


| Basic Information | |
|---|---|
| Family ID | F056924 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 137 |
| Average Sequence Length | 47 residues |
| Representative Sequence | MKTKLALKVVGLIGVLALISAGYCFWLMTVPLSYDWVPVVLIGF |
| Number of Associated Samples | 114 |
| Number of Associated Scaffolds | 137 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 23.08 % |
| % of genes near scaffold ends (potentially truncated) | 77.37 % |
| % of genes from short scaffolds (< 2000 bps) | 78.10 % |
| Associated GOLD sequencing projects | 105 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.47 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (83.212 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (12.409 % of family members) |
| Environment Ontology (ENVO) | Unclassified (29.927 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (40.876 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 45.83% β-sheet: 0.00% Coil/Unstructured: 54.17% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.47 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 137 Family Scaffolds |
|---|---|---|
| PF03795 | YCII | 26.28 |
| PF06172 | Cupin_5 | 4.38 |
| PF01042 | Ribonuc_L-PSP | 3.65 |
| PF12680 | SnoaL_2 | 2.19 |
| PF13505 | OMP_b-brl | 2.19 |
| PF13924 | Lipocalin_5 | 2.19 |
| PF00561 | Abhydrolase_1 | 2.19 |
| PF02371 | Transposase_20 | 1.46 |
| PF07690 | MFS_1 | 1.46 |
| PF14437 | MafB19-deam | 0.73 |
| PF08332 | CaMKII_AD | 0.73 |
| PF00903 | Glyoxalase | 0.73 |
| PF00375 | SDF | 0.73 |
| PF03544 | TonB_C | 0.73 |
| PF07075 | DUF1343 | 0.73 |
| PF01715 | IPPT | 0.73 |
| PF02223 | Thymidylate_kin | 0.73 |
| PF13673 | Acetyltransf_10 | 0.73 |
| PF14499 | DUF4437 | 0.73 |
| PF07676 | PD40 | 0.73 |
| PF14534 | DUF4440 | 0.73 |
| PF12681 | Glyoxalase_2 | 0.73 |
| PF12697 | Abhydrolase_6 | 0.73 |
| PF01266 | DAO | 0.73 |
| PF10042 | DUF2278 | 0.73 |
| PF13537 | GATase_7 | 0.73 |
| PF01370 | Epimerase | 0.73 |
| PF08282 | Hydrolase_3 | 0.73 |
| COG ID | Name | Functional Category | % Frequency in 137 Family Scaffolds |
|---|---|---|---|
| COG2350 | YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHis | Secondary metabolites biosynthesis, transport and catabolism [Q] | 26.28 |
| COG3542 | Predicted sugar epimerase, cupin superfamily | General function prediction only [R] | 4.38 |
| COG0251 | Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 family | Defense mechanisms [V] | 3.65 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 1.46 |
| COG0125 | Thymidylate kinase | Nucleotide transport and metabolism [F] | 0.73 |
| COG0324 | tRNA A37 N6-isopentenylltransferase MiaA | Translation, ribosomal structure and biogenesis [J] | 0.73 |
| COG0560 | Phosphoserine phosphatase | Amino acid transport and metabolism [E] | 0.73 |
| COG0561 | Hydroxymethylpyrimidine pyrophosphatase and other HAD family phosphatases | Coenzyme transport and metabolism [H] | 0.73 |
| COG0810 | Periplasmic protein TonB, links inner and outer membranes | Cell wall/membrane/envelope biogenesis [M] | 0.73 |
| COG1877 | Trehalose-6-phosphate phosphatase | Carbohydrate transport and metabolism [G] | 0.73 |
| COG2217 | Cation-transporting P-type ATPase | Inorganic ion transport and metabolism [P] | 0.73 |
| COG3769 | Mannosyl-3-phosphoglycerate phosphatase YedP/MpgP, HAD superfamily | Carbohydrate transport and metabolism [G] | 0.73 |
| COG3876 | Exo-beta-N-acetylmuramidase YbbC/NamZ, DUF1343 family | Cell wall/membrane/envelope biogenesis [M] | 0.73 |
| COG4875 | Protein kinase association domain CaMKII_AD, NTF2-like superfamily | Posttranslational modification, protein turnover, chaperones [O] | 0.73 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 83.21 % |
| Unclassified | root | N/A | 16.79 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2088090014|GPIPI_17363375 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1194 | Open in IMG/M |
| 2170459010|GIO7OMY01AMAT6 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 533 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_101706274 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1131 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_101706702 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 628 | Open in IMG/M |
| 3300000890|JGI11643J12802_12363380 | All Organisms → cellular organisms → Bacteria | 1780 | Open in IMG/M |
| 3300000955|JGI1027J12803_107850763 | All Organisms → cellular organisms → Bacteria | 941 | Open in IMG/M |
