Available | 545 | Open in IMG/M |
| 3300013372|Ga0177922_10380816 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Achromobacter → Achromobacter xylosoxidans | 1149 | Open in IMG/M |
| 3300015050|Ga0181338_1001977 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3622 | Open in IMG/M |
| 3300015050|Ga0181338_1009315 | Not Available | 1627 | Open in IMG/M |
| 3300015050|Ga0181338_1012523 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Bellamyvirus → unclassified Bellamyvirus → Synechococcus phage SynMITS9220M01 | 1375 | Open in IMG/M |
| 3300015050|Ga0181338_1017833 | All Organisms → cellular organisms → Bacteria | 1122 | Open in IMG/M |
| 3300015050|Ga0181338_1060552 | Not Available | 545 | Open in IMG/M |
| 3300017700|Ga0181339_1017197 | Not Available | 819 | Open in IMG/M |
| 3300017700|Ga0181339_1030335 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 594 | Open in IMG/M |
| 3300017716|Ga0181350_1029796 | Not Available | 1506 | Open in IMG/M |
| 3300017716|Ga0181350_1044866 | All Organisms → cellular organisms → Bacteria | 1188 | Open in IMG/M |
| 3300017716|Ga0181350_1154432 | Not Available | 534 | Open in IMG/M |
| 3300017722|Ga0181347_1039038 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1460 | Open in IMG/M |
| 3300017736|Ga0181365_1020577 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1662 | Open in IMG/M |
| 3300017774|Ga0181358_1105494 | Not Available | 1005 | Open in IMG/M |
| 3300017774|Ga0181358_1187185 | Not Available | 685 | Open in IMG/M |
| 3300017774|Ga0181358_1235252 | Not Available | 582 | Open in IMG/M |
| 3300017777|Ga0181357_1052084 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1596 | Open in IMG/M |
| 3300017777|Ga0181357_1088153 | Not Available | 1184 | Open in IMG/M |
| 3300017778|Ga0181349_1079760 | All Organisms → Viruses → Predicted Viral | 1247 | Open in IMG/M |
| 3300017778|Ga0181349_1095329 | All Organisms → Viruses → Predicted Viral | 1119 | Open in IMG/M |
| 3300017778|Ga0181349_1189333 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 717 | Open in IMG/M |
| 3300017778|Ga0181349_1260280 | Not Available | 575 | Open in IMG/M |
| 3300017778|Ga0181349_1279896 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 546 | Open in IMG/M |
| 3300017780|Ga0181346_1213810 | Not Available | 689 | Open in IMG/M |
| 3300017780|Ga0181346_1227330 | Not Available | 661 | Open in IMG/M |
| 3300017780|Ga0181346_1238690 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 640 | Open in IMG/M |
| 3300017780|Ga0181346_1276533 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 577 | Open in IMG/M |
| 3300017780|Ga0181346_1335036 | Not Available | 505 | Open in IMG/M |
| 3300017784|Ga0181348_1245605 | Not Available | 621 | Open in IMG/M |
| 3300017784|Ga0181348_1253214 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 608 | Open in IMG/M |
| 3300017785|Ga0181355_1289696 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 618 | Open in IMG/M |
| 3300019784|Ga0181359_1018666 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2603 | Open in IMG/M |
| 3300019784|Ga0181359_1176174 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 711 | Open in IMG/M |
| 3300019784|Ga0181359_1233361 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 570 | Open in IMG/M |
| 3300020048|Ga0207193_1878001 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 507 | Open in IMG/M |
| 3300020179|Ga0194134_10010319 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7385 | Open in IMG/M |
| 3300020205|Ga0211731_10493230 | Not Available | 2151 | Open in IMG/M |
| 3300021519|Ga0194048_10006256 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5635 | Open in IMG/M |
| 3300021962|Ga0222713_10296929 | All Organisms → Viruses → Predicted Viral | 1031 | Open in IMG/M |
| 3300021963|Ga0222712_10009207 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 9197 | Open in IMG/M |
