


| Basic Information | |
|---|---|
| Family ID | F056732 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 137 |
| Average Sequence Length | 40 residues |
| Representative Sequence | MFESIVCFGLHIRHPRVHVPAFPDSYLPGVNSITESRTVYL |
| Number of Associated Samples | 97 |
| Number of Associated Scaffolds | 137 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 62.77 % |
| % of genes near scaffold ends (potentially truncated) | 79.56 % |
| % of genes from short scaffolds (< 2000 bps) | 86.86 % |
| Associated GOLD sequencing projects | 90 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.15 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (57.664 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere (24.088 % of family members) |
| Environment Ontology (ENVO) | Unclassified (24.088 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (52.555 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 10.14% β-sheet: 0.00% Coil/Unstructured: 89.86% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.15 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 137 Family Scaffolds |
|---|---|---|
| PF01548 | DEDD_Tnp_IS110 | 24.82 |
| PF02371 | Transposase_20 | 13.87 |
| PF04392 | ABC_sub_bind | 1.46 |
| PF14362 | DUF4407 | 1.46 |
| PF13565 | HTH_32 | 1.46 |
| PF01609 | DDE_Tnp_1 | 1.46 |
| PF11746 | DUF3303 | 0.73 |
| PF00795 | CN_hydrolase | 0.73 |
| PF00583 | Acetyltransf_1 | 0.73 |
| PF13592 | HTH_33 | 0.73 |
| PF11578 | DUF3237 | 0.73 |
| PF00383 | dCMP_cyt_deam_1 | 0.73 |
| PF02771 | Acyl-CoA_dh_N | 0.73 |
| PF06042 | NTP_transf_6 | 0.73 |
| PF14319 | Zn_Tnp_IS91 | 0.73 |
| PF00872 | Transposase_mut | 0.73 |
| PF03069 | FmdA_AmdA | 0.73 |
| PF01408 | GFO_IDH_MocA | 0.73 |
| PF09707 | Cas_Cas2CT1978 | 0.73 |
| PF13808 | DDE_Tnp_1_assoc | 0.73 |
| PF13613 | HTH_Tnp_4 | 0.73 |
| PF13546 | DDE_5 | 0.73 |
| PF13650 | Asp_protease_2 | 0.73 |
| PF02452 | PemK_toxin | 0.73 |
| PF02518 | HATPase_c | 0.73 |
| PF09339 | HTH_IclR | 0.73 |
| PF13924 | Lipocalin_5 | 0.73 |
| PF05685 | Uma2 | 0.73 |
| PF03061 | 4HBT | 0.73 |
| COG ID | Name | Functional Category | % Frequency in 137 Family Scaffolds |
|---|---|---|---|
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 38.69 |
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 1.46 |
| COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 1.46 |
| COG3293 | Transposase | Mobilome: prophages, transposons [X] | 1.46 |
| COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 1.46 |
| COG5421 | Transposase | Mobilome: prophages, transposons [X] | 1.46 |
| COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 1.46 |
| COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 1.46 |
| COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 0.73 |
| COG2337 | mRNA-degrading endonuclease MazF, toxin component of the MazEF toxin-antitoxin module | Defense mechanisms [V] | 0.73 |
| COG2421 | Acetamidase/formamidase | Energy production and conversion [C] | 0.73 |
| COG3328 | Transposase (or an inactivated derivative) | Mobilome: prophages, transposons [X] | 0.73 |
| COG3575 | Uncharacterized conserved protein | Function unknown [S] | 0.73 |
| COG4636 | Endonuclease, Uma2 family (restriction endonuclease fold) | General function prediction only [R] | 0.73 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 57.66 % |
| Unclassified | root | N/A | 42.34 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000041|ARcpr5oldR_c002669 | Not Available | 1630 | Open in IMG/M |
| 3300000858|JGI10213J12805_11043415 | Not Available | 1444 | Open in IMG/M |
| 3300000955|JGI1027J12803_107963252 | Not Available | 1805 | Open in IMG/M |
| 3300000956|JGI10216J12902_100517127 | Not Available | 1074 | Open in IMG/M |
| 3300000956|JGI10216J12902_107933290 | Not Available | 1677 | Open in IMG/M |
| 3300003911|JGI25405J52794_10160959 | Not Available | 513 | Open in IMG/M |
| 3300004267|Ga0066396_10105327 | Not Available | 526 | Open in IMG/M |
| 3300005289|Ga0065704_10095880 | Not Available | 2468 | Open in IMG/M |
| 3300005295|Ga0065707_10129626 | Not Available | 1943 | Open in IMG/M |
| 3300005332|Ga0066388_100416439 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1988 | Open in IMG/M |
| 3300005332|Ga0066388_101274430 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 1264 | Open in IMG/M |
| 3300005332|Ga0066388_102100043 | Not Available | 1016 | Open in IMG/M |
