


| Basic Information | |
|---|---|
| Family ID | F056434 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 137 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MSKMSAKTRYEAFSEWHKWAQNHYKSMKKKKKARPDYMAYTENDY |
| Number of Associated Samples | 73 |
| Number of Associated Scaffolds | 137 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 1.46 % |
| % of genes near scaffold ends (potentially truncated) | 24.82 % |
| % of genes from short scaffolds (< 2000 bps) | 73.72 % |
| Associated GOLD sequencing projects | 64 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.44 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (60.584 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous (40.876 % of family members) |
| Environment Ontology (ENVO) | Unclassified (45.255 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (51.095 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 32.88% β-sheet: 0.00% Coil/Unstructured: 67.12% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.44 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 137 Family Scaffolds |
|---|---|---|
| PF01832 | Glucosaminidase | 16.79 |
| PF00294 | PfkB | 9.49 |
| PF03567 | Sulfotransfer_2 | 4.38 |
| PF00118 | Cpn60_TCP1 | 2.19 |
| PF13640 | 2OG-FeII_Oxy_3 | 2.19 |
| PF01258 | zf-dskA_traR | 1.46 |
| PF13661 | 2OG-FeII_Oxy_4 | 1.46 |
| PF05050 | Methyltransf_21 | 0.73 |
| PF00132 | Hexapep | 0.73 |
| PF00534 | Glycos_transf_1 | 0.73 |
| PF01041 | DegT_DnrJ_EryC1 | 0.73 |
| PF12705 | PDDEXK_1 | 0.73 |
| COG ID | Name | Functional Category | % Frequency in 137 Family Scaffolds |
|---|---|---|---|
| COG0459 | Chaperonin GroEL (HSP60 family) | Posttranslational modification, protein turnover, chaperones [O] | 2.19 |
| COG1734 | RNA polymerase-binding transcription factor DksA | Transcription [K] | 1.46 |
| COG0399 | dTDP-4-amino-4,6-dideoxygalactose transaminase | Cell wall/membrane/envelope biogenesis [M] | 0.73 |
| COG0436 | Aspartate/methionine/tyrosine aminotransferase | Amino acid transport and metabolism [E] | 0.73 |
| COG0520 | Selenocysteine lyase/Cysteine desulfurase | Amino acid transport and metabolism [E] | 0.73 |
| COG0626 | Cystathionine beta-lyase/cystathionine gamma-synthase | Amino acid transport and metabolism [E] | 0.73 |
| COG1104 | Cysteine desulfurase/Cysteine sulfinate desulfinase IscS or related enzyme, NifS family | Amino acid transport and metabolism [E] | 0.73 |
| COG2873 | O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependent | Amino acid transport and metabolism [E] | 0.73 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 60.58 % |
| All Organisms | root | All Organisms | 39.42 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000929|NpDRAFT_10036437 | All Organisms → cellular organisms → Bacteria | 680 | Open in IMG/M |
| 3300001934|GOS2267_101647 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 1953 | Open in IMG/M |
| 3300002835|B570J40625_100000693 | Not Available | 58555 | Open in IMG/M |
| 3300004240|Ga0007787_10604849 | Not Available | 549 | Open in IMG/M |
| 3300005077|Ga0071116_1068111 | Not Available | 2061 | Open in IMG/M |
| 3300006802|Ga0070749_10081459 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp. | 1932 | Open in IMG/M |
| 3300006802|Ga0070749_10134076 | All Organisms → cellular organisms → Bacteria | 1449 | Open in IMG/M |
| 3300006802|Ga0070749_10197089 | Not Available | 1155 | Open in IMG/M |
| 3300006802|Ga0070749_10223228 | Not Available | 1073 | Open in IMG/M |
| 3300006802|Ga0070749_10437107 | Not Available | 718 | Open in IMG/M |
| 3300006802|Ga0070749_10495811 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 666 | Open in IMG/M |
| 3300006802|Ga0070749_10511287 | Not Available | 653 | Open in IMG/M |
| 3300006802|Ga0070749_10513717 | Not Available | 652 | Open in IMG/M |
| 3300006802|Ga0070749_10557933 | Not Available | 620 | Open in IMG/M |
| 3300006802|Ga0070749_10640533 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
| 3300006802|Ga0070749_10692377 | Not Available | 545 | Open in IMG/M |
| 3300006802|Ga0070749_10785043 | Not Available | 506 | Open in IMG/M |
| 3300006919|Ga0070746_10056515 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2035 | Open in IMG/M |
| 3300006919|Ga0070746_10065622 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp. | 1863 | Open in IMG/M |
| 3300007538|Ga0099851_1000132 | Not Available | 30103 | Open in IMG/M |