| 3300004114|Ga0062593_100458423 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1165 | Open in IMG/M |
| 3300004480|Ga0062592_101032735 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 754 | Open in IMG/M |
| 3300004480|Ga0062592_101909746 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 584 | Open in IMG/M |
| 3300005184|Ga0066671_10922108 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 553 | Open in IMG/M |
| 3300005187|Ga0066675_11034592 | All Organisms → cellular organisms → Bacteria | 616 | Open in IMG/M |
| 3300005328|Ga0070676_10185290 | Not Available | 1356 | Open in IMG/M |
| 3300005340|Ga0070689_100568555 | All Organisms → cellular organisms → Bacteria | 979 | Open in IMG/M |
| 3300005356|Ga0070674_102079401 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300005365|Ga0070688_100708790 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 780 | Open in IMG/M |
| 3300005435|Ga0070714_100616835 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1042 | Open in IMG/M |
| 3300005435|Ga0070714_100675383 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 995 | Open in IMG/M |
| 3300005441|Ga0070700_101421265 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 587 | Open in IMG/M |
| 3300005446|Ga0066686_10957033 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
| 3300005456|Ga0070678_100842676 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 835 | Open in IMG/M |
| 3300005466|Ga0070685_11566463 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 509 | Open in IMG/M |
| 3300005764|Ga0066903_102939043 | All Organisms → cellular organisms → Bacteria | 924 | Open in IMG/M |
| 3300005764|Ga0066903_102977937 | All Organisms → cellular organisms → Bacteria | 918 | Open in IMG/M |
| 3300005764|Ga0066903_104828369 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → Chthoniobacter flavus → Chthoniobacter flavus Ellin428 | 716 | Open in IMG/M |
| 3300005937|Ga0081455_10109345 | All Organisms → cellular organisms → Bacteria | 2200 | Open in IMG/M |
| 3300005937|Ga0081455_10217934 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1417 | Open in IMG/M |
| 3300005937|Ga0081455_10443791 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 888 | Open in IMG/M |
| 3300005983|Ga0081540_1118528 | All Organisms → cellular organisms → Bacteria | 1103 | Open in IMG/M |
| 3300006046|Ga0066652_100394076 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1260 | Open in IMG/M |
| 3300006163|Ga0070715_10880346 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 550 | Open in IMG/M |
| 3300006173|Ga0070716_100227501 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1257 | Open in IMG/M |
| 3300006175|Ga0070712_100479757 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Collimonas | 1039 | Open in IMG/M |
| 3300006904|Ga0075424_100216891 | All Organisms → cellular organisms → Bacteria | 2033 | Open in IMG/M |
| 3300009090|Ga0099827_10360484 | All Organisms → cellular organisms → Bacteria | 1238 | Open in IMG/M |
| 3300009174|Ga0105241_11073456 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 757 | Open in IMG/M |
| 3300010329|Ga0134111_10312131 | All Organisms → cellular organisms → Bacteria | 657 | Open in IMG/M |
| 3300010335|Ga0134063_10574240 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 571 | Open in IMG/M |
| 3300010359|Ga0126376_10124899 | All Organisms → cellular organisms → Bacteria | 2015 | Open in IMG/M |
| 3300010359|Ga0126376_10999207 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 836 | Open in IMG/M |
| 3300010360|Ga0126372_10166116 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1789 | Open in IMG/M |
| 3300010361|Ga0126378_12202964 | All Organisms → cellular organisms → Bacteria | 629 | Open in IMG/M |
| 3300010366|Ga0126379_11492981 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 782 | Open in IMG/M |
| 3300011003|Ga0138514_100003682 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 2146 | Open in IMG/M |
| 3300012202|Ga0137363_10196375 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → unclassified Chthoniobacterales → Chthoniobacterales bacterium | 1616 | Open in IMG/M |
| 3300012350|Ga0137372_10849555 | All Organisms → cellular organisms → Bacteria | 652 | Open in IMG/M |
| 3300012359|Ga0137385_10849916 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae → Nitrosomonas → unclassified Nitrosomonas → Nitrosomonas sp. | 757 | Open in IMG/M |
| 3300012359|Ga0137385_11461589 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 547 | Open in IMG/M |