| 3300022190|Ga0181354_1044728 | All Organisms → Viruses → Predicted Viral | 1470 | Open in IMG/M |
| 3300022190|Ga0181354_1071354 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1151 | Open in IMG/M |
| 3300022190|Ga0181354_1113593 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 875 | Open in IMG/M |
| 3300022190|Ga0181354_1149324 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 732 | Open in IMG/M |
| 3300022190|Ga0181354_1182273 | Not Available | 637 | Open in IMG/M |
| 3300022190|Ga0181354_1224383 | Not Available | 548 | Open in IMG/M |
| 3300022198|Ga0196905_1089364 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 832 | Open in IMG/M |
| 3300022407|Ga0181351_1022901 | All Organisms → Viruses → Predicted Viral | 2646 | Open in IMG/M |
| 3300022407|Ga0181351_1041482 | All Organisms → Viruses → Predicted Viral | 1941 | Open in IMG/M |
| 3300022407|Ga0181351_1232786 | Not Available | 588 | Open in IMG/M |
| 3300022929|Ga0255752_10270235 | Not Available | 741 | Open in IMG/M |
| 3300025647|Ga0208160_1115973 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 680 | Open in IMG/M |
| 3300025843|Ga0209182_10215004 | Not Available | 539 | Open in IMG/M |
| 3300027586|Ga0208966_1045958 | Not Available | 1253 | Open in IMG/M |
| 3300027746|Ga0209597_1400090 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 501 | Open in IMG/M |
| 3300027754|Ga0209596_1190888 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 880 | Open in IMG/M |
| 3300027754|Ga0209596_1315428 | Not Available | 616 | Open in IMG/M |
| 3300027759|Ga0209296_1307301 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 628 | Open in IMG/M |
| 3300027763|Ga0209088_10209178 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 830 | Open in IMG/M |
| 3300027798|Ga0209353_10355582 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 610 | Open in IMG/M |
| 3300027899|Ga0209668_10662856 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 699 | Open in IMG/M |
| 3300031707|Ga0315291_10164467 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2303 | Open in IMG/M |
| 3300031857|Ga0315909_10851555 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 569 | Open in IMG/M |
| 3300031873|Ga0315297_10946987 | Not Available | 714 | Open in IMG/M |
| 3300031951|Ga0315904_10235617 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1765 | Open in IMG/M |
| 3300031952|Ga0315294_10717936 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 874 | Open in IMG/M |
| 3300031997|Ga0315278_10983736 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 841 | Open in IMG/M |
| 3300031999|Ga0315274_10845925 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 962 | Open in IMG/M |
| 3300031999|Ga0315274_12046208 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 512 | Open in IMG/M |
| 3300032046|Ga0315289_10284559 | Not Available | 1725 | Open in IMG/M |
| 3300032050|Ga0315906_11034422 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium TMED95 | 614 | Open in IMG/M |
| 3300032053|Ga0315284_12452618 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 510 | Open in IMG/M |
| 3300032092|Ga0315905_11205038 | Not Available | 618 | Open in IMG/M |
| 3300032118|Ga0315277_11347212 | Not Available | 622 | Open in IMG/M |
| 3300032118|Ga0315277_11785198 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 512 | Open in IMG/M |
| 3300032173|Ga0315268_12144549 | Not Available | 573 | Open in IMG/M |
| 3300032173|Ga0315268_12385331 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 543 | Open in IMG/M |
| 3300034102|Ga0335029_0210270 | All Organisms → Viruses → Predicted Viral | 1285 | Open in IMG/M |
| 3300034106|Ga0335036_0063984 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2775 | Open in IMG/M |
| 3300034112|Ga0335066_0163860 | Not Available | 1347 | Open in IMG/M |
| 3300034112|Ga0335066_0400158 | Not Available | 750 | Open in IMG/M |