| 3300007538|Ga0099851_1015947 | Not Available | 3052 | Open in IMG/M |
| 3300007538|Ga0099851_1021428 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp. | 2613 | Open in IMG/M |
| 3300007538|Ga0099851_1121353 | All Organisms → cellular organisms → Bacteria | 987 | Open in IMG/M |
| 3300007538|Ga0099851_1223849 | Not Available | 679 | Open in IMG/M |
| 3300007538|Ga0099851_1343236 | Not Available | 522 | Open in IMG/M |
| 3300007540|Ga0099847_1081395 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 997 | Open in IMG/M |
| 3300007541|Ga0099848_1004335 | All Organisms → cellular organisms → Bacteria | 6521 | Open in IMG/M |
| 3300007541|Ga0099848_1015286 | Not Available | 3324 | Open in IMG/M |
| 3300007541|Ga0099848_1072990 | Not Available | 1348 | Open in IMG/M |
| 3300007541|Ga0099848_1087647 | Not Available | 1206 | Open in IMG/M |
| 3300007541|Ga0099848_1139578 | Not Available | 903 | Open in IMG/M |
| 3300007541|Ga0099848_1283069 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
| 3300007541|Ga0099848_1291501 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300007640|Ga0070751_1176153 | Not Available | 842 | Open in IMG/M |
| 3300007960|Ga0099850_1019391 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp. | 3030 | Open in IMG/M |
| 3300007960|Ga0099850_1098157 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1211 | Open in IMG/M |
| 3300007960|Ga0099850_1260754 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 666 | Open in IMG/M |
| 3300008107|Ga0114340_1068186 | Not Available | 1505 | Open in IMG/M |
| 3300008108|Ga0114341_10108578 | Not Available | 1674 | Open in IMG/M |
| 3300008110|Ga0114343_1078450 | Not Available | 1192 | Open in IMG/M |
| 3300008116|Ga0114350_1028674 | All Organisms → cellular organisms → Bacteria | 2222 | Open in IMG/M |
| 3300008116|Ga0114350_1168342 | Not Available | 582 | Open in IMG/M |
| 3300008259|Ga0114841_1195566 | Not Available | 738 | Open in IMG/M |
| 3300008259|Ga0114841_1206948 | Not Available | 700 | Open in IMG/M |
| 3300008259|Ga0114841_1238883 | Not Available | 608 | Open in IMG/M |
| 3300008266|Ga0114363_1185245 | Not Available | 656 | Open in IMG/M |
| 3300008267|Ga0114364_1002377 | Not Available | 10707 | Open in IMG/M |
| 3300008267|Ga0114364_1005122 | All Organisms → cellular organisms → Bacteria | 6722 | Open in IMG/M |
| 3300008267|Ga0114364_1064386 | Not Available | 1258 | Open in IMG/M |
| 3300008267|Ga0114364_1108314 | Not Available | 850 | Open in IMG/M |
| 3300008267|Ga0114364_1154851 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
| 3300008448|Ga0114876_1042829 | Not Available | 2109 | Open in IMG/M |
| 3300008450|Ga0114880_1006340 | Not Available | 6133 | Open in IMG/M |
| 3300009075|Ga0105090_10263861 | Not Available | 1058 | Open in IMG/M |
| 3300009082|Ga0105099_10197194 | Not Available | 1151 | Open in IMG/M |
| 3300009149|Ga0114918_10574958 | Not Available | 597 | Open in IMG/M |
| 3300009170|Ga0105096_10352730 | Not Available | 755 | Open in IMG/M |
| 3300010318|Ga0136656_1239697 | Not Available | 599 | Open in IMG/M |
| 3300010354|Ga0129333_10186600 | All Organisms → Viruses → Predicted Viral | 1890 | Open in IMG/M |
| 3300010354|Ga0129333_11028225 | Not Available | 691 | Open in IMG/M |
| 3300010354|Ga0129333_11416627 | Not Available | 571 | Open in IMG/M |
| (restricted) 3300013125|Ga0172369_10437836 | Not Available | 648 | Open in IMG/M |
| (restricted) 3300013127|Ga0172365_10078079 | All Organisms → cellular organisms → Bacteria | 2139 | Open in IMG/M |
| (restricted) 3300013131|Ga0172373_10185017 | All Organisms → cellular organisms → Bacteria | 1436 | Open in IMG/M |
| 3300017754|Ga0181344_1019289 | All Organisms → cellular organisms → Bacteria | 2127 | Open in IMG/M |
| 3300017754|Ga0181344_1032218 | Not Available | 1600 | Open in IMG/M |
| 3300017754|Ga0181344_1197078 | Not Available | 566 | Open in IMG/M |
| 3300017766|Ga0181343_1177088 | Not Available | 589 | Open in IMG/M |
| 3300017774|Ga0181358_1001508 | Not Available | 10664 | Open in IMG/M |
| 3300017785|Ga0181355_1225524 | All Organisms → cellular organisms → Bacteria | 727 | Open in IMG/M |
| 3300017788|Ga0169931_10111857 | All Organisms → Viruses → Predicted Viral | 2578 | Open in IMG/M |
| 3300018775|Ga0188848_1006908 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 1269 | Open in IMG/M |
| 3300019784|Ga0181359_1000630 | Not Available | 8196 | Open in IMG/M |