| 3300012361|Ga0137360_11228773 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
| 3300012685|Ga0137397_10587475 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 829 | Open in IMG/M |
| 3300012924|Ga0137413_10262576 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1191 | Open in IMG/M |
| 3300012929|Ga0137404_10595080 | All Organisms → cellular organisms → Bacteria | 994 | Open in IMG/M |
| 3300012929|Ga0137404_11336355 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 661 | Open in IMG/M |
| 3300012951|Ga0164300_10031211 | All Organisms → cellular organisms → Bacteria | 1957 | Open in IMG/M |
| 3300012955|Ga0164298_11514779 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
| 3300012960|Ga0164301_10534848 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 852 | Open in IMG/M |
| 3300012971|Ga0126369_13319419 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → Chthoniobacter flavus → Chthoniobacter flavus Ellin428 | 527 | Open in IMG/M |
| 3300012984|Ga0164309_10528263 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 908 | Open in IMG/M |
| 3300012984|Ga0164309_11708564 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → Roseimicrobium → unclassified Roseimicrobium → Roseimicrobium sp. ORNL1 | 540 | Open in IMG/M |
| 3300012988|Ga0164306_10945864 | All Organisms → cellular organisms → Bacteria | 706 | Open in IMG/M |
| 3300013102|Ga0157371_11121128 | Not Available | 604 | Open in IMG/M |
| 3300013297|Ga0157378_10481179 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 1237 | Open in IMG/M |
| 3300015077|Ga0173483_10662955 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
| 3300015242|Ga0137412_10128031 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 2055 | Open in IMG/M |
| 3300015357|Ga0134072_10110197 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 859 | Open in IMG/M |
| 3300015373|Ga0132257_102383001 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 687 | Open in IMG/M |
| 3300015373|Ga0132257_102437830 | All Organisms → cellular organisms → Bacteria | 679 | Open in IMG/M |
| 3300015373|Ga0132257_104531818 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 506 | Open in IMG/M |
| 3300015374|Ga0132255_100462592 | All Organisms → cellular organisms → Bacteria | 1858 | Open in IMG/M |
| 3300015374|Ga0132255_101714359 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 953 | Open in IMG/M |
| 3300016294|Ga0182041_10558435 | All Organisms → cellular organisms → Bacteria | 1001 | Open in IMG/M |
| 3300016341|Ga0182035_12122849 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 510 | Open in IMG/M |
| 3300016387|Ga0182040_10080854 | All Organisms → cellular organisms → Bacteria | 2141 | Open in IMG/M |
| 3300016404|Ga0182037_11905800 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 532 | Open in IMG/M |
| 3300018028|Ga0184608_10039046 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1825 | Open in IMG/M |
| 3300019789|Ga0137408_1327858 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 6528 | Open in IMG/M |
| 3300019867|Ga0193704_1019768 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1369 | Open in IMG/M |
| 3300019869|Ga0193705_1068403 | All Organisms → cellular organisms → Bacteria | 705 | Open in IMG/M |
| 3300019870|Ga0193746_1026413 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
| 3300019877|Ga0193722_1084187 | All Organisms → cellular organisms → Bacteria | 778 | Open in IMG/M |
| 3300019886|Ga0193727_1084091 | All Organisms → cellular organisms → Bacteria | 962 | Open in IMG/M |
| 3300020002|Ga0193730_1047731 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Caulobacterales → Caulobacteraceae → Caulobacter → unclassified Caulobacter → Caulobacter sp. 17J65-9 | 1237 | Open in IMG/M |
| 3300021363|Ga0193699_10051198 | All Organisms → cellular organisms → Bacteria | 1598 | Open in IMG/M |
| 3300021560|Ga0126371_12476073 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 628 | Open in IMG/M |
| 3300022534|Ga0224452_1038889 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1392 | Open in IMG/M |
| 3300023058|Ga0193714_1066894 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300025905|Ga0207685_10762096 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 531 | Open in IMG/M |
| 3300025906|Ga0207699_10150858 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1538 | Open in IMG/M |
| 3300025915|Ga0207693_10303798 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1250 | Open in IMG/M |
