


| Basic Information | |
|---|---|
| Family ID | F056889 |
| Family Type | Metagenome |
| Number of Sequences | 137 |
| Average Sequence Length | 41 residues |
| Representative Sequence | MKNLSHEEQITLILIGIAIGIGIGFVLKTFVDTYYLVGSLP |
| Number of Associated Samples | 105 |
| Number of Associated Scaffolds | 137 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 30.66 % |
| % of genes near scaffold ends (potentially truncated) | 16.79 % |
| % of genes from short scaffolds (< 2000 bps) | 89.78 % |
| Associated GOLD sequencing projects | 94 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.56 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (45.985 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (44.526 % of family members) |
| Environment Ontology (ENVO) | Unclassified (84.672 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (97.080 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 47.83% β-sheet: 0.00% Coil/Unstructured: 52.17% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.56 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 137 Family Scaffolds |
|---|---|---|
| PF01521 | Fe-S_biosyn | 11.68 |
| PF00578 | AhpC-TSA | 5.84 |
| PF02412 | TSP_3 | 4.38 |
| PF03851 | UvdE | 3.65 |
| PF08534 | Redoxin | 2.19 |
| PF03819 | MazG | 1.46 |
| PF02562 | PhoH | 0.73 |
| PF00085 | Thioredoxin | 0.73 |
| COG ID | Name | Functional Category | % Frequency in 137 Family Scaffolds |
|---|---|---|---|
| COG0316 | Fe-S cluster assembly iron-binding protein IscA | Posttranslational modification, protein turnover, chaperones [O] | 11.68 |
| COG4841 | Uncharacterized conserved protein YneR, related to HesB/YadR/YfhF family | Function unknown [S] | 11.68 |
| COG4294 | UV DNA damage repair endonuclease | Replication, recombination and repair [L] | 3.65 |
| COG1702 | Phosphate starvation-inducible protein PhoH, predicted ATPase | Signal transduction mechanisms [T] | 0.73 |
| COG1875 | Predicted ribonuclease YlaK, contains NYN-type RNase and PhoH-family ATPase domains | General function prediction only [R] | 0.73 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 87.59 % |
| Unclassified | root | N/A | 12.41 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000115|DelMOSum2011_c10064752 | All Organisms → Viruses → Predicted Viral | 1353 | Open in IMG/M |
| 3300000115|DelMOSum2011_c10072134 | All Organisms → Viruses → Predicted Viral | 1239 | Open in IMG/M |
| 3300000117|DelMOWin2010_c10011320 | All Organisms → cellular organisms → Bacteria | 5014 | Open in IMG/M |
| 3300000168|LPjun09P1210mDRAFT_c1004852 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium TMED198 | 1190 | Open in IMG/M |
| 3300001450|JGI24006J15134_10043488 | All Organisms → Viruses → Predicted Viral | 1885 | Open in IMG/M |
| 3300002483|JGI25132J35274_1008896 | All Organisms → Viruses → Predicted Viral | 2494 | Open in IMG/M |
| 3300002488|JGI25128J35275_1040369 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium TMED198 | 1045 | Open in IMG/M |
| 3300002514|JGI25133J35611_10137195 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium TMED198 | 683 | Open in IMG/M |
| 3300005057|Ga0068511_1106474 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium TMED198 | 503 | Open in IMG/M |
| 3300005430|Ga0066849_10084015 | All Organisms → Viruses → Predicted Viral | 1270 | Open in IMG/M |
| 3300005430|Ga0066849_10130977 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED8 | 991 | Open in IMG/M |
| 3300005430|Ga0066849_10407113 | Not Available | 512 | Open in IMG/M |
| 3300005523|Ga0066865_10052148 | All Organisms → Viruses → Predicted Viral | 1422 | Open in IMG/M |
| 3300005934|Ga0066377_10020758 | All Organisms → Viruses → Predicted Viral | 1755 | Open in IMG/M |
| 3300006166|Ga0066836_10212366 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium TMED198 | 1150 | Open in IMG/M |
| 3300006190|Ga0075446_10051937 | All Organisms → Viruses → Predicted Viral | 1268 | Open in IMG/M |
| 3300006565|Ga0100228_1185293 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED8 | 764 | Open in IMG/M |
| 3300006735|Ga0098038_1027384 | All Organisms → Viruses → Predicted Viral | 2140 | Open in IMG/M |
| 3300006735|Ga0098038_1147161 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium TMED198 | 787 | Open in IMG/M |
| 3300006735|Ga0098038_1254512 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium TMED198 | 554 | Open in IMG/M |
| 3300006737|Ga0098037_1080342 | All Organisms → Viruses → Predicted Viral | 1145 | Open in IMG/M |
| 3300006738|Ga0098035_1142962 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium TMED198 | 816 | Open in IMG/M |
| 3300006749|Ga0098042_1051382 | All Organisms → Viruses → Predicted Viral | 1117 | Open in IMG/M |
| 3300006751|Ga0098040_1029674 | All Organisms → Viruses → Predicted Viral | 1749 | Open in IMG/M |
| 3300006752|Ga0098048_1232394 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium TMED198 | 541 | Open in IMG/M |
| 3300006753|Ga0098039_1014336 | All Organisms → Viruses → Predicted Viral | 2883 | Open in IMG/M |
| 3300006754|Ga0098044_1117826 | All Organisms → Viruses → Predicted Viral | 1080 | Open in IMG/M |
| 3300006754|Ga0098044_1183729 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED8 | 828 | Open in IMG/M |
| 3300006754|Ga0098044_1193797 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium TMED198 | 801 | Open in IMG/M |