| 3300034118|Ga0335053_0078422 | All Organisms → Viruses → Predicted Viral | 2315 | Open in IMG/M |
| 3300034279|Ga0335052_0121340 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1563 | Open in IMG/M |
| 3300034283|Ga0335007_0320322 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1006 | Open in IMG/M |
| 3300034355|Ga0335039_0491619 | Not Available | 616 | Open in IMG/M |
| 3300034356|Ga0335048_0073186 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2131 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 35.29% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 19.85% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 13.24% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 6.62% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 3.68% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 3.68% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 2.94% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 2.94% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 2.21% |
| Lake Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Lake Sediment | 1.47% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 1.47% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.74% |
| Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 0.74% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.74% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment | 0.74% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.74% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 0.74% |
| Freshwater And Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Freshwater And Marine | 0.74% |
| Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Sand | 0.74% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 0.74% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000929 | Marine plume microbial communities from the Columbia River - 15 PSU | Environmental | Open in IMG/M |
| 3300004461 | Marine viral communities from Newfoundland, Canada BC-2 | Environmental | Open in IMG/M |
| 3300004793 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SN (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005584 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF | Environmental | Open in IMG/M |
| 3300005943 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_4-Nov-14 | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300007544 | Estuarine microbial communities from the Columbia River estuary - metaG 1449B-3 | Environmental | Open in IMG/M |
| 3300007597 | Estuarine microbial communities from the Columbia River estuary - metaG 1563A-02 | Environmental | Open in IMG/M |
| 3300007670 | Estuarine microbial communities from the Columbia River estuary - metaG 1449C-3 | Environmental | Open in IMG/M |
| 3300007708 | Estuarine microbial communities from the Columbia River estuary - metaG 1371B-02 | Environmental | Open in IMG/M |
| 3300009039 | Lake sediment microbial communities from Lake Baikal, Russia to study Microbial Dark Matter (Phase II) - Lake Baikal sediment 0-5 cm | Environmental | Open in IMG/M |
| 3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009154 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG | Environmental | Open in IMG/M |
| 3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
| 3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
| 3300009161 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG | Environmental | Open in IMG/M |
| 3300009180 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG | Environmental | Open in IMG/M |
| 3300009181 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009182 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG | Environmental | Open in IMG/M |
| 3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
| 3300009184 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG | Environmental | Open in IMG/M |