| 3300025915|Ga0207693_10649074 | All Organisms → cellular organisms → Bacteria | 820 | Open in IMG/M |
| 3300025916|Ga0207663_10793431 | All Organisms → cellular organisms → Bacteria | 754 | Open in IMG/M |
| 3300025936|Ga0207670_11520641 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 569 | Open in IMG/M |
| 3300025938|Ga0207704_11460117 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
| 3300025938|Ga0207704_11949503 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 505 | Open in IMG/M |
| 3300025940|Ga0207691_10161782 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 1963 | Open in IMG/M |
| 3300025972|Ga0207668_10010202 | All Organisms → cellular organisms → Bacteria | 5669 | Open in IMG/M |
| 3300026530|Ga0209807_1029686 | All Organisms → cellular organisms → Bacteria | 2632 | Open in IMG/M |
| 3300026530|Ga0209807_1160895 | All Organisms → cellular organisms → Bacteria | 844 | Open in IMG/M |
| 3300026548|Ga0209161_10174483 | All Organisms → cellular organisms → Bacteria | 1220 | Open in IMG/M |
| 3300027018|Ga0208475_1020665 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 645 | Open in IMG/M |
| 3300027018|Ga0208475_1031133 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 527 | Open in IMG/M |
| 3300027252|Ga0209973_1057148 | Not Available | 596 | Open in IMG/M |
| 3300028784|Ga0307282_10607191 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 531 | Open in IMG/M |
| 3300028819|Ga0307296_10022851 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 3298 | Open in IMG/M |
| 3300030916|Ga0075386_12165232 | All Organisms → cellular organisms → Bacteria | 926 | Open in IMG/M |
| 3300030966|Ga0075383_11230291 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
| 3300031057|Ga0170834_104149242 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1522 | Open in IMG/M |
| 3300031231|Ga0170824_101645518 | All Organisms → cellular organisms → Bacteria | 780 | Open in IMG/M |
| 3300031231|Ga0170824_121757461 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1048 | Open in IMG/M |
| 3300031469|Ga0170819_10765282 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 853 | Open in IMG/M |
| 3300031474|Ga0170818_113808306 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1076 | Open in IMG/M |
| 3300031562|Ga0310886_10331071 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 880 | Open in IMG/M |
| 3300031573|Ga0310915_10873161 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
| 3300031833|Ga0310917_10201341 | All Organisms → cellular organisms → Bacteria | 1331 | Open in IMG/M |
| 3300031942|Ga0310916_10576238 | All Organisms → cellular organisms → Bacteria | 957 | Open in IMG/M |
| 3300031943|Ga0310885_10067889 | All Organisms → cellular organisms → Bacteria | 1536 | Open in IMG/M |
| 3300031954|Ga0306926_10735250 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1194 | Open in IMG/M |
| 3300033289|Ga0310914_10840164 | All Organisms → cellular organisms → Bacteria | 817 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 12.41% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 10.22% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 8.76% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 7.30% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 6.57% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.84% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 3.65% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.65% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 3.65% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.92% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.92% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 2.92% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 2.92% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.19% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.19% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.19% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 2.19% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.46% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.46% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 1.46% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 1.46% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.46% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.73% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.73% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.73% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.73% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.73% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.73% |
| Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.73% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.73% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.73% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.73% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.73% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.73% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.73% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.73% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2088090014 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 2170459010 | Grass soil microbial communities from Rothamsted Park, UK - December 2009 direct MP BIO1O1 lysis 0-9cm (no DNA from 10 to 21cm!!!) | Environmental | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000890 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
| 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Host-Associated | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300011003 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t9i015 | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300015077 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2) | Environmental | Open in IMG/M |
| 3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
| 3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300019867 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3m1 | Environmental | Open in IMG/M |
| 3300019869 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3m2 | Environmental | Open in IMG/M |
| 3300019870 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1m1 | Environmental | Open in IMG/M |
| 3300019877 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m1 | Environmental | Open in IMG/M |
| 3300019886 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c2 | Environmental | Open in IMG/M |
| 3300020002 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a1 | Environmental | Open in IMG/M |
| 3300021363 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c2 | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022534 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_b1 | Environmental | Open in IMG/M |
| 3300023058 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2m1 | Environmental | Open in IMG/M |
| 3300024187 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK13 | Environmental | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026530 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes) | Environmental | Open in IMG/M |
| 3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
| 3300027018 | Grasslands soil microbial communities from Kansas, USA, that are Nitrogen fertilized - NN575 (SPAdes) | Environmental | Open in IMG/M |
| 3300027252 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
| 3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
| 3300030916 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA12 EcM (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030966 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FB4 EcM (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031469 | Fir Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031538 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1 | Environmental | Open in IMG/M |
| 3300031562 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031943 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| GPIPI_02082290 | 2088090014 | Soil | MKTKLVLTIAILIGVLALISAGYCFWLMNIPLSYRWVPVVVTGFLQAIFVFVISLITSLV |
| GPIPI_03170990 | 2088090014 | Soil | MKVKLVLKVIALIGVPALIAAGYCFWLMTVPLSYD |
| F62_09461220 | 2170459010 | Grass Soil | MKTKLVLKIAGLIGVLTLISAGYCFWLMTVPLSYRWVPVVLIGFVVSIGVFVISLIT |
| INPhiseqgaiiFebDRAFT_1017062742 | 3300000364 | Soil | MNTKLTFKAVGTIGVLALISTIYCFWLMTVPLSYDLV* |
| INPhiseqgaiiFebDRAFT_1017067022 | 3300000364 | Soil | MNTKLALKMAGTIGVLALISTIYCFWLMTVPLSYDLV* |
| JGI11643J12802_123633801 | 3300000890 | Soil | MATKLVLKVAGLIGLLALISAGYCFWLMTVPLSYDWVPVVLVGFVVATGVFVIS |
| JGI1027J12803_1078507633 | 3300000955 | Soil | MKTKLALKVVGSIGVLALISAGYCFWLMTVPLSYDWVPVVLIGFVVAVG |
| Ga0062593_1004584231 | 3300004114 | Soil | MKVKLVLKVIALIGVPALIAAGYCFWLMTVPLSYD*VPVVLIGFVVAIGVF |
| Ga0062589_1003713791 | 3300004156 | Soil | MVIGLIGMLALISAAYCFWLMTIPLSYDLVYVVVIGFAVSL |
| Ga0063356_1015764371 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MKTKLVLTIGVLIGVLAVIAAGYCFWLMENPLSYRWVPVVITGFLLAIFVFIISLITSIIALI |