| 3300019784|Ga0181359_1002088 | Not Available | 5685 | Open in IMG/M |
| 3300019784|Ga0181359_1112906 | All Organisms → cellular organisms → Bacteria | 982 | Open in IMG/M |
| 3300019784|Ga0181359_1169037 | Not Available | 733 | Open in IMG/M |
| 3300020161|Ga0211726_10270126 | All Organisms → cellular organisms → Bacteria | 1937 | Open in IMG/M |
| 3300020179|Ga0194134_10065919 | Not Available | 1911 | Open in IMG/M |
| 3300020183|Ga0194115_10015601 | Not Available | 6378 | Open in IMG/M |
| 3300020558|Ga0208362_1062723 | Not Available | 569 | Open in IMG/M |
| 3300021376|Ga0194130_10079017 | Not Available | 2210 | Open in IMG/M |
| 3300021960|Ga0222715_10014124 | Not Available | 6207 | Open in IMG/M |
| 3300021960|Ga0222715_10209674 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 1160 | Open in IMG/M |
| 3300021960|Ga0222715_10276531 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp. | 964 | Open in IMG/M |
| 3300021961|Ga0222714_10048552 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp. | 2962 | Open in IMG/M |
| 3300021961|Ga0222714_10069198 | Not Available | 2347 | Open in IMG/M |
| 3300021961|Ga0222714_10070236 | Not Available | 2324 | Open in IMG/M |
| 3300021962|Ga0222713_10013590 | Not Available | 7159 | Open in IMG/M |
| 3300021964|Ga0222719_10649173 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp. | 605 | Open in IMG/M |
| 3300022057|Ga0212025_1043774 | Not Available | 770 | Open in IMG/M |
| 3300022057|Ga0212025_1054462 | All Organisms → cellular organisms → Bacteria | 691 | Open in IMG/M |
| 3300022063|Ga0212029_1012843 | All Organisms → Viruses → Predicted Viral | 1057 | Open in IMG/M |
| 3300022063|Ga0212029_1045689 | Not Available | 631 | Open in IMG/M |
| 3300022167|Ga0212020_1012071 | All Organisms → cellular organisms → Bacteria | 1307 | Open in IMG/M |
| 3300022167|Ga0212020_1064854 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
| 3300022176|Ga0212031_1004873 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 1674 | Open in IMG/M |
| 3300022176|Ga0212031_1041297 | All Organisms → cellular organisms → Bacteria | 765 | Open in IMG/M |
| 3300022179|Ga0181353_1004334 | All Organisms → cellular organisms → Bacteria | 3266 | Open in IMG/M |
| 3300022179|Ga0181353_1049137 | Not Available | 1107 | Open in IMG/M |
| 3300022198|Ga0196905_1145921 | All Organisms → cellular organisms → Bacteria | 611 | Open in IMG/M |
| 3300022198|Ga0196905_1191554 | Not Available | 515 | Open in IMG/M |
| 3300024239|Ga0247724_1009603 | Not Available | 1438 | Open in IMG/M |
| 3300025543|Ga0208303_1013794 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp. | 2425 | Open in IMG/M |
| 3300025543|Ga0208303_1115201 | Not Available | 548 | Open in IMG/M |
| 3300025646|Ga0208161_1006311 | All Organisms → cellular organisms → Bacteria | 5319 | Open in IMG/M |
| 3300025646|Ga0208161_1012216 | Not Available | 3515 | Open in IMG/M |
| 3300025646|Ga0208161_1019257 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp. | 2601 | Open in IMG/M |
| 3300025646|Ga0208161_1027707 | All Organisms → cellular organisms → Bacteria | 2030 | Open in IMG/M |
| 3300025646|Ga0208161_1069533 | Not Available | 1053 | Open in IMG/M |
| 3300025646|Ga0208161_1157140 | Not Available | 561 | Open in IMG/M |
| 3300025655|Ga0208795_1070557 | All Organisms → cellular organisms → Bacteria | 986 | Open in IMG/M |
| 3300025655|Ga0208795_1081546 | Not Available | 895 | Open in IMG/M |
| 3300025655|Ga0208795_1122832 | Not Available | 674 | Open in IMG/M |
| 3300025674|Ga0208162_1064827 | All Organisms → Viruses → Predicted Viral | 1174 | Open in IMG/M |
| 3300025687|Ga0208019_1064477 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1217 | Open in IMG/M |
| 3300027792|Ga0209287_10370502 | Not Available | 550 | Open in IMG/M |
| 3300031578|Ga0307376_10080401 | All Organisms → cellular organisms → Bacteria | 2316 | Open in IMG/M |
| 3300031669|Ga0307375_10352543 | All Organisms → cellular organisms → Bacteria | 927 | Open in IMG/M |
| 3300031758|Ga0315907_10004886 | Not Available | 14845 | Open in IMG/M |
| 3300031758|Ga0315907_10573506 | All Organisms → cellular organisms → Bacteria | 880 | Open in IMG/M |
| 3300031758|Ga0315907_10701919 | Not Available | 769 | Open in IMG/M |
| 3300031758|Ga0315907_11286225 | Not Available | 506 | Open in IMG/M |
| 3300031787|Ga0315900_10783483 | Not Available | 660 | Open in IMG/M |