| 3300006789|Ga0098054_1111500 | All Organisms → Viruses → Predicted Viral | 1021 | Open in IMG/M |
| 3300006789|Ga0098054_1167325 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium TMED198 | 808 | Open in IMG/M |
| 3300006789|Ga0098054_1325936 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300006793|Ga0098055_1111929 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium TMED198 | 1062 | Open in IMG/M |
| 3300006802|Ga0070749_10385174 | Not Available | 775 | Open in IMG/M |
| 3300006868|Ga0075481_10347455 | Not Available | 513 | Open in IMG/M |
| 3300006916|Ga0070750_10278166 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED8 | 720 | Open in IMG/M |
| 3300006922|Ga0098045_1010377 | All Organisms → Viruses → Predicted Viral | 2651 | Open in IMG/M |
| 3300006923|Ga0098053_1033385 | All Organisms → Viruses → Predicted Viral | 1089 | Open in IMG/M |
| 3300006929|Ga0098036_1064734 | All Organisms → Viruses → Predicted Viral | 1129 | Open in IMG/M |
| 3300006929|Ga0098036_1110963 | Not Available | 842 | Open in IMG/M |
| 3300006929|Ga0098036_1282784 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium TMED198 | 500 | Open in IMG/M |
| 3300007543|Ga0102853_1081954 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium TMED198 | 592 | Open in IMG/M |
| 3300007963|Ga0110931_1206609 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium TMED198 | 586 | Open in IMG/M |
| 3300008050|Ga0098052_1331901 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 571 | Open in IMG/M |
| 3300009071|Ga0115566_10071240 | All Organisms → Viruses → Predicted Viral | 2295 | Open in IMG/M |
| 3300009172|Ga0114995_10553131 | Not Available | 629 | Open in IMG/M |
| 3300009418|Ga0114908_1176326 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 674 | Open in IMG/M |
| 3300009420|Ga0114994_10104380 | All Organisms → Viruses → Predicted Viral | 1928 | Open in IMG/M |
| 3300009428|Ga0114915_1107422 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED8 | 824 | Open in IMG/M |
| 3300009481|Ga0114932_10755057 | All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Marinimicrobia | 565 | Open in IMG/M |
| 3300009550|Ga0115013_10881183 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED8 | 626 | Open in IMG/M |
| 3300009593|Ga0115011_10118958 | All Organisms → Viruses → Predicted Viral | 1887 | Open in IMG/M |
| 3300009593|Ga0115011_11422437 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium TMED198 | 609 | Open in IMG/M |
| 3300009790|Ga0115012_10844144 | Not Available | 745 | Open in IMG/M |
| 3300009790|Ga0115012_11632421 | Not Available | 559 | Open in IMG/M |
| 3300010151|Ga0098061_1053017 | All Organisms → Viruses → Predicted Viral | 1575 | Open in IMG/M |
| 3300011252|Ga0151674_1083467 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED8 | 602 | Open in IMG/M |
| 3300012920|Ga0160423_10648960 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 714 | Open in IMG/M |
| 3300012928|Ga0163110_10230120 | All Organisms → Viruses → Predicted Viral | 1327 | Open in IMG/M |
| 3300012928|Ga0163110_10296698 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium TMED198 | 1181 | Open in IMG/M |
| 3300012954|Ga0163111_11133044 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED8 | 761 | Open in IMG/M |
| 3300017702|Ga0181374_1064544 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
| 3300017705|Ga0181372_1021761 | All Organisms → Viruses → Predicted Viral | 1096 | Open in IMG/M |
| 3300017705|Ga0181372_1031087 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium TMED198 | 904 | Open in IMG/M |
| 3300017706|Ga0181377_1073053 | Not Available | 621 | Open in IMG/M |
| 3300017708|Ga0181369_1060600 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium TMED198 | 832 | Open in IMG/M |
| 3300017709|Ga0181387_1010567 | All Organisms → Viruses → Predicted Viral | 1787 | Open in IMG/M |
| 3300017709|Ga0181387_1033420 | All Organisms → Viruses → Predicted Viral | 1011 | Open in IMG/M |
| 3300017729|Ga0181396_1118016 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium TMED198 | 546 | Open in IMG/M |
| 3300017731|Ga0181416_1108524 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED8 | 663 | Open in IMG/M |
| 3300017741|Ga0181421_1074814 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED8 | 888 | Open in IMG/M |
| 3300017757|Ga0181420_1031349 | All Organisms → Viruses → Predicted Viral | 1745 | Open in IMG/M |
| 3300017757|Ga0181420_1034097 | All Organisms → Viruses → Predicted Viral | 1664 | Open in IMG/M |
| 3300017757|Ga0181420_1156927 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium TMED198 | 676 | Open in IMG/M |
| 3300017770|Ga0187217_1215413 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium TMED198 | 633 | Open in IMG/M |
| 3300017772|Ga0181430_1097018 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium TMED198 | 880 | Open in IMG/M |
| 3300017775|Ga0181432_1017401 | All Organisms → Viruses → Predicted Viral | 1826 | Open in IMG/M |
| 3300017775|Ga0181432_1025541 | All Organisms → Viruses → Predicted Viral | 1555 | Open in IMG/M |
| 3300017775|Ga0181432_1034606 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 1368 | Open in IMG/M |
| 3300017775|Ga0181432_1057805 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 1097 | Open in IMG/M |