| 3300009185 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140625_MF_MetaG | Environmental | Open in IMG/M |
| 3300009419 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT | Environmental | Open in IMG/M |
| 3300010158 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_MF_MetaG | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300012754 | Freshwater microbial communities from Lake Montjoie, Canada - M_130821_M_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012763 | Freshwater microbial communities from Lake Simoncouche, Canada - S_140108_E_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300013127 (restricted) | Sediment microbial communities from Lake Kivu, Rwanda - Sediment site 48cm | Environmental | Open in IMG/M |
| 3300013129 (restricted) | Sediment microbial communities from Lake Kivu, Rwanda - Sediment site 10cm | Environmental | Open in IMG/M |
| 3300013133 (restricted) | Sediment microbial communities from Lake Kivu, Rwanda - Sediment s1_kivu2a2 | Environmental | Open in IMG/M |
| 3300013285 | Freshwater microbial communities from Lower Cathedral Lake, Yosemite National Park, California, USA - 13028-31Y | Environmental | Open in IMG/M |
| 3300013295 | northern Canada Lakes metatranscriptome co-assembly | Environmental | Open in IMG/M |
| 3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
| 3300015050 | Freshwater viral communities from Lake Michigan, USA - Sp13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017700 | Freshwater viral communities from Lake Michigan, USA - Sp13.VD.MM110.D.D | Environmental | Open in IMG/M |
| 3300017716 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.DCM.D | Environmental | Open in IMG/M |
| 3300017722 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
| 3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020048 | Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915 | Environmental | Open in IMG/M |
| 3300020179 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015056 Kigoma Offshore 0m | Environmental | Open in IMG/M |
| 3300020205 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1 | Environmental | Open in IMG/M |
| 3300021519 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L222-5m | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
| 3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
| 3300022198 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300022929 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG | Environmental | Open in IMG/M |
| 3300025647 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025843 | Lake sediment microbial communities from Lake Baikal, Russia to study Microbial Dark Matter (Phase II) - Lake Baikal sediment 0-5 cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027586 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027746 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140625_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027754 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027763 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027798 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027808 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027899 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes) | Environmental | Open in IMG/M |
| 3300031707 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_20 | Environmental | Open in IMG/M |
| 3300031834 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_0 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300031873 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G15_0 | Environmental | Open in IMG/M |
| 3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
| 3300031952 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_40 | Environmental | Open in IMG/M |
| 3300031997 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0 | Environmental | Open in IMG/M |
| 3300031999 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20 | Environmental | Open in IMG/M |