| Ga0062592_1010327351 | 3300004480 | Soil | MATKLVLKVAGLIGLLALISAGYCFWLMTVPLSYDWVPVVLVG |
| Ga0062592_1019097461 | 3300004480 | Soil | MKTKLVLTIAVLIGGLALVAAGYCFWLMTVPLSYDWVPVVLIGFVVAIGVFL |
| Ga0066671_109221082 | 3300005184 | Soil | MKTKLTLKVVGLIGVLALISAGYCFWRMTVPLSYDWVPVV |
| Ga0066675_110345922 | 3300005187 | Soil | MKTKRSLMVIGLIGLLALISATYCFWLMTVPLSYDLVYVVVI |
| Ga0070676_101852901 | 3300005328 | Miscanthus Rhizosphere | MKTKRFLMVSGLVGVLALISASYCFWLMTIPLSYNLVYVVV |
| Ga0066388_1044682392 | 3300005332 | Tropical Forest Soil | MKTKLVLTIAVVIGVLALGAAAYCFWLMDNPLSYRWVPVVITGFLLALFVFIIAS |
| Ga0068868_1018935652 | 3300005338 | Miscanthus Rhizosphere | MKTKRRFILVSLIGGLALVTGSYCFWLMTVPLSYDWVYIVVAGLV |
| Ga0070689_1005685551 | 3300005340 | Switchgrass Rhizosphere | MKTKLLLAIAVLIGVLSLISGGYCFYLMNVPLSYRWVPVVVT |
| Ga0070674_1020794012 | 3300005356 | Miscanthus Rhizosphere | MKTKRFLMVSGLVGVLALISASYCFWLMTIPLSYNLVYVVVIGFIVSLG |
| Ga0070688_1007087902 | 3300005365 | Switchgrass Rhizosphere | MKTKRSLMVSGLVGVFALVSAAYCFWLMTVPLSYNLVYVVV |
| Ga0070714_1006168352 | 3300005435 | Agricultural Soil | MKTKLALKVVGLIGLLALISAGYCFWLMTVPLSYDWVPVVLIGFVLSTGVFVTSLITSFIVL |
| Ga0070714_1006753831 | 3300005435 | Agricultural Soil | MKTKLALKVVGLIGVLALILASYCFWLMTVPLSYDFVPVVLIGFVLSTSVFVISLITSF |
| Ga0070700_1014212651 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | MKIKVVLTTAVLIGVLALISAGYCFWLMDNPLSYRWVPVVITGFL |
| Ga0066686_109570332 | 3300005446 | Soil | MKTKRSLMVIALIGVLAFISAAYCFWLMTVPLSYDLVYVVVI |
| Ga0070678_1008426761 | 3300005456 | Miscanthus Rhizosphere | MKTKIVLTIAVVIGVLSLISGGYCFWLMTVPLSYSWVPVVVTG |
| Ga0070685_115664631 | 3300005466 | Switchgrass Rhizosphere | MKIKVVLTTAVLIGVLALISAGYCFWLMDHPLSYRWVPVVI |
| Ga0066903_1029390431 | 3300005764 | Tropical Forest Soil | MNSKLVLKIVGLIGVLALISAGYCFWLMTVPLSYDWVPVVLIGFVVAIGV |
| Ga0066903_1029779371 | 3300005764 | Tropical Forest Soil | MKTNRAVIVVGLIGLLALILASYCFWLMTVPLSYDWVIP |
| Ga0066903_1048283693 | 3300005764 | Tropical Forest Soil | MKTKLVLKIAVLIGVLALIAAGYCFWLMTVPLSYDWVPVVLIGFVM |
| Ga0068858_1016232861 | 3300005842 | Switchgrass Rhizosphere | MKIKVVLTTAVLIGVLALISAGYCFWLMDHPLSYRWVPVVITGFLPAIFVFIISLVTLFIAL |
| Ga0081455_101093451 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MKTKLVLTVAGLIGVLALISAGYCFWLMTIPLSYDWVPVVLIGFI |
| Ga0081455_102179344 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MKTKLVLAIAVLIGVLALISAGYCFWLMTVPLSYDWVPVVLIGFVVATGVFVI |
| Ga0081455_104437913 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MKTKLVLTVAALIGVLSLISAGYCFWLMTVPLSYDWVPFVLIGFVVATGVFVIALITSF |
| Ga0081540_11185281 | 3300005983 | Tabebuia Heterophylla Rhizosphere | MKTKLVLTIAVVTGLLALISAGYCFWLADNPLSYRWVPAVITG |
| Ga0066652_1003940763 | 3300006046 | Soil | MKTKLTLKVVGLIGVLALISAGYCFWLMTVPLSYDWVPVVV |
| Ga0066652_1014468022 | 3300006046 | Soil | MVIALIGVLTFISAAYCFWLMTVPLSYDLVYVVVIGFIVS |
| Ga0070715_108803462 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | MKTKLALKVVGLIGLLALISAGYCFWLMTVPLSYDWVP |
| Ga0070716_1002275012 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MKTKLALKVVGLIGLLALILAGYCFWLMTVPLSYDWVPVVLIGFVLSTGVYVTSLITS |
| Ga0070712_1004797573 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MKTKVALKVVGLIGVLALISAGYCFWLMTVPLSYDWVPVVLIGFVL |
| Ga0075424_1002168911 | 3300006904 | Populus Rhizosphere | MKTKLVLTIAVLIGGLALVAAGYCFWLMNVPLSYRWVPV |
| Ga0075435_1003628731 | 3300007076 | Populus Rhizosphere | MKTKLVLTIAVVIGVLAVISAGYCFWLMENPLSYSWVPVVITGFLLAIFVFIISLITSIIALI |
| Ga0099827_103604841 | 3300009090 | Vadose Zone Soil | MKTKLTLKVVGLIGVLTLISAGYCFWLMTVPLSYDWVP |
| Ga0105241_110734561 | 3300009174 | Corn Rhizosphere | MKTKPVLKIAVLIGVLALVSAGYCFWLMTVPLSYHWVPVVLIGFVVSI |
| Ga0134111_103121311 | 3300010329 | Grasslands Soil | MKTKLVLKVAGLIGLLALISAGYCFWLMTVPLSYDWVPVVLIG |
| Ga0134063_105742402 | 3300010335 | Grasslands Soil | MKAKLVLKVAGLIGVLALISAGYCFWLMIFPLSYDWVPVVLSGFVLATGVFVIS |
| Ga0126376_101248993 | 3300010359 | Tropical Forest Soil | MKTKLVLTIAVLIGVLALVAAGYCFWLMNVPLSYR* |
| Ga0126376_109992071 | 3300010359 | Tropical Forest Soil | MIFGVMKTKLVLTIAVLIGVLSLISGGYCFWLMNVPL |
| Ga0126372_101661161 | 3300010360 | Tropical Forest Soil | MNIKRSLVASGLLGVLALISAGYCFWLMTVPLSYDLVY |
| Ga0126372_128564622 | 3300010360 | Tropical Forest Soil | MKTKLVLIVAVLIGVLALISGGYCFWLMNVPLSYRWVPVVVTGFLLAIFMFIISLVTSIV |
| Ga0126378_122029642 | 3300010361 | Tropical Forest Soil | MNSKLVLKIVGLIGVLALISAGYCFWLMTVPLSYDWVPVVLIGFVVAIGVFV |