| 3300017775|Ga0181432_1089354 | Not Available | 908 | Open in IMG/M |
| 3300017775|Ga0181432_1101672 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 856 | Open in IMG/M |
| 3300017775|Ga0181432_1126749 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 774 | Open in IMG/M |
| 3300017775|Ga0181432_1156016 | Not Available | 703 | Open in IMG/M |
| 3300017775|Ga0181432_1216685 | Not Available | 601 | Open in IMG/M |
| 3300017775|Ga0181432_1271951 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 536 | Open in IMG/M |
| 3300017775|Ga0181432_1288137 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 520 | Open in IMG/M |
| 3300017775|Ga0181432_1295800 | Not Available | 513 | Open in IMG/M |
| 3300017952|Ga0181583_10647715 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium TMED198 | 632 | Open in IMG/M |
| 3300017962|Ga0181581_10667923 | Not Available | 627 | Open in IMG/M |
| 3300020165|Ga0206125_10013580 | Not Available | 5416 | Open in IMG/M |
| 3300020169|Ga0206127_1032694 | All Organisms → Viruses → Predicted Viral | 2951 | Open in IMG/M |
| 3300020247|Ga0211654_1001426 | All Organisms → Viruses → Predicted Viral | 4350 | Open in IMG/M |
| 3300020312|Ga0211542_1013457 | All Organisms → Viruses → Predicted Viral | 1868 | Open in IMG/M |
| 3300020347|Ga0211504_1062992 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium TMED198 | 866 | Open in IMG/M |
| 3300020377|Ga0211647_10098989 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium TMED198 | 1004 | Open in IMG/M |
| 3300020378|Ga0211527_10043368 | All Organisms → Viruses → Predicted Viral | 1432 | Open in IMG/M |
| 3300020379|Ga0211652_10058394 | All Organisms → Viruses → Predicted Viral | 1157 | Open in IMG/M |
| 3300020404|Ga0211659_10089253 | All Organisms → Viruses → Predicted Viral | 1429 | Open in IMG/M |
| 3300020405|Ga0211496_10079516 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium TMED198 | 1187 | Open in IMG/M |
| 3300020408|Ga0211651_10071309 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium TMED198 | 1482 | Open in IMG/M |
| 3300020414|Ga0211523_10073778 | All Organisms → Viruses → Predicted Viral | 1452 | Open in IMG/M |
| 3300020421|Ga0211653_10069881 | All Organisms → Viruses → Predicted Viral | 1574 | Open in IMG/M |
| 3300020436|Ga0211708_10217165 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium TMED198 | 770 | Open in IMG/M |
| 3300020445|Ga0211564_10387148 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium TMED198 | 687 | Open in IMG/M |
| 3300020449|Ga0211642_10510893 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 515 | Open in IMG/M |
| 3300020451|Ga0211473_10101985 | All Organisms → Viruses → Predicted Viral | 1466 | Open in IMG/M |
| 3300020457|Ga0211643_10235607 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED8 | 899 | Open in IMG/M |
| 3300020462|Ga0211546_10492066 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED8 | 618 | Open in IMG/M |
| 3300020462|Ga0211546_10574593 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium TMED198 | 568 | Open in IMG/M |
| 3300020470|Ga0211543_10610908 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED8 | 511 | Open in IMG/M |
| 3300020474|Ga0211547_10344031 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium TMED198 | 754 | Open in IMG/M |
| 3300021368|Ga0213860_10424207 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium TMED198 | 574 | Open in IMG/M |
| 3300021375|Ga0213869_10292648 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium TMED198 | 697 | Open in IMG/M |
| 3300024346|Ga0244775_10099744 | All Organisms → Viruses → Predicted Viral | 2470 | Open in IMG/M |
| 3300025071|Ga0207896_1068422 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium TMED198 | 556 | Open in IMG/M |
| 3300025084|Ga0208298_1074948 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium TMED198 | 634 | Open in IMG/M |
| 3300025096|Ga0208011_1018100 | All Organisms → Viruses → Predicted Viral | 1841 | Open in IMG/M |
| 3300025097|Ga0208010_1129414 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium TMED198 | 503 | Open in IMG/M |
| 3300025112|Ga0209349_1072456 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium TMED198 | 1027 | Open in IMG/M |
| 3300025132|Ga0209232_1028691 | All Organisms → Viruses → Predicted Viral | 2140 | Open in IMG/M |
| 3300025133|Ga0208299_1078711 | All Organisms → Viruses → Predicted Viral | 1163 | Open in IMG/M |
| 3300025133|Ga0208299_1104146 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED8 | 954 | Open in IMG/M |
| 3300025151|Ga0209645_1024845 | All Organisms → Viruses → Predicted Viral | 2250 | Open in IMG/M |
| 3300025751|Ga0208150_1039440 | Not Available | 1634 | Open in IMG/M |
| 3300026257|Ga0208407_1113310 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium TMED198 | 847 | Open in IMG/M |
| 3300026257|Ga0208407_1127577 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium TMED198 | 786 | Open in IMG/M |
| 3300026260|Ga0208408_1117523 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED8 | 771 | Open in IMG/M |
| 3300026321|Ga0208764_10093027 | All Organisms → Viruses → Predicted Viral | 1565 | Open in IMG/M |
| 3300027779|Ga0209709_10207307 | Not Available | 906 | Open in IMG/M |
| 3300027859|Ga0209503_10058475 | Not Available | 1767 | Open in IMG/M |