| 3300031787|Ga0315900_11038593 | Not Available | 534 | Open in IMG/M |
| 3300031857|Ga0315909_10150501 | All Organisms → cellular organisms → Bacteria | 1917 | Open in IMG/M |
| 3300031857|Ga0315909_10501382 | Not Available | 838 | Open in IMG/M |
| 3300031857|Ga0315909_10505580 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 833 | Open in IMG/M |
| 3300031857|Ga0315909_10819016 | Not Available | 586 | Open in IMG/M |
| 3300031963|Ga0315901_10380168 | Not Available | 1139 | Open in IMG/M |
| 3300032093|Ga0315902_10136912 | All Organisms → cellular organisms → Bacteria | 2576 | Open in IMG/M |
| 3300032116|Ga0315903_10206009 | Not Available | 1743 | Open in IMG/M |
| 3300034012|Ga0334986_0412516 | Not Available | 684 | Open in IMG/M |
| 3300034018|Ga0334985_0781689 | Not Available | 506 | Open in IMG/M |
| 3300034073|Ga0310130_0282792 | Not Available | 526 | Open in IMG/M |
| 3300034105|Ga0335035_0652661 | Not Available | 548 | Open in IMG/M |
| 3300034166|Ga0335016_0442518 | Not Available | 747 | Open in IMG/M |
| 3300034418|Ga0348337_130326 | Not Available | 751 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 40.88% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 10.22% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 10.22% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 9.49% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 5.84% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 5.11% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 3.65% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 2.92% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 2.92% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 1.46% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 1.46% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 0.73% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.73% |
| Sinkhole | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Sinkhole | 0.73% |
| Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 0.73% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 0.73% |
| Freshwater And Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Freshwater And Marine | 0.73% |
| Fracking Water | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water | 0.73% |
| Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 0.73% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000929 | Marine plume microbial communities from the Columbia River - 15 PSU | Environmental | Open in IMG/M |
| 3300001934 | Estuary microbial communities from Chesapeake Bay, Maryland, USA - MOVE858 | Environmental | Open in IMG/M |
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300004240 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN | Environmental | Open in IMG/M |
| 3300005077 | Water filled karst sinkhole microbial communities from Little Salt Spring, North Port, Florida - Phototrophic mat 2014 | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006919 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 | Environmental | Open in IMG/M |
| 3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007540 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007541 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG | Environmental | Open in IMG/M |
| 3300007640 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 | Environmental | Open in IMG/M |
| 3300007960 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG | Environmental | Open in IMG/M |
| 3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
| 3300008108 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-C-NA | Environmental | Open in IMG/M |
| 3300008110 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA | Environmental | Open in IMG/M |
| 3300008116 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA | Environmental | Open in IMG/M |
| 3300008259 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0132-C-NA | Environmental | Open in IMG/M |
| 3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008267 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-100-LTR | Environmental | Open in IMG/M |
| 3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
| 3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
| 3300009075 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm March2015 | Environmental | Open in IMG/M |
| 3300009082 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015 | Environmental | Open in IMG/M |