| Ga0126379_114929811 | 3300010366 | Tropical Forest Soil | MKTKLVLAIAVVIGVLALIAAGYCFWLMDNPLSYRWVPVVITGFL |
| Ga0134127_131002331 | 3300010399 | Terrestrial Soil | MKIKVVMTTAVLIGVLALISAGYCFWLMDNPLSYRWVPVVITGFLLAIFVFIISLVTFFI |
| Ga0138514_1000036825 | 3300011003 | Soil | MKTKLALKVVGLICVLALISAGYCFWLMTVPLSYDWVYAVVIGFV |
| Ga0137363_101963751 | 3300012202 | Vadose Zone Soil | MKTKRSLMVVGLIGVLALISAAYCFWLMTVPLSYDLVYVVVIG |
| Ga0137372_108495552 | 3300012350 | Vadose Zone Soil | MKTKLTLKVVGLIGVLALISAGYCFWLMTVPLSYDWVPVVVIGFVVSI |
| Ga0137385_108499162 | 3300012359 | Vadose Zone Soil | MKTKLTLKVVGLIGVLALISAGYCFWLMTIPLSYDWVPVVVIGFVVSIGVFVISLISSFI |
| Ga0137385_114615892 | 3300012359 | Vadose Zone Soil | MKTKLTLKVVGLIGVLALISAGYCFWLMTVPLSYD |
| Ga0137360_112287731 | 3300012361 | Vadose Zone Soil | MTNKLALKVVGLIGVLALISASYCFWLMTVPLSYDWVYAV |
| Ga0137397_105874752 | 3300012685 | Vadose Zone Soil | MKIAGLIGVLALISTGYCFWLMTVPLSYHWVPVVLIGFVVSIGVLVISLITSFILLTRLR |
| Ga0137413_102625761 | 3300012924 | Vadose Zone Soil | MKTKLALKVVGLIGVLALISAGYCFWLMTVPLSYDWVYAVVIGCVVSIGVFVISLISSI |
| Ga0137404_105950801 | 3300012929 | Vadose Zone Soil | MKTKLALKVVGLIDVLALISAGYCFWLMTVPLSYDWVPVVLIGFVVSIGVSVISLI |
| Ga0137404_113363551 | 3300012929 | Vadose Zone Soil | MKTKLALKVVGLIGALALISAGYCFWLMTVPLSYDWVYAVV |
| Ga0126375_111484862 | 3300012948 | Tropical Forest Soil | MKIKVVLMIAVVTGVLALISAGYCFWLMDNPLSYRWVPVVITGFLLAIFVFIISLV |
| Ga0164300_100312111 | 3300012951 | Soil | MRTKLFLKVAGLIGVLALISTGYCFWLMTVPLSYH |
| Ga0164298_115147791 | 3300012955 | Soil | MKAKLVLKVTALIGVPALIAAGYCFWLMTVPLSYDW |
| Ga0164301_105348481 | 3300012960 | Soil | MKTKLVLKIAGLIGVLALISTGYCFWLMTVPLSYHWVPV |
| Ga0126369_121459462 | 3300012971 | Tropical Forest Soil | MKTKLVLTIAGVIGVLALISGGCCFWLMTVPLSYNWVPVVITGFLLAIFVFII |
| Ga0126369_133194191 | 3300012971 | Tropical Forest Soil | MKTKLVLKIAVLIGVLALIAAGYCFWLMTVPLSYDWVPVVLIGF |
| Ga0164309_105282632 | 3300012984 | Soil | MKTKLVLKIAGLIGVLALISAGYCFWLMTVPLSYDWVPVVLIGFVVAIGVFVI |
| Ga0164309_117085641 | 3300012984 | Soil | MKTKLALKVVALIGVLALISTGYCFWLMTVPLSYHW |
| Ga0164306_109458642 | 3300012988 | Soil | MKAKLVLTIAVLIGVLALISTGYCFWLMTVPLSYHWVSVVLIGFG |
| Ga0157371_111211281 | 3300013102 | Corn Rhizosphere | MNTKLTFKVVGTIGVLALISTIYCFWLMTVPPFL* |
| Ga0157378_104811791 | 3300013297 | Miscanthus Rhizosphere | MKTKLVLKVVGLIGALALIAAGYCFWLMTVPLSYDWCPLS* |
| Ga0173483_106629552 | 3300015077 | Soil | MKVKLVLKVIALIGVPALIAAGYCFWLMTVPLSYD* |
| Ga0137412_101280311 | 3300015242 | Vadose Zone Soil | MKTKLALKVVGLIGVLALISAGYCFWLMTIPLSYDWVYAVVIGFVVS |
| Ga0134072_101101971 | 3300015357 | Grasslands Soil | MKTKLILKVAGVIGVLALISAGYCFWLMTIPLSYDLVYVVVIGFIVSLG |
| Ga0132257_1023830011 | 3300015373 | Arabidopsis Rhizosphere | MKTKRVLTVAVLIGVLALISGGYCFWLMNVPLSYRWVPVVVTGFLLAI |
| Ga0132257_1024378301 | 3300015373 | Arabidopsis Rhizosphere | VEPEKMQEAKTKLALKVVGPVGVLALISAGYCFWLMTVPISYDLVYVVVIGFIVSI |
| Ga0132257_1045318182 | 3300015373 | Arabidopsis Rhizosphere | MKTKLALKVAGLIGVLALISTGYCFWLMTVPLSYHWVPVVLIGFVVS |
| Ga0132255_1004625921 | 3300015374 | Arabidopsis Rhizosphere | MKTKLVLTIAVLIGGLALVAAGYCFWLMNVPLSYRWVPVVITGFLLAIF |
| Ga0132255_1017143591 | 3300015374 | Arabidopsis Rhizosphere | MKTKLVLTIAVLIGVLALISGGYCFWLMTVPLSYDWVPVVLIGFVVA |
| Ga0182041_105584353 | 3300016294 | Soil | IFEVMKTKLVLTIAVLIGVLALVAGGYCFWLMNVPLSYRWVPA |
| Ga0182035_121228493 | 3300016341 | Soil | LKVAILVGGLALISAGYCFWLMTVPLSYNWVPVVVTGFLLAVFMFIMSL |
| Ga0182040_100808542 | 3300016387 | Soil | MKTKLVLTIAVLIGVLALVAGGYCFWLMNVPLSYRWVPA |
| Ga0182037_119058001 | 3300016404 | Soil | LIFGVMKRKLVLKVAILVGGLALISAGYCFWLMTVPLSYNWV |
| Ga0184608_100390461 | 3300018028 | Groundwater Sediment | MKTKLALKVVGLIGVLALISAGYCFWLMTVPLSYD |
| Ga0137408_13278585 | 3300019789 | Vadose Zone Soil | MKNQTALKVVGLIGVLALISAGYCFWLMTVPLSYDWV |
| Ga0193704_10197681 | 3300019867 | Soil | MKTKLALKVVGLIGVLALISAGYCFWLMTVPLSYDWVY |
| Ga0193705_10684031 | 3300019869 | Soil | MKTKLALKVVGLIGVLALISAGYCFWLMTVPLSYDWVYAVVIGFVVSIGVFVISLISSII |
| Ga0193746_10264132 | 3300019870 | Soil | MKTKLALKVVGLIGVLSLISAGYCFWLMTVPLSYDWVPVVLI |
| Ga0193722_10841871 | 3300019877 | Soil | MKTKLALKVVGLIGVLALISAGYCFWLMTVPLSYDWVPVVLIGF |
| Ga0193727_10840911 | 3300019886 | Soil | VAELVLVMKTKLALKVVGLIGVLALISAGYCFWLMTVPLSHDWVYAVVIGFVVSI |
| Ga0193730_10477311 | 3300020002 | Soil | MKTKLALKVVGLIGVLALISAGYCFWLMTVPLSYDWVPVV |
| Ga0193699_100511985 | 3300021363 | Soil | MKTKLALKVVGLIGVLALISAGYCFWLMTVPLSYDWVPV |
| Ga0126371_124760731 | 3300021560 | Tropical Forest Soil | MIFGVMKTKLVLTIAVLIGVLSLISGGYCFWLMNVP |