| 3300028192|Ga0257107_1097989 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED8 | 877 | Open in IMG/M |
| 3300029319|Ga0183748_1012595 | All Organisms → Viruses → Predicted Viral | 3390 | Open in IMG/M |
| 3300029448|Ga0183755_1006384 | All Organisms → cellular organisms → Bacteria | 5266 | Open in IMG/M |
| 3300031851|Ga0315320_10628624 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED8 | 701 | Open in IMG/M |
| 3300032032|Ga0315327_10170866 | All Organisms → Viruses → Predicted Viral | 1360 | Open in IMG/M |
| 3300032073|Ga0315315_10199772 | All Organisms → Viruses → Predicted Viral | 1866 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 44.53% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 16.79% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 16.06% |
| Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 2.92% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 2.92% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 2.19% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 2.19% |
| Deep Ocean | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean | 1.46% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine | 1.46% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 1.46% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 1.46% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 1.46% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 0.73% |
| Marine Water | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine Water | 0.73% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.73% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.73% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 0.73% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 0.73% |
| Deep Subsurface | Environmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface | 0.73% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000115 | Marine microbial communities from Delaware Coast, sample from Delaware MO Summer July 2011 | Environmental | Open in IMG/M |
| 3300000117 | Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010 | Environmental | Open in IMG/M |
| 3300000168 | Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - June 2009 P12 10m | Environmental | Open in IMG/M |
| 3300001450 | Marine viral communities from the Pacific Ocean - LP-53 | Environmental | Open in IMG/M |
| 3300002483 | Marine viral communities from the Pacific Ocean - ETNP_6_30 | Environmental | Open in IMG/M |
| 3300002488 | Marine viral communities from the Pacific Ocean - ETNP_2_60 | Environmental | Open in IMG/M |
| 3300002514 | Marine viral communities from the Pacific Ocean - ETNP_6_85 | Environmental | Open in IMG/M |
| 3300005057 | Marine water microbial communities from the East Sea, Korea with extracellular vesicles - East-Sea-0.2um | Environmental | Open in IMG/M |
| 3300005430 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV69 | Environmental | Open in IMG/M |
| 3300005523 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F12-01SV265 | Environmental | Open in IMG/M |
| 3300005934 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S23_td_SurfaceB_ad_5m_LV_B | Environmental | Open in IMG/M |
| 3300006166 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302SV91 | Environmental | Open in IMG/M |
| 3300006190 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG058-DNA | Environmental | Open in IMG/M |
| 3300006565 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT231_2_0125m | Environmental | Open in IMG/M |
| 3300006735 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG | Environmental | Open in IMG/M |
| 3300006737 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG | Environmental | Open in IMG/M |
| 3300006738 | Marine viral communities from the Subarctic Pacific Ocean - 3_ETSP_OMZ_AT15126 metaG | Environmental | Open in IMG/M |
| 3300006749 | Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaG | Environmental | Open in IMG/M |
| 3300006751 | Marine viral communities from the Subarctic Pacific Ocean - 7_ETSP_OMZ_AT15161 metaG | Environmental | Open in IMG/M |
| 3300006752 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG | Environmental | Open in IMG/M |
| 3300006753 | Marine viral communities from the Subarctic Pacific Ocean - 6_ETSP_OMZ_AT15160 metaG | Environmental | Open in IMG/M |
| 3300006754 | Marine viral communities from the Subarctic Pacific Ocean - 10_ETSP_OMZ_AT15264 metaG | Environmental | Open in IMG/M |
| 3300006789 | Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG | Environmental | Open in IMG/M |
| 3300006793 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006868 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006916 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 | Environmental | Open in IMG/M |
| 3300006922 | Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaG | Environmental | Open in IMG/M |
| 3300006923 | Marine viral communities from the Subarctic Pacific Ocean - 15B_ETSP_OMZ_AT15312_CsCl metaG | Environmental | Open in IMG/M |
| 3300006929 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG | Environmental | Open in IMG/M |
| 3300007543 | Estuarine microbial communities from the Columbia River estuary - metaG 1370B-3 | Environmental | Open in IMG/M |
| 3300007963 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (version 2) | Environmental | Open in IMG/M |