| 3300005332|Ga0066388_102608828 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 920 | Open in IMG/M |
| 3300005343|Ga0070687_101435508 | Not Available | 517 | Open in IMG/M |
| 3300005445|Ga0070708_100096655 | Not Available | 2698 | Open in IMG/M |
| 3300005467|Ga0070706_100075612 | All Organisms → cellular organisms → Bacteria | 3117 | Open in IMG/M |
| 3300005471|Ga0070698_100081609 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3227 | Open in IMG/M |
| 3300005552|Ga0066701_10952951 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 508 | Open in IMG/M |
| 3300005554|Ga0066661_10461820 | Not Available | 774 | Open in IMG/M |
| 3300005568|Ga0066703_10808680 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 536 | Open in IMG/M |
| 3300005586|Ga0066691_10038912 | All Organisms → cellular organisms → Bacteria | 2499 | Open in IMG/M |
| 3300005617|Ga0068859_100785243 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Thiocystis → Thiocystis violacea | 1040 | Open in IMG/M |
| 3300005764|Ga0066903_100310581 | All Organisms → cellular organisms → Bacteria | 2506 | Open in IMG/M |
| 3300005764|Ga0066903_100324459 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 2462 | Open in IMG/M |
| 3300005764|Ga0066903_101072553 | Not Available | 1482 | Open in IMG/M |
| 3300005764|Ga0066903_102005969 | All Organisms → cellular organisms → Bacteria | 1111 | Open in IMG/M |
| 3300005764|Ga0066903_102294558 | Not Available | 1042 | Open in IMG/M |
| 3300005764|Ga0066903_102495772 | Not Available | 1001 | Open in IMG/M |
| 3300005764|Ga0066903_102793018 | All Organisms → cellular organisms → Bacteria | 947 | Open in IMG/M |
| 3300005764|Ga0066903_102935514 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 924 | Open in IMG/M |
| 3300005764|Ga0066903_107295080 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
| 3300006049|Ga0075417_10241079 | Not Available | 865 | Open in IMG/M |
| 3300006058|Ga0075432_10064587 | Not Available | 1307 | Open in IMG/M |
| 3300006194|Ga0075427_10045156 | All Organisms → cellular organisms → Bacteria | 749 | Open in IMG/M |
| 3300006194|Ga0075427_10071202 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 620 | Open in IMG/M |
| 3300006196|Ga0075422_10041780 | All Organisms → cellular organisms → Bacteria | 1634 | Open in IMG/M |
| 3300006196|Ga0075422_10121724 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1020 | Open in IMG/M |
| 3300006844|Ga0075428_100357749 | Not Available | 1566 | Open in IMG/M |
| 3300006844|Ga0075428_100689269 | Not Available | 1088 | Open in IMG/M |
| 3300006844|Ga0075428_102001030 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
| 3300006845|Ga0075421_100450485 | All Organisms → cellular organisms → Bacteria | 1538 | Open in IMG/M |
| 3300006845|Ga0075421_100455880 | All Organisms → cellular organisms → Bacteria | 1527 | Open in IMG/M |
| 3300006845|Ga0075421_102749016 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 508 | Open in IMG/M |
| 3300006846|Ga0075430_100438845 | Not Available | 1078 | Open in IMG/M |
| 3300006846|Ga0075430_100691305 | Not Available | 841 | Open in IMG/M |
| 3300006847|Ga0075431_100253177 | All Organisms → cellular organisms → Bacteria | 1789 | Open in IMG/M |
| 3300006853|Ga0075420_100163135 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1953 | Open in IMG/M |
| 3300006853|Ga0075420_100393981 | Not Available | 1198 | Open in IMG/M |
| 3300006854|Ga0075425_102541210 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 567 | Open in IMG/M |
| 3300006904|Ga0075424_100796538 | Not Available | 1008 | Open in IMG/M |
| 3300006904|Ga0075424_100994169 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → unclassified Nitrospiraceae → Nitrospiraceae bacterium | 894 | Open in IMG/M |
| 3300006904|Ga0075424_102736741 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 514 | Open in IMG/M |
| 3300006969|Ga0075419_10381875 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 962 | Open in IMG/M |
| 3300006969|Ga0075419_10756431 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 693 | Open in IMG/M |
| 3300007004|Ga0079218_10648633 | Not Available | 977 | Open in IMG/M |
| 3300007076|Ga0075435_100138464 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2040 | Open in IMG/M |
| 3300007255|Ga0099791_10170037 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella gemina | 1023 | Open in IMG/M |