| 3300009149 | Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG | Environmental | Open in IMG/M |
| 3300009170 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm May2015 | Environmental | Open in IMG/M |
| 3300010318 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.8_DNA | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300013125 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_11.25m | Environmental | Open in IMG/M |
| 3300013127 (restricted) | Sediment microbial communities from Lake Kivu, Rwanda - Sediment site 48cm | Environmental | Open in IMG/M |
| 3300013131 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_10m | Environmental | Open in IMG/M |
| 3300017754 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.D | Environmental | Open in IMG/M |
| 3300017766 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D | Environmental | Open in IMG/M |
| 3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300017788 | Freshwater microbial communities from Lake Kivu, Western Province, Rwanda to study Microbial Dark Matter (Phase II) - Kivu_15m_20L | Environmental | Open in IMG/M |
| 3300018775 | Metatranscriptome of marine microbial communities from Baltic Sea - GS679_0p8 | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020161 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1 | Environmental | Open in IMG/M |
| 3300020179 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015056 Kigoma Offshore 0m | Environmental | Open in IMG/M |
| 3300020183 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015002 Mahale S4 surface | Environmental | Open in IMG/M |
| 3300020558 | Freshwater microbial communities from Lake Mendota, WI - 13OCT2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300021376 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015050 Kigoma 12 surface | Environmental | Open in IMG/M |
| 3300021960 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9D | Environmental | Open in IMG/M |
| 3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300021964 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_34D | Environmental | Open in IMG/M |
| 3300022057 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 (v2) | Environmental | Open in IMG/M |
| 3300022063 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v2) | Environmental | Open in IMG/M |
| 3300022167 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (v2) | Environmental | Open in IMG/M |
| 3300022176 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v2) | Environmental | Open in IMG/M |
| 3300022179 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N | Environmental | Open in IMG/M |
| 3300022198 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300024239 | Subsurface sediment microbial communities from gas well in Oklahoma, United States - OK STACK MC-2-E | Environmental | Open in IMG/M |
| 3300025543 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025646 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025655 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025674 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025687 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027792 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300031578 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-2 | Environmental | Open in IMG/M |
| 3300031669 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-1 | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
| 3300032093 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117 | Environmental | Open in IMG/M |
| 3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
| 3300034012 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027 | Environmental | Open in IMG/M |
| 3300034018 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME04Jul2014-rr0021 | Environmental | Open in IMG/M |
| 3300034073 | Fracking water microbial communities from deep shales in Oklahoma, United States - MC-6-XL | Environmental | Open in IMG/M |
| 3300034105 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME15May2014-rr0127 | Environmental | Open in IMG/M |
| 3300034166 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Sep2012-rr0079 | Environmental | Open in IMG/M |
| 3300034418 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 (v4) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| NpDRAFT_100364373 | 3300000929 | Freshwater And Marine | MSKVSSKARYEAFSEWLKWAQNKYPSMKRKKKARPDYLVNRDGEY* |