| 3300008050 | Marine viral communities from the Subarctic Pacific Ocean - 15_ETSP_OMZ_AT15312 metaG | Environmental | Open in IMG/M |
| 3300009071 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405 | Environmental | Open in IMG/M |
| 3300009172 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154 | Environmental | Open in IMG/M |
| 3300009418 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s17 | Environmental | Open in IMG/M |
| 3300009420 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152 | Environmental | Open in IMG/M |
| 3300009428 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_55 | Environmental | Open in IMG/M |
| 3300009481 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV12_ACTIVE470 metaG | Environmental | Open in IMG/M |
| 3300009550 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - South Atlantic ANT15 Metagenome | Environmental | Open in IMG/M |
| 3300009593 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 Metagenome | Environmental | Open in IMG/M |
| 3300009790 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT10 Metagenome | Environmental | Open in IMG/M |
| 3300010151 | Marine viral communities from the Subarctic Pacific Ocean - 22_ETSP_OMZ_AT15343 metaG | Environmental | Open in IMG/M |
| 3300011252 | Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2014_4, permeate | Environmental | Open in IMG/M |
| 3300012920 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St8 metaG | Environmental | Open in IMG/M |
| 3300012928 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St17 metaG | Environmental | Open in IMG/M |
| 3300012954 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St18 metaG | Environmental | Open in IMG/M |
| 3300017702 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_10 viral metaG | Environmental | Open in IMG/M |
| 3300017705 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_08 viral metaG | Environmental | Open in IMG/M |
| 3300017706 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_13 viral metaG | Environmental | Open in IMG/M |
| 3300017708 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_04 viral metaG | Environmental | Open in IMG/M |
| 3300017709 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 10 SPOT_SRF_2010-04-27 | Environmental | Open in IMG/M |
| 3300017729 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 19 SPOT_SRF_2011-01-11 | Environmental | Open in IMG/M |
| 3300017731 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 39 SPOT_SRF_2013-01-16 | Environmental | Open in IMG/M |
| 3300017741 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 44 SPOT_SRF_2013-06-19 | Environmental | Open in IMG/M |
| 3300017757 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 43 SPOT_SRF_2013-05-22 | Environmental | Open in IMG/M |
| 3300017770 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15 (version 2) | Environmental | Open in IMG/M |
| 3300017772 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 53 SPOT_SRF_2014-04-10 | Environmental | Open in IMG/M |
| 3300017775 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 55 SPOT_SRF_2014-07-17 | Environmental | Open in IMG/M |
| 3300017952 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071405CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017962 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071404AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300020165 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160331_1 | Environmental | Open in IMG/M |
| 3300020169 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160419_1 | Environmental | Open in IMG/M |
| 3300020247 | Marine microbial communities from Tara Oceans - TARA_B100000902 (ERX556048-ERR598962) | Environmental | Open in IMG/M |
| 3300020312 | Marine microbial communities from Tara Oceans - TARA_B100000287 (ERX556125-ERR598977) | Environmental | Open in IMG/M |
| 3300020347 | Marine microbial communities from Tara Oceans - TARA_B100000497 (ERX556109-ERR598994) | Environmental | Open in IMG/M |
| 3300020377 | Marine microbial communities from Tara Oceans - TARA_B100000927 (ERX556007-ERR599065) | Environmental | Open in IMG/M |
| 3300020378 | Marine microbial communities from Tara Oceans - TARA_B100000066 (ERX556006-ERR599102) | Environmental | Open in IMG/M |
| 3300020379 | Marine microbial communities from Tara Oceans - TARA_B100000902 (ERX556001-ERR599168) | Environmental | Open in IMG/M |
| 3300020404 | Marine microbial communities from Tara Oceans - TARA_B100000900 (ERX555954-ERR598978) | Environmental | Open in IMG/M |
| 3300020405 | Marine microbial communities from Tara Oceans - TARA_B000000532 (ERX556129-ERR599012) | Environmental | Open in IMG/M |
| 3300020408 | Marine microbial communities from Tara Oceans - TARA_B100000925 (ERX555963-ERR599118) | Environmental | Open in IMG/M |
| 3300020414 | Marine microbial communities from Tara Oceans - TARA_B100000035 (ERX556019-ERR599028) | Environmental | Open in IMG/M |
| 3300020421 | Marine microbial communities from Tara Oceans - TARA_B100000902 (ERX556005-ERR599007) | Environmental | Open in IMG/M |
| 3300020436 | Marine microbial communities from Tara Oceans - TARA_B100000424 (ERX556009-ERR598984) | Environmental | Open in IMG/M |
| 3300020445 | Marine microbial communities from Tara Oceans - TARA_B100001996 (ERX555961-ERR599087) | Environmental | Open in IMG/M |