| 3300009038|Ga0099829_10733674 | Not Available | 821 | Open in IMG/M |
| 3300009081|Ga0105098_10010574 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 3395 | Open in IMG/M |
| 3300009088|Ga0099830_10107522 | All Organisms → cellular organisms → Bacteria | 2092 | Open in IMG/M |
| 3300009089|Ga0099828_11341421 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 632 | Open in IMG/M |
| 3300009090|Ga0099827_11180569 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | 665 | Open in IMG/M |
| 3300009090|Ga0099827_11869941 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 523 | Open in IMG/M |
| 3300009094|Ga0111539_12773672 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 568 | Open in IMG/M |
| 3300009100|Ga0075418_10181966 | All Organisms → cellular organisms → Bacteria | 2238 | Open in IMG/M |
| 3300009100|Ga0075418_11066733 | Not Available | 875 | Open in IMG/M |
| 3300009100|Ga0075418_12063835 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 621 | Open in IMG/M |
| 3300009147|Ga0114129_10414664 | Not Available | 1773 | Open in IMG/M |
| 3300009147|Ga0114129_11438687 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochloraceae → Prochloron → Prochloron didemni | 849 | Open in IMG/M |
| 3300009156|Ga0111538_10655201 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1331 | Open in IMG/M |
| 3300009157|Ga0105092_10089164 | Not Available | 1684 | Open in IMG/M |
| 3300009691|Ga0114944_1059126 | Not Available | 1415 | Open in IMG/M |
| 3300009819|Ga0105087_1057738 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
| 3300010046|Ga0126384_10378326 | Not Available | 1189 | Open in IMG/M |
| 3300010047|Ga0126382_10990681 | Not Available | 736 | Open in IMG/M |
| 3300010359|Ga0126376_11105779 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → unclassified Planctomycetales → Planctomycetales bacterium | 801 | Open in IMG/M |
| 3300010359|Ga0126376_12275829 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 588 | Open in IMG/M |
| 3300010359|Ga0126376_13211730 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 506 | Open in IMG/M |
| 3300010360|Ga0126372_11561514 | All Organisms → cellular organisms → Bacteria | 698 | Open in IMG/M |
| 3300010360|Ga0126372_11960035 | Not Available | 632 | Open in IMG/M |
| 3300010362|Ga0126377_13448495 | Not Available | 511 | Open in IMG/M |
| 3300010366|Ga0126379_10658597 | Not Available | 1138 | Open in IMG/M |
| 3300010376|Ga0126381_104970715 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
| 3300010398|Ga0126383_10227134 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1813 | Open in IMG/M |
| 3300011270|Ga0137391_10396642 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | 1180 | Open in IMG/M |
| 3300012189|Ga0137388_10654151 | Not Available | 976 | Open in IMG/M |
| 3300012202|Ga0137363_10987853 | Not Available | 715 | Open in IMG/M |
| 3300012209|Ga0137379_10863395 | Not Available | 809 | Open in IMG/M |
| 3300012353|Ga0137367_10032086 | All Organisms → cellular organisms → Bacteria | 4049 | Open in IMG/M |
| 3300012358|Ga0137368_10052436 | All Organisms → cellular organisms → Bacteria | 3447 | Open in IMG/M |
| 3300012358|Ga0137368_10595862 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Pseudanabaenales → Leptolyngbyaceae → Phormidesmis → Phormidesmis priestleyi | 702 | Open in IMG/M |
| 3300012361|Ga0137360_10203733 | Not Available | 1603 | Open in IMG/M |
| 3300012401|Ga0134055_1079468 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 542 | Open in IMG/M |
| 3300012481|Ga0157320_1001590 | Not Available | 1173 | Open in IMG/M |
| 3300012917|Ga0137395_10112290 | Not Available | 1825 | Open in IMG/M |
| 3300012925|Ga0137419_10133962 | Not Available | 1768 | Open in IMG/M |
| 3300012925|Ga0137419_10140016 | Not Available | 1734 | Open in IMG/M |
| 3300012930|Ga0137407_10687190 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Neisseriales → Neisseriaceae → Crenobacter → Crenobacter cavernae | 963 | Open in IMG/M |
| 3300012930|Ga0137407_11055768 | All Organisms → cellular organisms → Bacteria | 770 | Open in IMG/M |
| 3300012948|Ga0126375_11409090 | Not Available | 591 | Open in IMG/M |
| 3300012948|Ga0126375_11568332 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 566 | Open in IMG/M |