| Ga0224452_10388891 | 3300022534 | Groundwater Sediment | MKTKLALKVVGLIGVLALISAGYCFWLMTVPLSYDWVPVVIIGF |
| Ga0193714_10668942 | 3300023058 | Soil | MKTKLALKVVGLIGVLALISAGYCFWLMTVPLSYDRVYA |
| Ga0247672_10989612 | 3300024187 | Soil | MKTKIVLTIAVVIGVLSLISGGYCFWLMTVPLSYSWVPVVVTGFLLALFMFIISLI |
| Ga0207685_107620962 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | MKTKLLLAIAVLIGVLSLISGGYCFYLMNVPLSYRWVPVVVTGFLLA |
| Ga0207699_101508581 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MKTKLALKVVGLIGLLALISAGYCFWLMTVPLSYDWVPVVLIGFVLSTGVFVTSLITSFIVLIR |
| Ga0207693_103037981 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MQTKRSLVVTRLISVLAIVAAAYCFWLMTVPLSHDLVVLVVIGFVLSLLV |
| Ga0207693_106490742 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | VKTKLALKVIGLIGVLALISAGYCFWLMTVPLSYDWVPVVLIG |
| Ga0207663_107934311 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MKTKLALKVVGLIGVLALISAGYCFWLMTVPLSYDWVYAVVIGFVVSIGVFVI |
| Ga0207687_116570422 | 3300025927 | Miscanthus Rhizosphere | MKIKVVLTTAVLIGVLALISAGYCFWLMDHPLSYRWVPVVITGFLLAIFVFIISLVTL |
| Ga0207701_109913201 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | MKIKVILTIAVLLAAFALISAGYCFWLMDNPLSYRWVPVVITGFLLAIF |
| Ga0207670_115206412 | 3300025936 | Switchgrass Rhizosphere | MKTKLVLAIAVLIGVLSLISGGYCFYLMNVPLSYRWVPVV |
| Ga0207704_114601171 | 3300025938 | Miscanthus Rhizosphere | MKTKLVLKVVGLIGALALIAAGYCFWLMTVPLSYDLVSVVVI |
| Ga0207704_119495031 | 3300025938 | Miscanthus Rhizosphere | MKTKPVLKIAVLIGVLALVSAGYCFWLMTVPLSYHWVPVVLIGFVVSIGVLVISLITSFI |
| Ga0207691_101617821 | 3300025940 | Miscanthus Rhizosphere | MMKTKRSLIVSGSVSVLALISAAYCFWLMTVPLSYDLVYIVVIGF |
| Ga0207712_108881021 | 3300025961 | Switchgrass Rhizosphere | MKTKLVLTIAVLIGGLALVAAGYCFWLMNVPLSYRWVPIVITGFLLAIFVLIISLITSFIALMQ |
| Ga0207668_100102021 | 3300025972 | Switchgrass Rhizosphere | MKTKRFLMVSGLVGVLALISASYCFWLMTIPLSYNLVYVVVIGFIVS |
| Ga0207683_108844191 | 3300026121 | Miscanthus Rhizosphere | MKTKIVLTIAVVIGVLSLISGGYCFWLMTVPLSYSWVPVVVTGFLLALFMFIASL |
| Ga0209807_10296861 | 3300026530 | Soil | MKTKLTLKVVGLIGVLALISAGYCFWLMTVPLSYDWVPVVVIGFVVSIGVFVISLIS |
| Ga0209807_11608953 | 3300026530 | Soil | MRTKRSLMVIALIGVLAFISAAYCFWLMTVPLSYDLVYVVVIGF |
| Ga0209161_101744832 | 3300026548 | Soil | MKTKLTLKVVGLIGVLALIWAGYCFWLMTVPLSYD |
| Ga0208475_10206651 | 3300027018 | Soil | MKTKLVLKVAGLIGALALVSAGYCFWLMTVPLSYDSVPVVL |
| Ga0208475_10311332 | 3300027018 | Soil | MKTKLVVKIAGLIGVLALISAGYCFWLMSVPLSYDWVPVVLIGFVVATGVFVISLITSHVVLI |
| Ga0209973_10571482 | 3300027252 | Arabidopsis Thaliana Rhizosphere | MKTKLALKVVGVIGVLALISAGYCFWLMTVPLSYQWV |
| Ga0307282_106071911 | 3300028784 | Soil | MKTKLALKVVGLIGVLALISAGYCFWLMTVPLSYDWVYAVVIGFVVSIGVFVISLI |
| Ga0307296_100228511 | 3300028819 | Soil | MKTKLALKVVGLIGVLALISAGYCFWLMTVPLSYDWV |
| Ga0075386_121652323 | 3300030916 | Soil | MKTKLVLKVAGLIAVLALISTGYCFWLMTVPLSYHW |
| Ga0075383_112302911 | 3300030966 | Soil | AGLMGMLALISAGYCFWLMTVPLSYDWVPVVLIGFVLAIGVFVSSLITSFIVLIRLRRSR |
| Ga0170834_1041492421 | 3300031057 | Forest Soil | MKTKVALKVIGLIGVLALISAGYCFCLMTVPLSYDWVPVGLIGFVLSTGVLVIS |
| Ga0170824_1016455181 | 3300031231 | Forest Soil | VKTKLALTVVGLIGVLALISAGYCFWLMTVPLSYNW |
| Ga0170824_1217574613 | 3300031231 | Forest Soil | MKTKLALKVVGLVAVLALIPTGYCFWLMTVPLSYHWVPVVLIGFVVSIGVFVI |
| Ga0170819_107652821 | 3300031469 | Forest Soil | MKTKLVLKGAALIGVLALISAGYCFWLMTVPLSYDWVPVVLIGFVV |
| Ga0170818_1138083061 | 3300031474 | Forest Soil | LKGAALIGVLALISAGYCLWLMTVPLSYDSVPVVMIGFVVA |
| Ga0310888_106854832 | 3300031538 | Soil | MKIKVVLTTAVLIGVLALISAGYCFWLMDHPLSYRWVPVVITGFLLAIFVFIISLVT |
| Ga0310886_103310713 | 3300031562 | Soil | MKIKVVLTTAVLIGVLALISAGYCFWLMDHPLSYRWVPIVITGFLLAIF |
| Ga0310915_108731611 | 3300031573 | Soil | MNSKLVLKIVGLIGMLALISAGYCFWLITVPLSYDWVP |
| Ga0310917_102013413 | 3300031833 | Soil | MNSKLVLKIVGLIGMLALISAGYCFWLITVPLSYDWVPVVLIGFVVAIGVFVISLIASFI |
| Ga0310916_105762382 | 3300031942 | Soil | MNSKLVLKIVGLIGMLALISAGYCFWLITVPLSYDWV |
| Ga0310885_100678891 | 3300031943 | Soil | MKTKLALKVVGLIGVLALISAGYCFWLMTVPISYRWVPVVLIGFV |
| Ga0310909_111778931 | 3300031947 | Soil | LTVVVLIGLLALIAAGYCFWLMDNPLSYRWAPVVITDFLLAIFVFIIAFITSFI |
| Ga0306926_107352501 | 3300031954 | Soil | MKTKLVLTIAVLVGVLALVAAGYCFWLMNVPLSYRWLPIVITVFL |
| Ga0307472_1025695131 | 3300032205 | Hardwood Forest Soil | MKTKIVLAIAVLIGVLSLISGGYCFYLMNVPLSYRWVPVVVTGFLLAIFMFIMSLITSFVALI |
| Ga0310914_108401641 | 3300033289 | Soil | MNSKLVLKIVGLIGMLALISAGYCFWLITVPLSYDWVPVVLIGFVVAIGVFVISLIAS |
| ⦗Top⦘ |