| 3300020449 | Marine microbial communities from Tara Oceans - TARA_B100001079 (ERX556008-ERR599020) | Environmental | Open in IMG/M |
| 3300020451 | Marine microbial communities from Tara Oceans - TARA_B100001778 (ERX555927-ERR598996) | Environmental | Open in IMG/M |
| 3300020457 | Marine microbial communities from Tara Oceans - TARA_B100001113 (ERX555941-ERR599014) | Environmental | Open in IMG/M |
| 3300020462 | Marine microbial communities from Tara Oceans - TARA_B100001559 (ERX556040-ERR598986) | Environmental | Open in IMG/M |
| 3300020470 | Marine microbial communities from Tara Oceans - TARA_B100000287 (ERX555976-ERR599053) | Environmental | Open in IMG/M |
| 3300020474 | Marine prokaryotic communities collected during Tara Oceans survey from station TARA_151 - TARA_B100001564 (ERX555957-ERR598976) | Environmental | Open in IMG/M |
| 3300021368 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO550 | Environmental | Open in IMG/M |
| 3300021375 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO132 | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300025071 | Marine viral communities from the Pacific Ocean - LP-36 (SPAdes) | Environmental | Open in IMG/M |
| 3300025084 | Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025096 | Marine viral communities from the Subarctic Pacific Ocean - 7_ETSP_OMZ_AT15161 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025097 | Marine viral communities from the Subarctic Pacific Ocean - 2_ETSP_OMZ_AT15125 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025112 | Marine viral communities from the Pacific Ocean - ETNP_2_130 (SPAdes) | Environmental | Open in IMG/M |
| 3300025132 | Marine viral communities from the Pacific Ocean - ETNP_2_60 (SPAdes) | Environmental | Open in IMG/M |
| 3300025133 | Marine viral communities from the Subarctic Pacific Ocean - 15_ETSP_OMZ_AT15312 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025151 | Marine viral communities from the Pacific Ocean - ETNP_6_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300025751 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300026257 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV69 (SPAdes) | Environmental | Open in IMG/M |
| 3300026260 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV67 (SPAdes) | Environmental | Open in IMG/M |
| 3300026321 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302SV91 (SPAdes) | Environmental | Open in IMG/M |
| 3300027779 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_136 (SPAdes) | Environmental | Open in IMG/M |
| 3300027859 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - South Atlantic ANT15 Metagenome (SPAdes) | Environmental | Open in IMG/M |
| 3300028192 | Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2011_P26_500m | Environmental | Open in IMG/M |
| 3300029319 | Marine viral communities collected during Tara Oceans survey from station TARA_032 - TARA_A100001516 | Environmental | Open in IMG/M |
| 3300029448 | Marine viral communities collected during Tara Oceans survey from station TARA_023 - TARA_E500000082 | Environmental | Open in IMG/M |
| 3300031851 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 21515 | Environmental | Open in IMG/M |
| 3300032032 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 32315 | Environmental | Open in IMG/M |
| 3300032073 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 3416 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSum2011_100647525 | 3300000115 | Marine | MKNLSHEEQITLILIGIAIGIGIGFVLKAFLDTYYLLQNL* |
| DelMOSum2011_100721345 | 3300000115 | Marine | MKNLSHEEQITLILIGIAIGIGIGFVLKVFVDSYIIIERLPL* |
| DelMOWin2010_100113207 | 3300000117 | Marine | MKNLSNEEQITLILIGIAIGIGLGFLIKVFIDTHILLQNF* |
| LPjun09P1210mDRAFT_10048524 | 3300000168 | Marine | MKNLSHEEQITLILIGIAIGVGIGFVLKVFVDSYIII |
| JGI24006J15134_100434882 | 3300001450 | Marine | MKNLSSEEQITLILIGIAIGVAIGFVLKTFVDTYYLLGSLP* |
| JGI25132J35274_10088963 | 3300002483 | Marine | MKNLSNEEQITLILIGIAIGXGXGFLIKVFIXTHILLQNI* |
| JGI25128J35275_10403694 | 3300002488 | Marine | MKNLSNEEQITLILIGIAIGIGVGFLIKVFIDTHILLQNF* |
| JGI25133J35611_101371952 | 3300002514 | Marine | MKNLSSEEQITXIVIGIAIGVAVGFVLKTFVDTYYLVGSLP* |
| Ga0068511_11064741 | 3300005057 | Marine Water | MKNLSNEEQVTLILIGIAIGIGIGFLIKVFIDTHILLQNI* |
| Ga0066849_100840152 | 3300005430 | Marine | MKNLSSEEQITLIVIGIAIGVAVGFVLKTFVDTYYLVGSLP* |
| Ga0066849_101309773 | 3300005430 | Marine | MKNLSHEEQITLIVIGIAIGIAIGFVLKTFVDTYYLVGSLPL* |
| Ga0066849_104071132 | 3300005430 | Marine | MKNLSHEEQITLIVIGIAIGIAIGFVLKTFVDTYYLLGSLPL* |
| Ga0066865_100521483 | 3300005523 | Marine | EEQITLIVIGIAIGIAVGFVLKTFIDTYYLIGSLPL*LEN* |
| Ga0066377_100207585 | 3300005934 | Marine | MKNLSNEEQITLILIGIAIGIGIGFLIKVFVDTHILLQNF* |
| Ga0066836_102123664 | 3300006166 | Marine | MKNLSSEEQITLIVIGIAIGIAIGFVLKTFVDTYYLVGSLP* |
| Ga0075446_100519373 | 3300006190 | Marine | MSNQEEMISYILIGVAIGIAIGFLLKVFVDTYKLVESLPI* |
| Ga0100228_11852932 | 3300006565 | Marine | MKNLSHEEQITLILIGIAIGIGIGFVLKTFVDTYYLVGSLPL* |
| Ga0098038_10273842 | 3300006735 | Marine | MKNLSHEEQITLILIGIAIGIGIGFILKTFVDTYYLVGSLP* |
| Ga0098038_11471612 | 3300006735 | Marine | MKNLSHEEQITLILIGIAIGIGIGFVLKVFLDTYYLLQNL* |
| Ga0098038_12545123 | 3300006735 | Marine | MKNLSNEEQITLIVIGIAIGIAVGFVLKTFIDTYYLLGSLPL* |