| 3300012948|Ga0126375_11721459 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 544 | Open in IMG/M |
| 3300012948|Ga0126375_11793427 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 535 | Open in IMG/M |
| 3300013306|Ga0163162_10415821 | Not Available | 1477 | Open in IMG/M |
| 3300015371|Ga0132258_10036682 | All Organisms → cellular organisms → Bacteria | 11055 | Open in IMG/M |
| 3300015371|Ga0132258_10797505 | All Organisms → cellular organisms → Bacteria | 2381 | Open in IMG/M |
| 3300015371|Ga0132258_11045705 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Stahlbacteria → unclassified Candidatus Stahlbacteria → Candidatus Stahlbacteria bacterium | 2064 | Open in IMG/M |
| 3300015373|Ga0132257_100216663 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 2275 | Open in IMG/M |
| 3300019233|Ga0184645_1151449 | Not Available | 701 | Open in IMG/M |
| 3300020018|Ga0193721_1100496 | Not Available | 741 | Open in IMG/M |
| 3300021086|Ga0179596_10250846 | Not Available | 874 | Open in IMG/M |
| 3300025910|Ga0207684_11292747 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 601 | Open in IMG/M |
| 3300026035|Ga0207703_10878788 | All Organisms → cellular organisms → Bacteria | 858 | Open in IMG/M |
| 3300026326|Ga0209801_1259698 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 648 | Open in IMG/M |
| 3300027873|Ga0209814_10455068 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 565 | Open in IMG/M |
| 3300027874|Ga0209465_10068796 | Not Available | 1714 | Open in IMG/M |
| 3300027874|Ga0209465_10570528 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 562 | Open in IMG/M |
| 3300027875|Ga0209283_10238964 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1205 | Open in IMG/M |
| 3300027875|Ga0209283_10605636 | Not Available | 694 | Open in IMG/M |
| 3300027907|Ga0207428_10242595 | All Organisms → cellular organisms → Bacteria | 1346 | Open in IMG/M |
| 3300028587|Ga0247828_10348309 | Not Available | 835 | Open in IMG/M |
| 3300028878|Ga0307278_10060133 | Not Available | 1715 | Open in IMG/M |
| 3300030006|Ga0299907_11022387 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella palauensis | 606 | Open in IMG/M |
| 3300031094|Ga0308199_1044693 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Nitrospinae → unclassified Nitrospinota → Nitrospinae bacterium RIFCSPLOWO2_12_FULL_45_22 | 847 | Open in IMG/M |
| 3300031573|Ga0310915_10100220 | Not Available | 1956 | Open in IMG/M |
| 3300031740|Ga0307468_101632813 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 604 | Open in IMG/M |
| 3300031744|Ga0306918_10269296 | Not Available | 1305 | Open in IMG/M |
| 3300031892|Ga0310893_10402905 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 599 | Open in IMG/M |
| 3300031901|Ga0307406_11312763 | Not Available | 632 | Open in IMG/M |
| 3300031908|Ga0310900_10450443 | Not Available | 989 | Open in IMG/M |
| 3300031945|Ga0310913_11218037 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → unclassified Chthoniobacterales → Chthoniobacterales bacterium | 524 | Open in IMG/M |
| 3300032002|Ga0307416_101607027 | Not Available | 755 | Open in IMG/M |
| 3300032075|Ga0310890_11192816 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 619 | Open in IMG/M |
| 3300032180|Ga0307471_102917394 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 607 | Open in IMG/M |
| 3300032211|Ga0310896_10049262 | Not Available | 1693 | Open in IMG/M |
| 3300034668|Ga0314793_002367 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2101 | Open in IMG/M |
| 3300034678|Ga0314803_014602 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1098 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 24.09% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 16.06% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 11.68% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 10.95% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 6.57% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 5.11% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 3.65% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.92% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.92% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 1.46% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.46% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.46% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.46% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.46% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.73% |