| 3300032046 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_40 | Environmental | Open in IMG/M |
| 3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
| 3300032053 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16 | Environmental | Open in IMG/M |
| 3300032092 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121 | Environmental | Open in IMG/M |
| 3300032118 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_15 | Environmental | Open in IMG/M |
| 3300032173 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_top | Environmental | Open in IMG/M |
| 3300034102 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112 | Environmental | Open in IMG/M |
| 3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
| 3300034112 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Aug2014-rr0191 | Environmental | Open in IMG/M |
| 3300034118 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Aug2017-rr0165 | Environmental | Open in IMG/M |
| 3300034279 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2014-rr0163 | Environmental | Open in IMG/M |
| 3300034283 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061 | Environmental | Open in IMG/M |
| 3300034355 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Oct2015-rr0135 | Environmental | Open in IMG/M |
| 3300034356 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jun2014-rr0152 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| NpDRAFT_102991913 | 3300000929 | Freshwater And Marine | LTESIVIGWIPESAITSAQQCVQGQIDSMITPPVSPEAQPLPWA* |
| Ga0066223_12921201 | 3300004461 | Marine | TLEQGAAFTPYDQLTQAQVIGWIPESQITSAQQCVQGQIDSLITPPVSPSAQPLPWVTA* |
| Ga0007760_112960381 | 3300004793 | Freshwater Lake | LTEAIVIGWIPESAIASAQQCVQGQIDSMITPPVSPSNTDLPWA* |
| Ga0049082_100945681 | 3300005584 | Freshwater Lentic | IPYADLTEAIVIGWIPEQAMASAQACVQGQIDSMITPPVSPQNTPLPWSA* |
| Ga0049082_103221261 | 3300005584 | Freshwater Lentic | YDQLTQAIVIGWIPENAMASAQACVQGQIDSMITPPVSPQNTPLPWA* |
| Ga0073926_100970813 | 3300005943 | Sand | FDSSQAPETFIPYDQLTQAIVIGWIPENAMASAQACVQGQINSLITPPVSPQNTDLPWN* |
| Ga0070749_100977556 | 3300006802 | Aqueous | VIGWIPPEQIASAQACVQGQINSLISPPVSPQNTPLPWSQA* |
| Ga0070749_100982405 | 3300006802 | Aqueous | PYDQLTQAQVIGWIPADQIASAQACVQGQINSMITPPVSPQNTQLPWGSQA* |
| Ga0070749_104065363 | 3300006802 | Aqueous | ANAMASAQACVQGQIDSMITPPVSPANTPLPWSP* |
| Ga0102861_10571483 | 3300007544 | Estuarine | GAFIPYADLTEEIVIGWIPADVMEGSQQCVQGQINSLITPPVSPAKTALPWSV* |
| Ga0102919_10566864 | 3300007597 | Estuarine | TEAIVIGWIPENAMASAQACVQGQIDSLINPPVSPQNTDLPWN* |
| Ga0102862_11829882 | 3300007670 | Estuarine | AFIPYADLTEAIVIGWIPESQIASAQACVQGQIDSMITPPVSPANTPLPWVTPTP* |
| Ga0102859_10306551 | 3300007708 | Estuarine | PYASLTQAQVIGWIPESAITSAQQCVQGQIDSMITPPVSPANTALPWGQP* |
| Ga0105152_103427051 | 3300009039 | Lake Sediment | PYASLTEATVIGWIPAEAITSAQQCVQGQIDSMITPPFRPEAQPLPWA* |
| Ga0114973_102625681 | 3300009068 | Freshwater Lake | ASLTEALVIGWIPENQIDSAQACVQGQIDSLITPPVSPANTPLPWSA* |
| Ga0114973_104550281 | 3300009068 | Freshwater Lake | TQAEVIGWIPESNIASAQACVQGQINSMITPPVSPTNTPLPWSA* |
| Ga0114963_102392683 | 3300009154 | Freshwater Lake | VTPYDQLTQAIVIGWISEQAIANAQACVQGQIDSMITPPVSPANTALPWA* |
| Ga0114968_104443331 | 3300009155 | Freshwater Lake | EATVIGWIPESQITSAQACVQGQIDSMITPPVSPANTPLPWGA* |
| Ga0114977_100568147 | 3300009158 | Freshwater Lake | LVISWIPENQIDSAQSCVQGQIDSLITPPVSPANTPLPWATV* |
| Ga0114966_101600225 | 3300009161 | Freshwater Lake | QFTSQQGPDFIPYADLTEATVIGWIPESQITSAQACVQGQIDSMITPPVSPANTPLPWGA |
| Ga0114966_103683691 | 3300009161 | Freshwater Lake | NLTEALVISWIPENQIDSAQACVQGQIDSLITPPVSPANTPLPWSA* |
| Ga0114979_104200121 | 3300009180 | Freshwater Lake | TEALVIGWIPENQIDSAQSCVQGQIDSLITPPVSPENTPLPWSA* |
| Ga0114979_105590903 | 3300009180 | Freshwater Lake | WIPESAIESAQACVQGQIDSLINPPVSPENTPLPWSA* |