| GOS2267_1016475 | 3300001934 | Marine | MSKVSSKARYEAFMEWHKWAQNHYKSMKRKKKARPDYMLSNEDY* |
| B570J40625_10000069346 | 3300002835 | Freshwater | MSKVSAKARYEAFSEWFKWAQNKYPSMKKKKKARPDYMMGNEEY* |
| Ga0007787_106048491 | 3300004240 | Freshwater Lake | MSKVSSKSRYEAFSEWHKWAQNHYKSMKRKKKARPDYMLS |
| Ga0071116_10681111 | 3300005077 | Sinkhole | MSKVSSKTRYEAFSEWHKWAQNHYKSMKRKKKARPDYMLSN |
| Ga0070749_100814593 | 3300006802 | Aqueous | MSKVSGKTRYEAFMEWHKWAQHKYPIMKKKKKARPDYMAYTNDEY* |
| Ga0070749_101340764 | 3300006802 | Aqueous | MSKMSAKTRYEAFSEWHKWASHRYQSMKKKKKARPDYMTYGSNEY* |
| Ga0070749_101970891 | 3300006802 | Aqueous | MSKMSAKTRYQAFMEWHKWAQHKYPIMKKKKKARPEYLTYGTENEY* |
| Ga0070749_102232283 | 3300006802 | Aqueous | MSKMSAKTRYEAFSEWHKWAQSQYKSMKKKKKARPDYMAY |
| Ga0070749_104371073 | 3300006802 | Aqueous | MSKMSAKTRYEAFSEWHKWAQHKYPIMKKKKKARPDYMTYGAQNDY* |
| Ga0070749_104958113 | 3300006802 | Aqueous | MSKMSAKTRYEAFMEWHKWAQHKYPIMKKKKKARPEYLAYASGNEY* |
| Ga0070749_105112871 | 3300006802 | Aqueous | MSKMSAKTRYESFMEWHKWAQHKYPILKKKKKARPDYMTYGTNDEY* |
| Ga0070749_105137172 | 3300006802 | Aqueous | MSKVSSKSRYEAFSEWHKWAQNHYKSMKRKKKARPDYMLSNEDY* |
| Ga0070749_105579332 | 3300006802 | Aqueous | MSKMSAKTRYEAFMEWHKWAQNRYSSMKRKKKARPDYMAYGADNEY* |
| Ga0070749_106405331 | 3300006802 | Aqueous | MSKMSAKTRYQAFTEWQNWAKHKYPIMRRKKKARPDYLTYGTNDEY* |
| Ga0070749_106923771 | 3300006802 | Aqueous | MSKMSAKTRYEAFSEWHKWAQHKYPIMKKKKKARPDYMTYG |
| Ga0070749_107850433 | 3300006802 | Aqueous | MSKVSGKTRYEAFMEWHKWAQHKYPIMKKKKKARPDYMAYANNEY* |
| Ga0070746_100565152 | 3300006919 | Aqueous | MSKMSAKTRYEAFMEWHKWAQHKYPIMKKKKKARPDYMTYGANNEY* |
| Ga0070746_100656225 | 3300006919 | Aqueous | MSKMSAKTRYEAFSEWHKWAQHKYPIMKKKKKPRPDYITYGTPNDY* |
| Ga0099851_100013240 | 3300007538 | Aqueous | MSKMSAKTRYEAFMEWHKWAQHKYPIMKKKKKARPDYMTYGAQNDY* |
| Ga0099851_10159476 | 3300007538 | Aqueous | MSKMSAKTRYEAFSEWHKWAQSQYKSMKKKKKARPDYMAYAENDY* |
| Ga0099851_10214288 | 3300007538 | Aqueous | MSKVSSKARYVAFMEWHKWAQNHYKSMKRKKKARPDYLLSNEDY* |
| Ga0099851_11213531 | 3300007538 | Aqueous | MSKMSAKTRYEAFSEWHKWASHRYQSMKKKKKTRPDYMTYGSNEY* |
| Ga0099851_12238493 | 3300007538 | Aqueous | MSKVSSKARYEAFMEWHKWAQNHYKSMKRKKKARPDYLLSNEDY* |
| Ga0099851_13432363 | 3300007538 | Aqueous | MSKMSAKTRYEAFMEWHKWAQHKYPSMKRKKKPQVPDYMRLNEEY* |
| Ga0099847_10813951 | 3300007540 | Aqueous | INVIKIVNVMSKMSAKTRYEAFSEWHKWAQHKYPIMKKKKKARPDYMTYGTGNDY* |
| Ga0099848_100433514 | 3300007541 | Aqueous | MSKVSSKARYEAFMEWHKWASQRYNSMKRKKKARPDYLLSNENY* |
| Ga0099848_10152861 | 3300007541 | Aqueous | SVIKIVNVMSKMSAKTRYEAFMEWHKWAQHKYPIMKKKKKARPDYMTYGAQNDY* |
| Ga0099848_10729901 | 3300007541 | Aqueous | RYETFTEWHKWASNRYQSMRKKKKAQPDYLSKEEY* |
| Ga0099848_10876474 | 3300007541 | Aqueous | MSKMSAKTRYESFMEWHKWAQHKYPILKKKKKARPEYMTYGTNNEY* |
| Ga0099848_11395784 | 3300007541 | Aqueous | MSKVSSKARYEAFMEWHKWAQNHYKSMKRKKKARPDYLL |
| Ga0099848_12830694 | 3300007541 | Aqueous | MSKMSAKTRYQAFTEWQNWAKHKYPIMRRKKKARPDYMTYGTNNEY* |
| Ga0099848_12915011 | 3300007541 | Aqueous | TRYEAFMEWHKWAQHKYPIMKKKKKARPDYMTYGANNEY* |
| Ga0070751_11761533 | 3300007640 | Aqueous | MSTKTRYEAFSEWHKWAQHKYPIMKKKKKARPDYMTYGAQNDY* |
| Ga0099850_10193911 | 3300007960 | Aqueous | KIVIVMSKMSAKTRYQAFTEWQNWAKHKYPIMRRKKKARPDYLTYGTNDEY* |
| Ga0099850_10981571 | 3300007960 | Aqueous | MSKMSAKTRYEAFMEWHKWAQHKYPIMKKKKKARPDYMTYG |
| Ga0099850_12607543 | 3300007960 | Aqueous | MSKMSAKTRYEAFMEWHKWAQHKYPIMKKKKKARPEYLTYASGNEY* |
| Ga0114340_10681863 | 3300008107 | Freshwater, Plankton | MSKVSAKARYESFSEWHKWAQNHYKSMKKKKKVRPDYMAYGADSEY* |
| Ga0114341_101085782 | 3300008108 | Freshwater, Plankton | MSKVSSKARYEAFSEWLKWAQTKYPSMKRKKKARPDYLLSNEDY* |
| Ga0114343_10784504 | 3300008110 | Freshwater, Plankton | MSKMSAKTRYEAFSEWFKWAQTKYPSMKCKKKARPDYLPLNEDY* |
| Ga0114350_10286744 | 3300008116 | Freshwater, Plankton | MSKVSSKARYEAFQEWHKWAQNHYKSMKRKKKARPDYMLSNEDY* |
| Ga0114350_11683423 | 3300008116 | Freshwater, Plankton | MSKVSSKARYEAFSEWLKWAQTKYPSMKRKKKPRPDYLAYAEGDH* |
| Ga0114841_11955663 | 3300008259 | Freshwater, Plankton | MSKVSSKTRYEVFMEWHKWAQHKYSSMKRKKKPLVPDYMRLDEEY* |
| Ga0114841_12069484 | 3300008259 | Freshwater, Plankton | MSKVSSKARYEAFSEWLKWAQTKYPSMKRKKKARPDYLAYAEGDH* |
| Ga0114841_12388832 | 3300008259 | Freshwater, Plankton | MSKVSGKTRYEAFSEWHKWAQNHYKSMKRKKKARPDYMAYGAENEY* |