| Thermal Springs | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Thermal Springs | 0.73% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.73% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.73% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.73% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.73% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.73% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.73% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.73% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.73% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.73% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.73% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000041 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere | Host-Associated | Open in IMG/M |
| 3300000858 | Soil microbial communities from Great Prairies - Wisconsin Native Prairie soil | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300004267 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 6 MoBio | Environmental | Open in IMG/M |
| 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 | Host-Associated | Open in IMG/M |
| 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006058 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Host-Associated | Open in IMG/M |
| 3300006194 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Host-Associated | Open in IMG/M |
| 3300006196 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 | Host-Associated | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009081 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009157 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
| 3300009691 | Hot spring microbial communities from Beatty, Nevada to study Microbial Dark Matter (Phase II) - OV2 TP2 | Environmental | Open in IMG/M |
| 3300009819 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_40_50 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012401 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_16_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012481 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 | Host-Associated | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300019233 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020018 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2s2 | Environmental | Open in IMG/M |
| 3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes) | Environmental | Open in IMG/M |
| 3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028587 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3 | Environmental | Open in IMG/M |
| 3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
| 3300030006 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67 | Environmental | Open in IMG/M |
| 3300031094 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_203 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031892 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D2 | Environmental | Open in IMG/M |
| 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Host-Associated | Open in IMG/M |
| 3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
| 3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032211 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1 | Environmental | Open in IMG/M |
| 3300034668 | Metatranscriptome of lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0R1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034678 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48R4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| ARcpr5oldR_0026692 | 3300000041 | Arabidopsis Rhizosphere | MLESIACYGLHMRPPRVHVPAFPDSYLPGVNSITESRTVYL* |
| JGI10213J12805_110434151 | 3300000858 | Soil | MFVSIACYGLHIRPPWVHVPAFPDSYLPGVCIITEAGLYTY |
| JGI1027J12803_1079632521 | 3300000955 | Soil | MFESIMGFGLPMRTPRVPVPACPDSYLPGVDSTTES |
| JGI10216J12902_1005171272 | 3300000956 | Soil | MFESIVCFGLHIRPLRVHVPAFPDSYLPGVHSITE |
| JGI10216J12902_1079332902 | 3300000956 | Soil | MLESIMCLGMQTRNPRVHVPAFTDSYLPVVFSITESRTVYL* |
| JGI25405J52794_101609591 | 3300003911 | Tabebuia Heterophylla Rhizosphere | MLESIRCFGMDTRTLRVHVPALTESYLLAVFSITESSTVYL* |
| Ga0066396_101053271 | 3300004267 | Tropical Forest Soil | MFVSLAGYAVDIRPLRVHVPAFPDSYLSGVDSITESRTVYL* |