| Ga0114979_106759431 | 3300009180 | Freshwater Lake | GWIPESAIASAQQCVQGQIDSLITPPVSPSNTDLPWA* |
| Ga0114969_100389338 | 3300009181 | Freshwater Lake | TEAIVIGWIPESAITSAQQCVQGQIDSLITPPVSPSNTALPWSQA* |
| Ga0114969_105064821 | 3300009181 | Freshwater Lake | LVISWIPENQIDSAQACVQGQIDSLITPPVSPAAQPLPW* |
| Ga0114969_105670121 | 3300009181 | Freshwater Lake | IVIGWIPESAITSAQQCVQGQLDSMANPPVSPANTALPWVA* |
| Ga0114959_102039934 | 3300009182 | Freshwater Lake | TEATVIGWIPAEAIASAQACVQGQIDSMITPPVSPSNTPLPWVA* |
| Ga0114974_102747384 | 3300009183 | Freshwater Lake | ADQEGAVIPYDQLTEAIVIGWIPAQDISNAQACVQGQINSLITPPVSPANTALPWSA* |
| Ga0114976_106364282 | 3300009184 | Freshwater Lake | IGWIPESAITSAQQCVQGQIDSMITPPVSPEAQPLPWA* |
| Ga0114971_100464571 | 3300009185 | Freshwater Lake | IPYADLTEATVIGWIPEQAMASAQACVQGQIDSMITPPVSPQNTPLPWSA* |
| Ga0114982_12572011 | 3300009419 | Deep Subsurface | TVIGWIPAEATASAQACVQGQIDSMITPPVSPENTPLPWAPAA* |
| Ga0114960_100376581 | 3300010158 | Freshwater Lake | QAPETFIPYDQLTQAIVIGWIPEQAIASAQACVQGQIDSMITPPVSPANTALPWA* |
| Ga0114960_101933921 | 3300010158 | Freshwater Lake | EATVIGWIPEQAIASAQACVQGQIDSMITPPVSPANTALPWASA* |
| Ga0133913_129920481 | 3300010885 | Freshwater Lake | AITPYASLTEAIVIGWIPESAIASAQACVQGQIDSMITPPVSPSNTALPWSTA* |
| Ga0138278_10232554 | 3300012754 | Freshwater Lake | LTQAQVIGWIPESAITSAQQSVQGQIDSLITPPVSPSNTALPWSQA* |
| Ga0138289_11315281 | 3300012763 | Freshwater Lake | ESAIESAQACVQGQIDSLITPPVSPANTALPWAA* |
| (restricted) Ga0172365_101235191 | 3300013127 | Sediment | NTQFTVQEGTFIPYDQLTPQIVTGWIPPEQIASAQACVQGQIDSMITPPISPANTPLPWAA* |
| (restricted) Ga0172364_107944943 | 3300013129 | Sediment | QIVTGWIPPEQIASAQACVQGQLDSMANPPVSPQNTPLPWSQS* |
| (restricted) Ga0172362_107128091 | 3300013133 | Sediment | EGTFIPYDQLTPQIVTGWIPPEQIASAQACVQGQIDSMITPPISPANTPLPWAA* |
| (restricted) Ga0172362_110042391 | 3300013133 | Sediment | QEGTFTPYDQLTPQIVLGWIPQNQIASAQACVQGQIDSMISPPVSPQNTPLPWSQNAA* |
| Ga0136642_11709851 | 3300013285 | Freshwater | IPESQITSAQSCVQGQIDSMITPPVSPTSQALPW* |
| Ga0170791_134748261 | 3300013295 | Freshwater | PYASLTQAQVIGWIPESAITSAQQSVQGQIDSLITPPVSPSNTALPWSQA* |
| Ga0177922_101100092 | 3300013372 | Freshwater | WIPENAMASAQACVQGQIDSMITPPVSPQNTPLPWSA* |
| Ga0177922_103808164 | 3300013372 | Freshwater | IGWIPESAITSAQQCVQGQLDSMANPPVSPANTALPWSA* |
| Ga0181338_10019774 | 3300015050 | Freshwater Lake | ETFIPYDQLTQAIVIGWIPENAMASAQACVQGQIDSMITPPVSPQNTPLPWA* |
| Ga0181338_10093154 | 3300015050 | Freshwater Lake | IPYADLTEAIVIGWIPEQAMASAQACVQGQIDSIITPPVSPQNTPLPWSA* |
| Ga0181338_10125231 | 3300015050 | Freshwater Lake | IVIGWIPEQAMASAQACVQGQIDSMITPPVSPQNTPLPWSA* |
| Ga0181338_10178331 | 3300015050 | Freshwater Lake | ADLTEAIVIGWIPEQATASAQACVQGQIDSMITPPVSPQNTPLPWSA* |
| Ga0181338_10605521 | 3300015050 | Freshwater Lake | QVGAFIPYSSLTEATVIGWIPENQITSAQQCVQGQIDSMITPPVSPANTALPWATP* |
| Ga0181339_10171973 | 3300017700 | Freshwater Lake | ASLTQAQVIGWIPESAITSAQACVQGQIDSMITPPVSPANTALPWGQPWT |
| Ga0181339_10303352 | 3300017700 | Freshwater Lake | IPESAITSAQQCVQGQIDSMITPPVSPENTPLPWAA |
| Ga0181350_10297961 | 3300017716 | Freshwater Lake | FIPYADLTEAIVIGWIPEQAMASAQACVQGQIDSMITPPVSPQNTPLPWSA |
| Ga0181350_10448661 | 3300017716 | Freshwater Lake | ETFIPYADLTEAIVIGWIPEQATASAQACVQGQIDSMITPPVSPQNTPLPWSA |
| Ga0181350_11544323 | 3300017716 | Freshwater Lake | IPENQIDSAQSCVQGQIDSLITPPVSPANTPLPWTTA |
| Ga0181347_10390381 | 3300017722 | Freshwater Lake | AQVIAWIPESAITSAQQCVQGQIDSMITPPVSPANTELPW |
| Ga0181365_10205771 | 3300017736 | Freshwater Lake | VIGWIPASDIESSQACVQGQINSLITPPALPADTALPWSN |
| Ga0181358_11054941 | 3300017774 | Freshwater Lake | EAIVIGWIPEQATASAQACVQGQIDSMITPPVSPQNTPLPWSA |
| Ga0181358_11871852 | 3300017774 | Freshwater Lake | PYADLTEAIVIGWIPEQAMASAQACVQGQIDSMITPPVSPQNTPLPWSA |
| Ga0181358_12352521 | 3300017774 | Freshwater Lake | PVTPYASLTQAQVIGWIPESAITSAQACVQGQIDSMITPPVSPANTALPWSQA |
| Ga0181357_10520847 | 3300017777 | Freshwater Lake | PVTPYASLTQAQVIAWIPESAITSAQQCVQGQIDSMITPPVSPANTELPW |