| Ga0098037_10803422 | 3300006737 | Marine | MKNLSHEEQITLILIGIAIGIGIGFILKTFVDTYYLVGSLP** |
| Ga0098035_11429623 | 3300006738 | Marine | MKQMNSEEQITLIVIGIAIGIAIGFVLKTFVDTYYLIGSLP* |
| Ga0098042_10513821 | 3300006749 | Marine | EQITLILIGIAIGIGIGFILKTFVDTYYLVGSLP** |
| Ga0098040_10296742 | 3300006751 | Marine | MKNLSHEEQITLIVIGIAIGVAVGFVLKTFVDTYYLVGSLPL* |
| Ga0098048_12323942 | 3300006752 | Marine | MKNLSNEEQITLILIGIAIGIGVGFLIKVFIDTHILLQNI* |
| Ga0098039_10143361 | 3300006753 | Marine | SEEQITLIVIGIAIGVAIGFVLKAIVDTYDLVRSLPI** |
| Ga0098044_11178264 | 3300006754 | Marine | MKQMNSEEQITLIVIGIAIGIAIGFVLKTFVDTYYLI |
| Ga0098044_11837291 | 3300006754 | Marine | KLSMKQMNSEEQITLIVIGIAIGIAIGFVLKTFVDTYYLIGSLP* |
| Ga0098044_11937972 | 3300006754 | Marine | MKQMNSEEEITLIVIGIAIGIAIGFVLKAVVDTYDLVRSLPI* |
| Ga0098054_11115003 | 3300006789 | Marine | MKNLSSEEQITLIVIGIAIGVAVGFVLKTFVDTYYLVGSLP** |
| Ga0098054_11673253 | 3300006789 | Marine | MKNLSHEEQITLILIGIAIGIGIGFILKVFLDTYYLLQNL* |
| Ga0098054_13259362 | 3300006789 | Marine | MKQLNSEEQITLIVIGIAIGVAIGFVLKAVVDTYDLVRSLPI* |
| Ga0098055_11119293 | 3300006793 | Marine | MKNLSHEEQVALILIGIAIGIGIGFVLKVFLDTYYLLQNL* |
| Ga0070749_103851742 | 3300006802 | Aqueous | MKNLSNEEQITLILIGIAIGIGIGFLIKVFIDTHILLQNF* |
| Ga0075481_103474552 | 3300006868 | Aqueous | NMKNLSNEEQITLILIGIAIGIGIGFLIKVFIDTHILLQNF* |
| Ga0070750_102781662 | 3300006916 | Aqueous | LNMKNLSHEEQITLILIGIAIGIGIGFVLKVFVDSYIIIERLPL* |
| Ga0098045_10103772 | 3300006922 | Marine | MKNLSHEEQITLILIGIAIGIGIGFVLKSFVDTYYLLQNL* |
| Ga0098053_10333852 | 3300006923 | Marine | MKNLSSEEQITLIVIGIAIGVAVGFVLKTFVDTYYLLGSLPL*LEN* |
| Ga0098036_10647341 | 3300006929 | Marine | MKQMNSEEQITLIVIGIAIGVAVGFVLKTFVDTYYLVGSLP** |
| Ga0098036_11109632 | 3300006929 | Marine | MKNLSHEEQITLILIGIAIGIGIGFVLKTFVDTYYLLGSLPL* |
| Ga0098036_12827842 | 3300006929 | Marine | MKNLSHEEQITLILIGIAIGIAIGFVLKTFVDTYYLVGSLPL* |
| Ga0102853_10819542 | 3300007543 | Estuarine | MKNLSHEEQITLILICIAIGIGIGFVLKVFLDTYYLLQNL* |
| Ga0110931_12066091 | 3300007963 | Marine | MKNLSHEEQITLILIGIAIGIGIGFVLKSFVDTYY |
| Ga0098052_13319012 | 3300008050 | Marine | MNKITDNEDMISYILIGIAIGIAIGFVLKAVVDTYDLVRSLPI* |
| Ga0115566_100712402 | 3300009071 | Pelagic Marine | MKNLSHEEQVTLILIGIAIGIGIGFVLKVFLDTYYLLQNL* |
| Ga0114995_105531312 | 3300009172 | Marine | MKNLNHEEQITLILIGIAIGIGIGFVLKVFVDTYIIIQGLPV* |
| Ga0114908_11763262 | 3300009418 | Deep Ocean | MKQEEIIEYICIGIAIGIAIGFVLKAIIDTYDLVWSLPL* |
| Ga0114994_101043805 | 3300009420 | Marine | MKNLNHEEQITLILIGIAIGIGIGFVSKVFLDSYVIIQGLPA* |
| Ga0114915_11074222 | 3300009428 | Deep Ocean | MKNLSHEEQITLILIGIAIGIGIGFVLKVFVDSYIIIEGLPL* |
| Ga0114932_107550572 | 3300009481 | Deep Subsurface | MKQLDSEEQITLIVIGIAIGIAIGFVLKAVVDTYDLVRSLPI* |
| Ga0115013_108811831 | 3300009550 | Marine | MKNLSHEEQITLVVIGIAIGIAIGFVLKTFVDTYYLVGSLPL* |
| Ga0115011_101189583 | 3300009593 | Marine | MKNLSSEEQITLVVIGIAIGIAIGFVLKTFVDTYYLVGSLPL* |
| Ga0115011_114224372 | 3300009593 | Marine | MRNLSHEEQITLIVIGIAIGIAVGFVLKTFIDTYYLLGSLPL* |
| Ga0115012_108441442 | 3300009790 | Marine | MKNLSNEEQITLILIGIAIGIGIGFLIKVFIDTHILLQNI* |
| Ga0115012_116324212 | 3300009790 | Marine | MKNLSHEEQITLILIGIAIGIGIGFVLKTFVDTYYLIGSLPL* |
| Ga0098061_10530172 | 3300010151 | Marine | MNSEEQITLIVIGIAIGIAIGFVLKTFVDTYYLIGSLP* |
| Ga0151674_10834671 | 3300011252 | Marine | MKNLSHEEQITLILIGIAIGIAIGFVLKTFVDTYYLLGSLPL* |
| Ga0160423_106489602 | 3300012920 | Surface Seawater | MKNLNSEEQITLILIGIAIGIGIGFLIKVFIDTHILLQNF* |
| Ga0163110_102301203 | 3300012928 | Surface Seawater | MKNLSHEEQITLILIGIAIGIGIGFILKTFVDTYYLLGSLPL* |
| Ga0163110_102966983 | 3300012928 | Surface Seawater | MKNLSHEEQITLILIGIAIGIGIGFILKTFVDTYYLIGSLPQ* |
| Ga0163111_111330442 | 3300012954 | Surface Seawater | MRNLSHEEQITLIVIGIAIGIAVGFVLKTFIDTYYLVGSLPL* |
| Ga0181374_10645442 | 3300017702 | Marine | MNSEEQITLIVIGIAIGIAIGFVLKTFVDTYDLVRSLPI |
| Ga0181372_10217612 | 3300017705 | Marine | MKQLDSEEQITLIVIGIAIGIAIGFVLKTFVDTYYLIGSLP |
| Ga0181372_10310873 | 3300017705 | Marine | MKNLSHEEQITLILIGIAIGIAIGFVLKTFVDTYYLVGSLPL |
| Ga0181377_10730531 | 3300017706 | Marine | LSHEEQITLILIGIAIGIGIGFVLKVFLDTYYLLQNL |
| Ga0181369_10606003 | 3300017708 | Marine | MKNLSNEEQITLILIGIAIGIGVGFLIKVFIDTHILLQNI |
| Ga0181387_10105673 | 3300017709 | Seawater | MKNLSSEEQITLILIGITIGIAIGFVLKAFVDTYYLVGSLP |
| Ga0181387_10334201 | 3300017709 | Seawater | MKNLSHEEQITLILICIAIGIGIGFVLKVFLDTYYLLQNL |
| Ga0181396_11180162 | 3300017729 | Seawater | MKNLSHDEQITLIVIGIAIGIAIGFVLKTFVDTYYLVGSLP |
| Ga0181416_11085242 | 3300017731 | Seawater | MKNLSHEEQITLILIGIAIGVGIGFVLKVFVDSYIIIERLPL |
| Ga0181421_10748142 | 3300017741 | Seawater | MKNLSHDEQITLIVIGIAIGIAIGFVLKTFVDTYYLVGSLPX |
| Ga0181420_10313491 | 3300017757 | Seawater | MNSEEQITLIVIGIAIGIAIGFVLKVIVDTYDLVGSLPI |
| Ga0181420_10340971 | 3300017757 | Seawater | LNMKNLSHDEQITLIVIGIAIGIAIGFVLKVYIDTYILIEGLPL |
| Ga0181420_11569273 | 3300017757 | Seawater | MKNLSHDEQITLIVIGIAIGIAIGFVLKTFVDTYYLVGSLPL |
| Ga0187217_12154131 | 3300017770 | Seawater | MKNLSSEEQITLILIGITIGIAIGFVLKAFVDTYYL |
| Ga0181430_10970184 | 3300017772 | Seawater | MKNLSHEEQITLILIGIAIGIGIGFILKVFLDTYYLLQNL |
| Ga0181432_10174015 | 3300017775 | Seawater | MNNMNQHETMISYILVGIAIGIAIGFLLKVFVDTYNLVESLPI |
| Ga0181432_10255412 | 3300017775 | Seawater | MNKITDHEDMITYIIIGIAIGIAIGFVLKAFVDTYIILGNFPI |