| Ga0065704_100958803 | 3300005289 | Switchgrass Rhizosphere | MLESIVCFGVHTRTPQVHVPAFPDSYLPGVDSITESRTLYL* |
| Ga0065707_101296261 | 3300005295 | Switchgrass Rhizosphere | MLESIVCFGVHTRTPQVHVPAFPDSYLPGVDSITESRTL* |
| Ga0066388_1004164392 | 3300005332 | Tropical Forest Soil | MLESIMCFGLHIRTPRVHVPAFPDSYLPGVDSITESRTVYL* |
| Ga0066388_1012744301 | 3300005332 | Tropical Forest Soil | RTWGVENMLESIVCFGLHTRTPQVHVPAFPDSYLPGVDSITESRTLYL* |
| Ga0066388_1021000431 | 3300005332 | Tropical Forest Soil | MLVSITCFGVHTRTPRVHVPAFPDSYLPGVHSITEAGLITY |
| Ga0066388_1026088281 | 3300005332 | Tropical Forest Soil | VSITCFGVHTRTPRVHVPAFPDSYLPGVHSITESRTNYL* |
| Ga0070687_1014355081 | 3300005343 | Switchgrass Rhizosphere | MLESIVCFGLHIRHPRVHVPAFPDSSLPSVNSITESRTVYL* |
| Ga0070708_1000966553 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MFVSLTGYAVDIRPLRVHVPAFPDSYLPGVYSITESRTVYL* |
| Ga0070706_1000756124 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MLESIACFGLHTRNPQVHVPAFPDSYLPGVYSITESRTLYL* |
| Ga0070698_1000816093 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MFESIVCFGVHMRHPRVHVPAFPDSYLPGVLSITESRTVYL* |
| Ga0066701_109529512 | 3300005552 | Soil | MFVSIACYGLDIRHPRVHVPAFPVSYLPGVDSITESRTVYL* |
| Ga0066661_104618202 | 3300005554 | Soil | MFESIVCFGLHIRHPRVHVPAFPDSYLPGVNSITESRTVYL* |
| Ga0066703_108086802 | 3300005568 | Soil | MFVSIACYGLDIRHPRVHVPAFPDSYLPGVNSITESRTVYL* |
| Ga0066691_100389122 | 3300005586 | Soil | MFVSLTGYAVDIRPLRVHIPAFPDSYLSGVFSITESRTVYL* |
| Ga0068859_1007852434 | 3300005617 | Switchgrass Rhizosphere | CFALHIRHPQVHVPAFPDSYLSGVHSITESRTVYL* |
| Ga0066903_1003105811 | 3300005764 | Tropical Forest Soil | ESIACFGLHTRNPRVHVPAFPDSYLPGVYSITESRALYL* |
| Ga0066903_1003244592 | 3300005764 | Tropical Forest Soil | MLESIACFGLHTRNPRVHVPAFPDSYLPGVYSITESRALYL* |
| Ga0066903_1010725532 | 3300005764 | Tropical Forest Soil | MLESRRCFGLHMRHPQGHVPAFPDSYLPGVLSITESRTVYL* |
| Ga0066903_1020059693 | 3300005764 | Tropical Forest Soil | MFVSLTGYAVDIRPLRVHVPAFPDSYLPGVCIITESRTVYL* |
| Ga0066903_1022945581 | 3300005764 | Tropical Forest Soil | ERIGCFGLHMRHPRVHVPAFPDSSLPGVHSITESRTVYL* |
| Ga0066903_1024957722 | 3300005764 | Tropical Forest Soil | MFVSIACYGLHIRPSWVHVPAFPDSYLPGVDSITESRT |
| Ga0066903_1027930183 | 3300005764 | Tropical Forest Soil | MFESIVCFGLDTRTLRVHVPAVPDSYLSGVHSITESRIVYL* |
| Ga0066903_1029355142 | 3300005764 | Tropical Forest Soil | ENMFESIACFGLHARTPRVHVPAFPDSYLPGVDRITESRTLYL* |
| Ga0066903_1072950801 | 3300005764 | Tropical Forest Soil | SIVCFGLHIRHPRVHVPAFPDSYLPSVNSITESRTVYL* |
| Ga0075417_102410792 | 3300006049 | Populus Rhizosphere | MFVSIACYSLHIRPPWVHVPAFPDSYLPGVDSITESRTL |
| Ga0075432_100645871 | 3300006058 | Populus Rhizosphere | VFKSVMCFALHIRHPQVHVPAFPDSYLPGVHSITESRT |
| Ga0075427_100451562 | 3300006194 | Populus Rhizosphere | MLESIACYGLHIRPPRVHVPAFPDSYLPGVNSITESRT |
| Ga0075427_100712022 | 3300006194 | Populus Rhizosphere | MLESIVCLGLHTRTPQVHVPAFPDSYLPGVDSITESRT |
| Ga0075422_100417801 | 3300006196 | Populus Rhizosphere | QCESLGCCGWHIRPPRVQVPACPDRYLPGVDRITESRTIYLLL* |
| Ga0075422_101217242 | 3300006196 | Populus Rhizosphere | MFVSLAGYAVDIRPLRVHGPAVTGSYLPAVESTTENRTVYL* |
| Ga0075428_1003577491 | 3300006844 | Populus Rhizosphere | MFESIRCCGLHIRTPRVHVPAFPDSYLPGVYSTTESR |
| Ga0075428_1006892691 | 3300006844 | Populus Rhizosphere | MFVSIACFGVHIRTPRVHVPAFPDSYLPGVHSITESRTL |
| Ga0075428_1020010301 | 3300006844 | Populus Rhizosphere | MFVSLTGYAVDIRPLRVHVPAFPDSYLSGVFSITESRTVYL |
| Ga0075421_1004504851 | 3300006845 | Populus Rhizosphere | ESIACFGLHIRHPRVHVPAFSDSYLPGVHSITESRTVYL* |
| Ga0075421_1004558803 | 3300006845 | Populus Rhizosphere | MFVSIVCFGLHMRHPQVHVPAFPDSYLPGGHSIPESRTIYL* |
| Ga0075421_1027490162 | 3300006845 | Populus Rhizosphere | MLESVMCFSLPIRHPRVHVPAFPDSYLPGVNSITE |
| Ga0075430_1004388451 | 3300006846 | Populus Rhizosphere | MLESIVCFGVHTRTPQVHGPAFPDSYLPGVDSITEAGLFTY |
| Ga0075430_1006913052 | 3300006846 | Populus Rhizosphere | MFVSLSGYAVDIHPLRVHVPAFAESYLPAVNSITESRTEYL* |
| Ga0075431_1002531772 | 3300006847 | Populus Rhizosphere | FVSLAGYAVDIRPLRVHVPAFPDSYLPGVYSITESRTEYL* |
| Ga0075420_1001631351 | 3300006853 | Populus Rhizosphere | MLVSIACFGVHTRTPRVHVPAFPDSYLPGVHSITESRTLYL |
| Ga0075420_1003939811 | 3300006853 | Populus Rhizosphere | MFVSLAGYALDMRHPRVQVPACADSYPPGVNSITESRTV |
| Ga0075425_1025412101 | 3300006854 | Populus Rhizosphere | MFVSIACFGLHIRTPQVHVPAFPDSYLPGVDSITESRT |