| Ga0114363_11852453 | 3300008266 | Freshwater, Plankton | MSKMSAKTRYEAFSEWHKWAQNHYKSMKRKKKARPDYMLSNEDY* |
| Ga0114364_10023773 | 3300008267 | Freshwater, Plankton | MSKVSSKARYIAFQEWYKWASQRYTSMKRKKKVRPDHLAYGTENDY* |
| Ga0114364_10051222 | 3300008267 | Freshwater, Plankton | MSKMSAKTRYEAFMEWHKWAQTQYKSMKKKKKARPDYMVYTENDY* |
| Ga0114364_10643863 | 3300008267 | Freshwater, Plankton | MSKVSSKSRYEAFSEWHKWAQTQYKSMKKKKKARPDYMAYAENDY* |
| Ga0114364_11083142 | 3300008267 | Freshwater, Plankton | MSKVSSKARYEAFSEWLKWAQNKYPSMKRKKKARPDYLLSNEGH* |
| Ga0114364_11548512 | 3300008267 | Freshwater, Plankton | MSKMSAKTRYEAFSEWHKWAQSQYKSMKKKKKARPDYMAYTENDY* |
| Ga0114876_10428296 | 3300008448 | Freshwater Lake | MSKVSSKSRYEAFSEWHKWAQTRYKSMKRKKKLQVPDYLKVDEEY* |
| Ga0114880_100634016 | 3300008450 | Freshwater Lake | MSKVSSKTRYEAFSEWHKWAQTRYQSMKRKKKARPDYMAYGADNEY* |
| Ga0105090_102638614 | 3300009075 | Freshwater Sediment | MSKVSSKARYEAFSEWLKWAQTKYPSMKRKKKVRPDYLAYGADSDN* |
| Ga0105099_101971943 | 3300009082 | Freshwater Sediment | MSKASAKARYETFSEWHKWAQHKYQSMKKKKKARPDYMVGNEEY* |
| Ga0114918_105749583 | 3300009149 | Deep Subsurface | MSKVSSKARYEAFSEWLKWAQTKYPSMKRKRKARPDYLSHGNGEY* |
| Ga0105096_103527301 | 3300009170 | Freshwater Sediment | MSKVSSKARYEAFSEWLKWAQTKYPSMKRKKKARPDYLLS |
| Ga0136656_12396971 | 3300010318 | Freshwater To Marine Saline Gradient | MSKVSGKTRYEVFQEWHKWASNRYQSMKKKKKAQPDYLSKEEY* |
| Ga0129333_101866002 | 3300010354 | Freshwater To Marine Saline Gradient | MSKVSAKTRYEVFQEWHKWASNRYQSMKKKKRTQPDYLSKEEY* |
| Ga0129333_110282251 | 3300010354 | Freshwater To Marine Saline Gradient | MSKVSAKTRYETFMEWHKWASNRYQSMRKKKKAQPDYLPKEEY* |
| Ga0129333_114166272 | 3300010354 | Freshwater To Marine Saline Gradient | MSKVSAKTRYETFMEWHKWASNRYQSMKKKKRTQPDYSTKEEY* |
| (restricted) Ga0172369_104378363 | 3300013125 | Freshwater | MSKVSAKARYEAFSEWHKWAQVHYKSMKKKKKARPDYMLSNEDY* |
| (restricted) Ga0172365_100780794 | 3300013127 | Sediment | MSKVSAKARYEAFSEWHKWAQVHYKSMKKKKKARPDYMLSNENY* |
| (restricted) Ga0172373_101850172 | 3300013131 | Freshwater | MSKVSAKARYEAFSEWHKWAQFHYKSMKKKKKARPDYMLSNEDY* |
| Ga0181344_10192891 | 3300017754 | Freshwater Lake | MSKVSSKARYEAFSEWLKWTQTKYPSMKRKKKARPDYLPLNENY |
| Ga0181344_10322181 | 3300017754 | Freshwater Lake | MSKVSSKARYEAFSEWFKWAQTKYPSMKRKKKVRPD |
| Ga0181344_11970782 | 3300017754 | Freshwater Lake | MSKVSSKSRYEAFSEWHKWAQNHYKSMKRKKKARPD |
| Ga0181343_11770883 | 3300017766 | Freshwater Lake | SSKARYEAFSEWHKWAQTRYKSMKRKKKLQAPDYLKVDEEY |
| Ga0181358_100150815 | 3300017774 | Freshwater Lake | MSKVSSKARYIAFQEWYKWASQRYTSMKRKKKVRPDHLAYGTENDN |
| Ga0181355_12255242 | 3300017785 | Freshwater Lake | METILVLAIVMSKMSAKTRYEAFSEWHKWAQNHYKSMKKKKKARPDYMAYTENDY |
| Ga0169931_101118573 | 3300017788 | Freshwater | MSKVSAKARYEAFSEWHKWAQVHYKSMKKKKKARPDYMLSNENY |
| Ga0188848_10069084 | 3300018775 | Freshwater Lake | MSKVSSKARYEAFMEWHKWASQRYNSMKRKKKARPDYLVNGDGEY |
| Ga0181359_100063015 | 3300019784 | Freshwater Lake | MSKMSAKTRYEAFSEWHKWAQYQYKSMKKKKKARPDYMAYAENDY |
| Ga0181359_10020885 | 3300019784 | Freshwater Lake | MSKMSAKTRYEAFMEWHKWAQTQYKSMKKKKKARPDYMVYTENDY |
| Ga0181359_11129062 | 3300019784 | Freshwater Lake | MSKMSAKTRYEAFSEWHKWAQNHYKSMKKKKKARPDYMAYTENDY |
| Ga0181359_11690373 | 3300019784 | Freshwater Lake | MSKVSSKSRYEAFSEWHKWAQNHYKSMKRKKKARPDYMLSNEDY |
| Ga0211726_102701263 | 3300020161 | Freshwater | MSKVSSKARYIAFQEWYKWASQRYTSMKRKKKVRPDHLAYGTENDY |
| Ga0194134_100659196 | 3300020179 | Freshwater Lake | MSKASAKARYEAFSEWHKWASQRYNSMKRKKKARPDYMLSNENY |
| Ga0194115_100156017 | 3300020183 | Freshwater Lake | MSKVSAKARYEAFSEWHKWAQFHYKSMKKKKKARPDYMLSNEDY |
| Ga0208362_10627231 | 3300020558 | Freshwater | MSKVSAKARYEAFSEWFKWAQNKYPSMKKKKKARPD |
| Ga0194130_100790177 | 3300021376 | Freshwater Lake | MSKVSAKARYEAFSEWHKWAQFHYKSMKKKKKARPDYMLSNENY |
| Ga0222715_100141244 | 3300021960 | Estuarine Water | MSKMSAKTRYEAFSEWHKWASHRYQSMKKKKKARPDYMTYGSNEH |
| Ga0222715_102096743 | 3300021960 | Estuarine Water | MSKVSSKSRYEAFMEWHKWAQHKYSSMKRKKKPLVPDYMRLDEEY |
| Ga0222715_102765313 | 3300021960 | Estuarine Water | MSKMSAKTRYQAFMEWHKWAQHKYPIMKKKKKARPDYITYGTPNDY |
| Ga0222714_100485529 | 3300021961 | Estuarine Water | MSKMSAKTRYEAFMEWHKWAQHKYPIMKKKKKARPDYIAYASENDY |
| Ga0222714_100691983 | 3300021961 | Estuarine Water | MSKVSGKTRYEAFSEWHKWAQNHYKSMKRKKKARPDYMLSNEDY |
| Ga0222714_100702362 | 3300021961 | Estuarine Water | MSKVSGKTRYEVFQEWHKWASNRYQSMKKKKKAQPDYLSKEDY |