| Ga0181357_10881531 | 3300017777 | Freshwater Lake | IPYDQLTEAMIISWIPASDIESSQQCVQGQINSLITPPVSPENTPLPWSQA |
| Ga0181357_11585474 | 3300017777 | Freshwater Lake | DSSQAPETFIPYDQLTQAIVIGWIPEDVMANAQACVQKMINSMITPPVSPANTPLPWATPAV |
| Ga0181349_10797601 | 3300017778 | Freshwater Lake | PYASLTEAVVLSWIPESAITSAQQCVQGQIDSMITPPVSPANTALPWSA |
| Ga0181349_10953291 | 3300017778 | Freshwater Lake | IPYSSLTESVVIGWIPADAIASAQACVQGQIDSMITPPVSPSNTDLPWA |
| Ga0181349_11893332 | 3300017778 | Freshwater Lake | DQLTEAIVIGWIPAEAMASAQACVQGQIDSLITPPVSPQNTPLPWSA |
| Ga0181349_12602801 | 3300017778 | Freshwater Lake | SLTEAIVIGWIPADAIASAQACVQGQIDSMITPPVSPANTALPWSA |
| Ga0181349_12798963 | 3300017778 | Freshwater Lake | GWIPASDIESSQACVQGQINSLITPPALPADTALPWSQA |
| Ga0181346_10234667 | 3300017780 | Freshwater Lake | DQEGAFVPYADLTESVVIGWIPLQDISNAQSCVQGQIDTMITPPVSPANTPLPWSP |
| Ga0181346_12138103 | 3300017780 | Freshwater Lake | FIPYASLTESVVIGWIPESAITSAQQCVQGQIDSMITPPVSPANTALPW |
| Ga0181346_12273301 | 3300017780 | Freshwater Lake | ASLTQAQVIGWIPESAITSAQQCVQGQLDSLANPPVSPANTELPWSNYA |
| Ga0181346_12386904 | 3300017780 | Freshwater Lake | DQLTEAVVIGWIPESDIDSAQACVQGQINSMITPPISPEKTPLPWG |
| Ga0181346_12765331 | 3300017780 | Freshwater Lake | EIVIGWIPADVMEGSQRCVQGQIDSKITPPVSPANTALPW |
| Ga0181346_13350361 | 3300017780 | Freshwater Lake | ASLTEATVIGWIPESAITSAQQCVQGQIDSMINPPVSPANTALPWAP |
| Ga0181348_12456051 | 3300017784 | Freshwater Lake | GWIPESAITSAQQCVQGQIDSMITPPVSPANTALPWTAA |
| Ga0181348_12532141 | 3300017784 | Freshwater Lake | DQLTEAMIISWIPASDIESSQQCVQGQINSLITPPALPADTALPWSN |
| Ga0181355_12896962 | 3300017785 | Freshwater Lake | IPYADLTEAIVIGWIPEQATASAQACVQGQIDSIITPPVSPQNTPLPWSA |
| Ga0181359_10186661 | 3300019784 | Freshwater Lake | TQAIVIGWIPENAMASAQACVQGQIDSMITPPVSPQNTPLPWA |
| Ga0181359_11761743 | 3300019784 | Freshwater Lake | GQGPVIPYDQLTEDIVISWIPAQDIASSQTIVQGQINSQINPPVTPQNTPLPWA |
| Ga0181359_12333613 | 3300019784 | Freshwater Lake | PYDQLTEAVVIGWIPASDIESSQACVQGQINSLITPPALPADTALPWSQA |
| Ga0207193_18780013 | 3300020048 | Freshwater Lake Sediment | QVIGWIPANQIESAQACVQGQLDSLANPPVSPENTPLPWSAAA |
| Ga0194134_100103191 | 3300020179 | Freshwater Lake | LTPQIVTGWIPANQIASAQACVQGQIDSMITPPVSPQNTPLPWSQNAA |
| Ga0211731_104932301 | 3300020205 | Freshwater | IGWIPESAITSAQQCVQGQIDSLITPPVSPANTALPWATP |
| Ga0194048_100062569 | 3300021519 | Anoxic Zone Freshwater | TDQTTFIPYADLTEALVISWIPENQIDSAQSCVQGQIDSLITPPVSPQKTPLPWTTA |
| Ga0222713_102969291 | 3300021962 | Estuarine Water | IVIGWIPENQIASAQACVQGQIDSMITPPVSPANTALPWSAA |
| Ga0222712_1000920712 | 3300021963 | Estuarine Water | YDQLTAEIVLGWIPQTQIDSAQACVQGQLESLANPPVSPQNTPLPWNQS |
| Ga0181354_10447286 | 3300022190 | Freshwater Lake | TEATVIGWIPESQITSAQQCVQGQIDSMITPPVSPEAQPLPWV |
| Ga0181354_10713541 | 3300022190 | Freshwater Lake | AEFIPYDELTEAIVIGWIPASDIESSQQCVQGQINSLITPPALPADTALPWSQA |
| Ga0181354_11135931 | 3300022190 | Freshwater Lake | NSADQEGAVIPYSSLTESIVIGWIPANAMASAQACVQGQINSLITPPVSPQNTPLPWN |
| Ga0181354_11493241 | 3300022190 | Freshwater Lake | TEEIVIGWIPADVMEGSQRCVQGQIDSKITPPVSPANTALPW |
| Ga0181354_11822732 | 3300022190 | Freshwater Lake | DHQQGAVVPYADLTEAIVIGWISADAIASAQTNVQGQIDSMITPPVSPQNTPLPWSA |
| Ga0181354_12243834 | 3300022190 | Freshwater Lake | SVVIGWIPTQDISNAQACVQGQIDSMITPPVSPANTPLPWSP |
| Ga0196905_10893644 | 3300022198 | Aqueous | IVLGWIPANQIDSAQACVQGQIDSMITPPVSPENTPLPWAA |
| Ga0181351_10229017 | 3300022407 | Freshwater Lake | QEGAFVPYDQLTEAIVIGWIPASQIGSAQACVQGQIDSMITPPVSPELTPLPWA |
| Ga0181351_10414825 | 3300022407 | Freshwater Lake | VIGWIPADAIASAQACVQGQIDSMITPPVSPSNTDLPWA |
| Ga0181351_11409101 | 3300022407 | Freshwater Lake | GSADQEGAIVPYADLTEAIVIGWIPESAIASAQACVQGQIDSMIRPPVSPANTALPWSAA |
| Ga0181351_12327863 | 3300022407 | Freshwater Lake | DQLTPEIVVGWISPQDMLNAQECVQGQLNSMITPPVTPQNTPLPW |
| Ga0255752_102702351 | 3300022929 | Salt Marsh | WIPQTQIDSAQACVQGQLESLANPPVSPQNTPLPWNQS |