| Ga0075424_1007965382 | 3300006904 | Populus Rhizosphere | MLESVMCFGLHIRHPRVHVPAFPDSYLPGVHSITESR |
| Ga0075424_1009941692 | 3300006904 | Populus Rhizosphere | IACCGLHMRHPRVHGPAVPGSYLPAVESTTENRTVYL* |
| Ga0075424_1027367412 | 3300006904 | Populus Rhizosphere | MLVSIACFGVHTRTPRVHVPAFPDSYLPGVHSITESRT |
| Ga0075419_103818751 | 3300006969 | Populus Rhizosphere | MLESIGCFGLHTRTPQVHVPAFPDSYLPGVDSITESRTLY |
| Ga0075419_107564312 | 3300006969 | Populus Rhizosphere | GVENMLESIVCFGLHTRTPQVHGPAFPDSYLPGVDSITESRTLYL* |
| Ga0079218_106486331 | 3300007004 | Agricultural Soil | KSIVCSPLVIRHPRAHGPAFTGSYLPAVISITESRTVYLYPHWR* |
| Ga0075435_1001384641 | 3300007076 | Populus Rhizosphere | MFESIACFGLHIRHPRVHVPAFSDSYLPGVHSITESRTLY |
| Ga0099791_101700373 | 3300007255 | Vadose Zone Soil | FVRIVCFGLPMRHPQVHVPAFPDSYLPGVHSITESRTLYL* |
| Ga0099829_107336742 | 3300009038 | Vadose Zone Soil | CYGLDIRHPRVHVPAFPVSYLPGVDSITESRTVYL* |
| Ga0105098_100105745 | 3300009081 | Freshwater Sediment | MLASILCLGMDTRTPRVHVPAVTGSYLPAVLNITESRTVYL* |
| Ga0099830_101075224 | 3300009088 | Vadose Zone Soil | MLESIVCFGVHTRTPRVHVPAFPDSYLPGVDSITESRTVYL* |
| Ga0099828_113414212 | 3300009089 | Vadose Zone Soil | MFGSITCFGVHTRTPRVHVPAFPDSYLPGVHSITESRTNYL |
| Ga0099827_111805692 | 3300009090 | Vadose Zone Soil | MRFGLHIRTPRVHVPAFPDSYLPGVCIITESRTVY |
| Ga0099827_118699412 | 3300009090 | Vadose Zone Soil | MFESVMGFGLHIRHPQGHVPAFPDSYLPGVCIITESR |
| Ga0111539_127736722 | 3300009094 | Populus Rhizosphere | MFVSLVGHAVDIRPLRVHVPAFPDSYLSGVFSITESRT |
| Ga0075418_101819663 | 3300009100 | Populus Rhizosphere | MFVSIRCFGLHIRHPQVHVPAFPDSYLPGVHSITESR |
| Ga0075418_110667332 | 3300009100 | Populus Rhizosphere | FVSLAGSAVDIRPLRVHVPAFTGSDLPAVLSVTESRTVYL* |
| Ga0075418_120638352 | 3300009100 | Populus Rhizosphere | MFVSIACYSLHIRPPWVHVPAFPDSYLPGVDSITESRTVYL |
| Ga0114129_104146643 | 3300009147 | Populus Rhizosphere | MFESIACFGVHIRHPRVHVPAFSDSYLPGVHSITESR |
| Ga0114129_114386873 | 3300009147 | Populus Rhizosphere | TCGGEAMFVSIVCFGLHMRHPQVHVPAFPDSYLPGGHSIPESRTIYL* |
| Ga0111538_106552011 | 3300009156 | Populus Rhizosphere | PRTCGVEDMFVSIACFGLHMRTPQVHVPAFPDSYLPGVDSITESRTLYL* |
| Ga0105092_100891644 | 3300009157 | Freshwater Sediment | MLASILCLGMDTRTPRVHVPDVTGSYLLAVLNITESRTVYL* |
| Ga0114944_10591261 | 3300009691 | Thermal Springs | MFVSIACYGLHIRPPWVHVPAFPDSYLPGVDSITESRTVYL |
| Ga0105087_10577381 | 3300009819 | Groundwater Sand | MFVSLGGYAVDIRPLRVHVPAFPESYLPGVYSITESRT |
| Ga0126384_103783261 | 3300010046 | Tropical Forest Soil | MFESIVCCGVHIRHPRVHVPAFPDSYLSGGYSITESRT |
| Ga0126382_109906811 | 3300010047 | Tropical Forest Soil | MLASIVCFGVHTRTPRVHVPAFPDSYLPGVDSITESRT |
| Ga0126376_111057791 | 3300010359 | Tropical Forest Soil | MLESIVCFGLHTRTPQVHVPAFPDSYLPGVDRITESRTLYL* |
| Ga0126376_122758292 | 3300010359 | Tropical Forest Soil | MFESIVFFGLDTRTLRVHVPAFPDSYLQGVHSITESR |
| Ga0126376_132117302 | 3300010359 | Tropical Forest Soil | MFESITCLRVHARTPRVHVPTFPDSYLPGVYSITESR |
| Ga0126372_115615141 | 3300010360 | Tropical Forest Soil | NMLESIVCFGLHTRTPQVHVPAFPDSYLPGVHSITESRTLYL* |
| Ga0126372_119600352 | 3300010360 | Tropical Forest Soil | PRTCGVENMLESIMCFGVHARTPRVHDPAFPDSYLPGVDSITESRTLYL* |
| Ga0126377_134484951 | 3300010362 | Tropical Forest Soil | MCASIACFGLPIRHPRVHVPAFSDSYLPGMNSITESRT |
| Ga0126379_106585973 | 3300010366 | Tropical Forest Soil | ESIVCFGLHIRHPRVHVPAFPYSYLPGVYSITESRTVYL* |
| Ga0126381_1049707152 | 3300010376 | Tropical Forest Soil | MFVSLMGYAVDIRPLRVPVPVFLDSYLPGGYSITESRTVYL |
| Ga0126383_102271344 | 3300010398 | Tropical Forest Soil | NMFESIACFGLHTRPLRVHVPAFPDSDLPGVYSITESRTEYL* |
| Ga0137391_103966422 | 3300011270 | Vadose Zone Soil | FVSIACYGLDIRHPRVHVPAFPVSYLPGVDSITESRTVYL* |
| Ga0137388_106541511 | 3300012189 | Vadose Zone Soil | MLESVMRFGLHIRTPRVHVPAFPDSYLPGVCIITESRTVY |
| Ga0137363_109878532 | 3300012202 | Vadose Zone Soil | MFVSITCFGVHTRTPRVHVPAFPDSYLPGVDSITE |
| Ga0137379_108633951 | 3300012209 | Vadose Zone Soil | MFESIMGFGLPMRTPRVHVPAFPDSYLLGVCIITESRT |
| Ga0137367_100320864 | 3300012353 | Vadose Zone Soil | MCESLVCFGVPLRHPRVHVPAFPASSLPGVTVIITESRTVYL* |
| Ga0137368_100524366 | 3300012358 | Vadose Zone Soil | FESVMCFGLHIRTPRVHVPAFPDSYLPDVNSITESRTLYL* |
| Ga0137368_105958621 | 3300012358 | Vadose Zone Soil | SLVCFGVPLRHPRVHVPAFPASSLPGVTVMITESRTVYL* |
| Ga0137360_102037332 | 3300012361 | Vadose Zone Soil | MFESGMCFGVHIRHPRVHVPAFPDSYLPGVDSITESR |