| Ga0181432_10346066 | 3300017775 | Seawater | MKQEEIIEYICIGIAIGIAIGFVLKAIIDTYDLVWSLPI |
| Ga0181432_10578052 | 3300017775 | Seawater | MSNMSQHEDMITYIIIGIAIGIAIGFVLKAFVDTYIILGNFPI |
| Ga0181432_10893543 | 3300017775 | Seawater | MNKITDNEDMISYILIGIAIGIAIGFVLKAFVDTYDLVRSFPI |
| Ga0181432_11016722 | 3300017775 | Seawater | MSNMNQHEDMISYILIGVAIGIAIGFLLKVFVDTYNLVESLPI |
| Ga0181432_11267491 | 3300017775 | Seawater | ISMNKITDNEDMISYILIGVAIGIAIGFVLKAFVDTYDIVRSFPI |
| Ga0181432_11560163 | 3300017775 | Seawater | MKHEEIIEYITIGIAIGIAIGFVLKAIIDTYDLVWSLPI |
| Ga0181432_12166852 | 3300017775 | Seawater | MKQEEKIEYIVIGIAIGIAIGFVLKVIIDTYNIVGSLPI |
| Ga0181432_12719512 | 3300017775 | Seawater | MLGRRMMPNEEKVEYIVIGIAIGIAIGFVLKAILDTYDLVWSLPIX |
| Ga0181432_12881372 | 3300017775 | Seawater | MNKITDNEDMISYILIGVAIGIAIGFVLKAIVDTYDLVRSLPI |
| Ga0181432_12958002 | 3300017775 | Seawater | MNKITDNEDMISYILIGVAIGIAIGFVLKAVVDTYDLVRSLPI |
| Ga0181583_106477151 | 3300017952 | Salt Marsh | MKNLSNEEQITLILIGIAIGIGIGFLIKVFIDTHILLQNF |
| Ga0181581_106679232 | 3300017962 | Salt Marsh | MKNLSNEEQITLILIGIAIGIGLGFLIKVFIDTHILLQNF |
| Ga0206125_100135804 | 3300020165 | Seawater | MKNLSHEEQITLILIGIAIGIGIGFVLKVFVDSYIIIERLPL |
| Ga0206127_10326943 | 3300020169 | Seawater | MKNLSSEEQITLILIGIAIGIGIGFVLKVFVDSYIIIERLPL |
| Ga0211654_100142612 | 3300020247 | Marine | MKNLSHEEQITLILIGIAIGIGIGFVLKVFLDTYYLLQNL |
| Ga0211542_10134574 | 3300020312 | Marine | MKNLSHEEQITLILIGIAIGIGIGFVLKTFVDTYYLVGSLPL |
| Ga0211504_10629922 | 3300020347 | Marine | MKNLSHEEQVTLILIGIAIGIGIGFVLKAFLDTYYLLQNL |
| Ga0211647_100989893 | 3300020377 | Marine | MKNLSHEEQITLILIGIAIGIGIGFVLKTFVDTYYLVGSLP |
| Ga0211527_100433682 | 3300020378 | Marine | EQITLILIGIAIGIGIGFVLKTFVDTYYLVGSLPLXLKNX |
| Ga0211652_100583941 | 3300020379 | Marine | QITLIVIGIAIGIAVGFVLKTFIDTYYLLGSLPLXLEN |
| Ga0211659_100892532 | 3300020404 | Marine | MKNLSNEEQITLIVIGIAIGIAVGFVLKTFIDTYYLLGSLPL |
| Ga0211496_100795164 | 3300020405 | Marine | MKNLSHEEQITLILIGIAIGIGIGFILKTFVDTYYLIGS |
| Ga0211651_100713092 | 3300020408 | Marine | MKNLSNEEQITLILIGIAIGIGIGFLIKVFIDTHILLQNI |
| Ga0211523_100737785 | 3300020414 | Marine | MKNLSNEEQITLILIGIAIGIGIGFLIKVFIDTHILLQN |
| Ga0211653_100698813 | 3300020421 | Marine | MKNLSNEEQITLIVIGIAIGIAVGFVLKTFIDTYYLLGSLPLXLKN |
| Ga0211708_102171653 | 3300020436 | Marine | MKNLNSEEQITLILIGIAIGIGIGFLIKAFIDTHILLQNF |
| Ga0211564_103871482 | 3300020445 | Marine | MKNLSSEEQITLIVIGIAIGIAIGFVLKTFVDTYYLIGSLPL |
| Ga0211642_105108932 | 3300020449 | Marine | MNKITDNEDMISYILIGIAIGIAIGFVLKAIVDTYDLVRSLPI |
| Ga0211473_101019853 | 3300020451 | Marine | MKNLSHEEQITLILIGIAIGIAIGFVLKTFVDTYYLLGSLPL |
| Ga0211643_102356073 | 3300020457 | Marine | MKNLSHEEQITLILIGIAIGIGIGFILKTFVDTYYLVGSLP |
| Ga0211546_104920661 | 3300020462 | Marine | MKNLSSEEQITLILIGIAIGIAIGFVLKTFVDTYYLLGSLPL |
| Ga0211546_105745933 | 3300020462 | Marine | MKNLSHEEQITLILIGIAIGIGIGFVLKTFVDTYYLV |
| Ga0211543_106109081 | 3300020470 | Marine | LSHEEQITLILIGIAIGIGIGFVLKTFVDTYYLVGSLPLXLKNX |
| Ga0211547_103440313 | 3300020474 | Marine | MKNLSSEEQITLILIGIAIGVAIGFVLKTFVDTYYLVGSLPL |
| Ga0213860_104242073 | 3300021368 | Seawater | MKNLSSEEQITLILIGIAIGIVIGFVLKTFVDTYYLIGSLPL |
| Ga0213869_102926483 | 3300021375 | Seawater | MKNLSHEEQITLILIGIAIGIGIGFVLKAFLDTYYLLQNL |
| Ga0244775_100997447 | 3300024346 | Estuarine | MKNLSHEEQITLILIGIAIGVGIGFVLKVFVDSYIIIEGLPL |
| Ga0207896_10684222 | 3300025071 | Marine | MKNLSSEEQITLILIGIAIGVAIGFVLKTFVDTYYLLGSLP |
| Ga0208298_10749482 | 3300025084 | Marine | MKNLSHEEQITLILIGIAIGIAIGFVLKTFIDTYYLLGSLPL |
| Ga0208011_10181004 | 3300025096 | Marine | MKQMNSEEQITLIVIGIAIGIAIGFVLKTFVDTYYLIGSLP |
| Ga0208010_11294143 | 3300025097 | Marine | MKQMNSEEQITLIVIGIAIGIAIGFVLKAVVDTYDLVRSLPI |
| Ga0209349_10724563 | 3300025112 | Marine | MKQMNSEEQITLIVIGIAIGIAIGFVLKVIVDTYDLVRSLPI |
| Ga0209232_10286916 | 3300025132 | Marine | MKNLSSEEQITLVVIGIAIGIAIGFVLKTFVDTYYLVGSLPL |
| Ga0208299_10787113 | 3300025133 | Marine | MNSEEEITLIVIGIAIGIAIGFVLKAVVDTYDLVRSLPI |
| Ga0208299_11041461 | 3300025133 | Marine | MKNLSSEEQITLIVIGIAIGVAVGFVLKTFVDTYYLVGSLPX |
| Ga0209645_10248452 | 3300025151 | Marine | MRNLSHEEQITLIVIGIAIGIAVGFVLKTFIDTYYLLGSLPL |
| Ga0208150_10394401 | 3300025751 | Aqueous | RLNMKNLSNEEQITLILIGIAIGIGIGFLIKVFIDTHILLQNF |
| Ga0208407_11133102 | 3300026257 | Marine | MKNLSHEEQITLIVIGIAIGIAIGFVLKTFVDTYYLVGSLPL |
| Ga0208407_11275772 | 3300026257 | Marine | MKNLSSEEQITLIVIGIAIGVAVGFVLKTFVDTYYLVGSLP |
| Ga0208408_11175232 | 3300026260 | Marine | MKNLSHEEQITLIVIGIAIGIAIGFVLKTFVDTYYLVGSLPLXLEN |
| Ga0208764_100930275 | 3300026321 | Marine | MKNLSSEEQITLIVIGIAIGIAIGFVLKTFVDTYYLVGSLP |
| Ga0209709_102073073 | 3300027779 | Marine | MKNLNHEEQITLILIGIAIGIGIGFVSKVFLDSYVIIQGLPA |
| Ga0209503_100584751 | 3300027859 | Marine | MKNLSHEEQITLILIGIAIGIGIGFVLKTFLDTYYLLQNL |
| Ga0257107_10979891 | 3300028192 | Marine | MSNMNQHEDMITSILIGVGIGIGIGFVLKVFIDTYI |
| Ga0183748_10125957 | 3300029319 | Marine | MKNLSHEEQITLILIGIAIGIGIGFILKTFVDTYYLVGSLPL |
| Ga0183755_100638411 | 3300029448 | Marine | MKNLSHEEQITLILIGIAIGIGVGFVLKVFLDTYTMIEGLPL |
| Ga0315320_106286242 | 3300031851 | Seawater | EEQITLILIGIAIGVAIGFVLKTFVDTYYLVGSLPX |
| Ga0315327_101708661 | 3300032032 | Seawater | SMKNLSHDEQITLIVIGIAIGIAIGFVLKTFVDTYYLVGSLPX |
| Ga0315315_101997722 | 3300032073 | Seawater | MKNLSHEEQITLILIGIAIGIGIGFVLKTFVDTYYLIGSLPL |
| ⦗Top⦘ |