| Ga0208160_11159731 | 3300025647 | Aqueous | VLGWIPANQIDSAQACVQGQIDSMITPPVSPENTPLPWAA |
| Ga0209182_102150043 | 3300025843 | Lake Sediment | IPYDQLTEAIVIGWIPESAITSAQQCVQGQIDSMITPPVSPEAQPLPWA |
| Ga0208966_10459581 | 3300027586 | Freshwater Lentic | WIPENAMASAQACVQGQIDSMITPPVSPQNTPLPWSA |
| Ga0209597_14000901 | 3300027746 | Freshwater Lake | IPYADLTEATVIGWIPEQAMASAQACVQGQIDSMITPPVSPQNTPLPWSA |
| Ga0209596_11908884 | 3300027754 | Freshwater Lake | PYANLTEALVISWIPENQIDSAQACVQGQIDSLITPPVSPQNTPLPWVTPLA |
| Ga0209596_13154281 | 3300027754 | Freshwater Lake | IVIGWIPESAITSAQQCVQGQLDSMANPPVSPANTALPWVA |
| Ga0209296_13073011 | 3300027759 | Freshwater Lake | IPENQIDSAQACVQGQIDSLITPPVSPANTPLPWSA |
| Ga0209088_102091781 | 3300027763 | Freshwater Lake | IPESQITSAQQCVQGQIDSQITPPVSPANTPLPWVAPVTQ |
| Ga0209353_103555821 | 3300027798 | Freshwater Lake | GWIPASDIESSQACVQGQINSLITPPALPADTALPWSN |
| Ga0209354_102714451 | 3300027808 | Freshwater Lake | TFDSNQAETFIPYADLTEAIVIGWIPEQAMASAQACVQGQIDSMITPPVSPQNTPLPWSA |
| Ga0209668_106628565 | 3300027899 | Freshwater Lake Sediment | TEAIVIGWIPESAIASAQACVQGQIDSMITPPVSPANTALPWGQA |
| Ga0315291_101644678 | 3300031707 | Sediment | IGWIPESAITSAQQCVQGQIDSMITPPVSPANTALPWSNHA |
| Ga0315290_113306331 | 3300031834 | Sediment | ADQEGAIVPYASLTESVVIGWIPESAITSAQQCVQGQIDSMITPPVSPASQPLPWSAA |
| Ga0315909_108515551 | 3300031857 | Freshwater | IPQNQIDSAQACVQGQIDSLISPPVSPQNTPLPWAA |
| Ga0315297_109469874 | 3300031873 | Sediment | ISWIPENQIDSAQSCVQGQIDSLITPPVSPHNTPLPWTTA |
| Ga0315904_102356171 | 3300031951 | Freshwater | SLTEATVIGWIPAEAIASAQACVQGQIDSMITPPVSPEAQPLPWAP |
| Ga0315294_107179361 | 3300031952 | Sediment | IGWIPESAITSAQQCVQGQIDSMITPPVSPANTALPW |
| Ga0315278_109837361 | 3300031997 | Sediment | TPYASLTQAQVIGWIPESAITSAQQCVQGQIDSMITPPVSPANTALPW |
| Ga0315274_108459251 | 3300031999 | Sediment | VLSWIPESAITSAQACVQGQIDSMITPPVSPAAQPLPWSAA |
| Ga0315274_118333351 | 3300031999 | Sediment | QFDSTDQTTFVPYASLTEALVISWIPENQIDSAQSCVQGQIDSLITPPVSPQNTPLPWTT |
| Ga0315274_120462083 | 3300031999 | Sediment | DSTDQTTFVPYASLTEALVISWIPENQIDSAQSCVQGQIDSLITPPVSPANTPLPWSA |
| Ga0315289_102845595 | 3300032046 | Sediment | QVIGWIPEPAITSAQQCVQGQIDSMITPPVSPQNTPLPW |
| Ga0315906_110344221 | 3300032050 | Freshwater | MQEGTFIPYDQLTQATVIGWIPADQIASAQANVQGQIDSMITPPVSPQNTPLPWATA |
| Ga0315284_124526182 | 3300032053 | Sediment | NLTEEIVIGWIPADIMEGSQRCVQGQIDSMITPPVSPAKTALPWSA |
| Ga0315905_112050383 | 3300032092 | Freshwater | YASLTEATVIGWIPESAITSSQATVQGQIDSMITPPVSPANTALPWSA |
| Ga0315277_113472121 | 3300032118 | Sediment | AFIPYASLTEAVVLSWIPESAITSAQQCVQGQIDSMITPPVSPASQPLPWSAA |
| Ga0315277_117851981 | 3300032118 | Sediment | TTFVPYASLTEALVIGWIPENQIDSAQSCVQGQIDSLITPPVSPANTPLPWSA |
| Ga0315268_121445491 | 3300032173 | Sediment | VIGWIPESAITSAQACVQVQIDSMITPPVSPANTPLPWSA |
| Ga0315268_123853313 | 3300032173 | Sediment | SLTEAIVIGWIPESAITSAQQCVQGQIDSMITPPVSPAAQLLPWAAA |
| Ga0335029_0210270_1153_1284 | 3300034102 | Freshwater | EATVIGWIPADAITSAQACVQGQIDSMITPPVSPANTPLPWTP |
| Ga0335036_0063984_2665_2775 | 3300034106 | Freshwater | IPEQAMASAQACVQGQIDSMITPPVSPQNTPLPWSA |
| Ga0335066_0163860_3_125 | 3300034112 | Freshwater | IGWIPESAIASAQACVQGQIDSMITPPVSPANTALPWGQA |
| Ga0335066_0400158_583_750 | 3300034112 | Freshwater | QEGAFIPYDQLTQAQVIGWIPANQIDSAQACVQGQINSMITPPVSPQNTPLPWAA |
| Ga0335053_0078422_2183_2314 | 3300034118 | Freshwater | EATVLGWIPANQIDSAQACVQGQINSMITPPVSPQNTPLPWAA |
| Ga0335052_0121340_1404_1562 | 3300034279 | Freshwater | VIPYADLTESVVLSWIPESAIASAQACVQGQIDSMITPPVSPANTALPWSQA |
| Ga0335007_0320322_880_1005 | 3300034283 | Freshwater | IGWIPESAITSAQQCVQGQLDSLANPPVSPANTALPWAPAA |
| Ga0335039_0491619_3_158 | 3300034355 | Freshwater | FTPYTQLTQEQVIGWIPANQIENAQACVQGQINSMITPPVSPQNTPLPWAA |
| Ga0335048_0073186_3_149 | 3300034356 | Freshwater | YDQLTQAQVIGWIPESVIENMQACVQGQIDSMITPPVSPENTPLPWSA |
| ⦗Top⦘ |