| Ga0134055_10794682 | 3300012401 | Grasslands Soil | MFESIRCFGLHIRPPRVPVPAFPDSYLPGVDSITE |
| Ga0157320_10015902 | 3300012481 | Arabidopsis Rhizosphere | MFVSIVGFGLPMRHPQVPVPAFPDRSLPGVHSITESRTVYL* |
| Ga0137395_101122901 | 3300012917 | Vadose Zone Soil | MFESVMCFGVHIRHPRVHVPAFPDSYLPGVDSITESRT |
| Ga0137419_101339622 | 3300012925 | Vadose Zone Soil | MFVSITCFGVHTRTPRVHVPAFPDSYLPGVHSITESR |
| Ga0137419_101400162 | 3300012925 | Vadose Zone Soil | CFGLPIRHPRVHVPAFPDSYLTGVDSITESRTLYL* |
| Ga0137407_106871901 | 3300012930 | Vadose Zone Soil | TCGVEDMLVSIACFGVHIRTPRVHVPAFPDSYLPGVDSITESRTLYL* |
| Ga0137407_110557682 | 3300012930 | Vadose Zone Soil | VMCFGLHIRTPRVHVPAFPDSYLPDVNSITESRTLYL* |
| Ga0126375_114090901 | 3300012948 | Tropical Forest Soil | MLESLRCFGLHIRTPRVHVPAFPDSYLPGVCIITESRT |
| Ga0126375_115683321 | 3300012948 | Tropical Forest Soil | MCVSIAGDGWHMRPPWVHVPAFPGSSLPGMDSITAS |
| Ga0126375_117214591 | 3300012948 | Tropical Forest Soil | MFVSIRCFGVHSRHPQVHVPAFPDSYLPGVDSLTESRTLY |
| Ga0126375_117934272 | 3300012948 | Tropical Forest Soil | MFESIACCGVHIRHPRVHVPAFSGSYLPGVHSITESR |
| Ga0163162_104158211 | 3300013306 | Switchgrass Rhizosphere | MFVSLVGYAVDIRPLRVHVPAFPDSYLPSVNSITE |
| Ga0132258_1003668213 | 3300015371 | Arabidopsis Rhizosphere | MFVSLVGSAVDIRPLRVHVPAFPDSFLPGVYSITESRTVYL* |
| Ga0132258_107975053 | 3300015371 | Arabidopsis Rhizosphere | VSIVGFGLPMRHPQVPVPAFPDRSLPGVHSITESRTVYL* |
| Ga0132258_110457055 | 3300015371 | Arabidopsis Rhizosphere | FVSIVGFGLPMRHPQVPVPAFPDRSLPGVHSITESRTVYL* |
| Ga0132257_1002166634 | 3300015373 | Arabidopsis Rhizosphere | VGFGLPMRHPQVPVPAFPDRSLPGVHSITESRTVYL* |
| Ga0184645_11514491 | 3300019233 | Groundwater Sediment | HKRTRGFEDMLESILCCGLDIRNLRVHVPALTESYLSAVFSITESRTVYL |
| Ga0193721_11004961 | 3300020018 | Soil | MFVSIACYGLDIRHPRVHVPAFPDSYLPGVNSITES |
| Ga0179596_102508462 | 3300021086 | Vadose Zone Soil | MLESIMCFGVHTRTPRVHVPAFPDSYLPGVDSITESRTLYL |
| Ga0207684_112927472 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MFVSIACYGLDIRHPRVHVPAFPVSYLPGVNSITES |
| Ga0207703_108787881 | 3300026035 | Switchgrass Rhizosphere | IVCFGLHIRHPRVHVPAFPDSSLPSVNSITESRTVYL |
| Ga0209801_12596981 | 3300026326 | Soil | MFVSLTGYAVDIRPLRVHIPAFPDSYLSGVFSITESRTVYL |
| Ga0209814_104550681 | 3300027873 | Populus Rhizosphere | MFVSIACFGLHMRTPQVHVPAFPDSYLPGVDSITESRTLY |
| Ga0209465_100687961 | 3300027874 | Tropical Forest Soil | MFESITCFGLHTRTPRVHVPAFPDSYLPGVDSITES |
| Ga0209465_105705281 | 3300027874 | Tropical Forest Soil | MLESILCFGLHIRNPRVHVPAFPDSYLPGVDSITESRT |
| Ga0209283_102389643 | 3300027875 | Vadose Zone Soil | MFGSITCFGVHTRTPRVHVPAFPDSYLPGVHSITESRTNYLTR |
| Ga0209283_106056362 | 3300027875 | Vadose Zone Soil | FVSIACYGLDIRHPRVHVPAFPVSYLPGVDSITESRTVYL |
| Ga0207428_102425953 | 3300027907 | Populus Rhizosphere | EDMCVSIRCFGLHIRHPQVHVPAFPDSYLPGVHSITESRTLYL |
| Ga0247828_103483091 | 3300028587 | Soil | MFVSLAGYAVDIRPLRVHVSAFPESYLPGVDSITESR |
| Ga0307278_100601331 | 3300028878 | Soil | MFVSLACFGVHIRPLRVYVPAFPDSDLPGVDSITER |
| Ga0299907_110223871 | 3300030006 | Soil | MFVSIACYGLDIRHPRVHVPAFPVSYLPGVDSITESRTVYL |
| Ga0308199_10446932 | 3300031094 | Soil | EDMFVSIACYGLDIRHPRVHVPAFPVSYLPGVDSITESRTEYL |
| Ga0310915_101002201 | 3300031573 | Soil | MEREGVLHIRHPQVHVPAFPDSYLSGVHSITESRTVY |
| Ga0307468_1016328132 | 3300031740 | Hardwood Forest Soil | MFESVMCFGLHIRHPQVHVPAFPDSYLPGVCIITASRPVYL |
| Ga0306918_102692961 | 3300031744 | Soil | FKSVMCFALHIRHPQVHVPAFPDSYLSGVHSITESRTVYL |
| Ga0310893_104029052 | 3300031892 | Soil | MFVSLVGYAVDIRPLRVHVPAFPDSYLSGVFSITE |
| Ga0307406_113127631 | 3300031901 | Rhizosphere | LERIMCFGMQIRHPRVHVPAFTDSYLPVVFSITESRTVYL |
| Ga0310900_104504432 | 3300031908 | Soil | MFESITCLCLHARTPRVHVPAFPASYLPGVYSITESRTVYL |
| Ga0310913_112180371 | 3300031945 | Soil | VFKSVMCFALHIRHPQVHVPAFPDSYLSGVHSITESRTVYL |
| Ga0307416_1016070272 | 3300032002 | Rhizosphere | MSIVCYALEIRNPRAHVPAFTGNYLPAVFSITESRTVYLYPHWSR |
| Ga0310890_111928162 | 3300032075 | Soil | MFVSIACFGVHIRTPRVHVPAFPDSYLPGVHSITESRTVYL |
| Ga0307471_1029173941 | 3300032180 | Hardwood Forest Soil | ESIRCFGVHIRTPRVHVPAFPDSYLPGVDIITESRTLYL |
| Ga0310896_100492621 | 3300032211 | Soil | MFVSIACYGLHIRPPWVHVPAFPDSYLPGVDSITESR |
| Ga0314793_002367_50_175 | 3300034668 | Soil | MFVSLAGYAVDIRPLRVHVPAFPESYLPGVDSITENRTVYL |
| Ga0314803_014602_17_142 | 3300034678 | Soil | MFVSLAGYAVDIRPLRVHGPAVTGSYLPAVESTTENRTVYL |
| ⦗Top⦘ |