| Ga0222713_1001359013 | 3300021962 | Estuarine Water | MSKMSAKTRYEAFMEWHKWAQHKYPIMKKKKKARPDYIAYTSENDY |
| Ga0222719_106491733 | 3300021964 | Estuarine Water | MSKMSAKTRYEAFSEWHKWAQHKYPIMKKKKKARPDYMTYGAQNDY |
| Ga0212025_10437743 | 3300022057 | Aqueous | MSKMSAKTRYEAFMEWHKWAQHKYPIMKKKKKARPDYMTYGAQNDY |
| Ga0212025_10544621 | 3300022057 | Aqueous | RKTRYEAFSEWHKWASHRYQSMKKKKKARPDYMTYGSNEY |
| Ga0212029_10128433 | 3300022063 | Aqueous | MSKMSAKTRYEAFSEWHKWAQSQYKSMKKKKKARPDYMAYAENDY |
| Ga0212029_10456892 | 3300022063 | Aqueous | MSKMSAKTRYEAFMEWHKWAQHKYPIMKKKKKARPEYLAYASGNEY |
| Ga0212020_10120712 | 3300022167 | Aqueous | MSKMSAKTRYEAFMEWHKWAQHKYPIMKKKKKARPDYMTYGANNEY |
| Ga0212020_10648543 | 3300022167 | Aqueous | MSKMSAKTRYEAFSEWHKWASHRYQSMKKKKKARPDYMTYGSNEY |
| Ga0212031_10048733 | 3300022176 | Aqueous | MSKMSAKTRYQAFSEWHKWASHRYQSMKKKKKTRPDYMTYGSNEY |
| Ga0212031_10412973 | 3300022176 | Aqueous | MSKMSAKTRYEAFSEWHKWAQHKYPIMKKKKKARPDYMTYGAENEY |
| Ga0181353_10043343 | 3300022179 | Freshwater Lake | MSKMSAKTRYEAFSEWHKWAQSQYKSMKKKKKARPDYMAYTENDY |
| Ga0181353_10491374 | 3300022179 | Freshwater Lake | MSKVSSKARYEAFSEWYKWAQSQYKSLKRKKKVRPDHSAYAEGEY |
| Ga0196905_11459211 | 3300022198 | Aqueous | KIVIVMSKMSAKTRYEAFSEWHKWAQHKYPILKKKKKARPDYMTYGTNNEY |
| Ga0196905_11915542 | 3300022198 | Aqueous | MSKVSSKTRYEVFMEWHKWAQHKYPSMKPKKKVMPDYMR |
| Ga0247724_10096035 | 3300024239 | Deep Subsurface Sediment | MSKVSSKARYEAFSEWLKWAQNKYPSMKRKKKARPDYLLSNEDH |
| Ga0208303_10137942 | 3300025543 | Aqueous | MSKMSAKTRYQAFMEWHKWAQHKYPIMKKKKKARPEYLTYGTENEY |
| Ga0208303_11152013 | 3300025543 | Aqueous | INVIKIVNVMSKMSAKTRYEAFSEWHKWAQHKYPIMKKKKKARPDYMTYGTGNDY |
| Ga0208161_10063116 | 3300025646 | Aqueous | MSKVSSKARYEAFMEWHKWASQRYNSMKRKKKARPDYLLSNENY |
| Ga0208161_101221613 | 3300025646 | Aqueous | MSKMSAKTRYEAFMEWHKWAQHKYPIMKKKKKARPEYLTYASGNEY |
| Ga0208161_10192577 | 3300025646 | Aqueous | MSKVSSKARYVAFMEWHKWAQNHYKSMKRKKKARPDYLLSNEDY |
| Ga0208161_10277075 | 3300025646 | Aqueous | IVIVMSKMSAKTRYEAFSEWHKWASHRYQSMKKKKKTRPDYMTYGSNEY |
| Ga0208161_10695331 | 3300025646 | Aqueous | MSKVSSKARYEAFMEWHKWAQNHYKSMKRKKKARPDYLLSNEDY |
| Ga0208161_11571402 | 3300025646 | Aqueous | MSKMSAKTRYEAFSEWHKWAQVQYKSMKKKKKARPDYMAYAENDY |
| Ga0208795_10705573 | 3300025655 | Aqueous | VSSKARYEAFMEWHKWAQNHYKSMKRKKKARPDYLLSNEDY |
| Ga0208795_10815464 | 3300025655 | Aqueous | QINVIKIVIVMSKMSAKTRYESFMEWHKWAQHKYPILKKKKKARPEYMTYGTNNEY |
| Ga0208795_11228321 | 3300025655 | Aqueous | MSKMSAKTRYESFMEWHKWAQHKYPILKKKKKARPDYMTYGTNDEY |
| Ga0208162_10648272 | 3300025674 | Aqueous | MSKMSAKTRYEAFSEWHKWAQHKYPILKKKKKARPDYMTYGTNNEY |
| Ga0208019_10644773 | 3300025687 | Aqueous | MSAKTRYEAFMEWHKWAQHKYPIMKKKKKARPDYMTYGAQN |
| Ga0209287_103705022 | 3300027792 | Freshwater Sediment | MSKASAKARYETFSEWHKWAQHKYQSMKKKKKARPDYMVGNEEY |
| Ga0307376_100804012 | 3300031578 | Soil | MSKISGKTRHEAFQEWHKWASQRYTSMKRKKKVRPDHLAYGTENDH |
| Ga0307375_103525432 | 3300031669 | Soil | MSKMSAKTRYEAFMEWHKWAQHKYPIMKKKKKARPEHLTYGVENDY |
| Ga0315907_1000488620 | 3300031758 | Freshwater | MSKVSSKTRYEVFMEWHKWAQHKYSSMKRKKKPLVPDYMRLDEEY |
| Ga0315907_105735063 | 3300031758 | Freshwater | MSKMSAKTRYEAFSEWHKWAQNHYKSMKRKKKARPDYMLSNEDY |
| Ga0315907_107019192 | 3300031758 | Freshwater | MSKVSGKTRYEAFSEWHKWAQNHYKSMKRKKKARPDYMAYGAENEY |
| Ga0315907_112862251 | 3300031758 | Freshwater | MSKVSSKARYEAFSEWHKWAQTRYKSMKRKKKLQVPDYL |
| Ga0315900_107834833 | 3300031787 | Freshwater | MSKVSSKARYEAFSEWHKWAQTRYKSMKRKKKLQVPDYLKVDEEY |
| Ga0315900_110385931 | 3300031787 | Freshwater | MSKVSSKARYEAFSEWLKWAQNKYPSMKRKKKARPDYLLSNEGH |
| Ga0315909_101505014 | 3300031857 | Freshwater | MSKVSSKARYEAFQEWHKWAQNHYKSMKRKKKARPDYMLSNEDY |
| Ga0315909_105013822 | 3300031857 | Freshwater | MSKVSSKTRYEAFSEWHKWAQTRYQSMKRKKKARPDYMAYGADNEY |
| Ga0315909_105055801 | 3300031857 | Freshwater | MSKMSAKTRYEAFMEWHKWAQTQYKSMKKKKKARPDYMV |
| Ga0315909_108190162 | 3300031857 | Freshwater | MSKVSAKARYEAFQEWHKWAQTRYKSMKRKKKLQVPDYLKVDEEY |
| Ga0315901_103801685 | 3300031963 | Freshwater | EAFSEWHKWAQTRYKSMKRKKKLQVPDYLKVDEEY |
| Ga0315902_101369121 | 3300032093 | Freshwater | SKVSSKARYEAFSEWLKWAQTKYPSMKRKKKARPDYLLSNEDY |
| Ga0315903_102060091 | 3300032116 | Freshwater | MSKMSAKTRYEAFMEWHKWAQTQYKSMKKKKKARPDYMVYTE |
| Ga0334986_0412516_478_612 | 3300034012 | Freshwater | MSKVSSKARYEAFSEWLKWTQTKYPSMKRKKKARPDYLLPNEGY |
| Ga0334985_0781689_392_505 | 3300034018 | Freshwater | MSKVSSKARYIAFQEWYKWASQRYTSMKRKKKVRPDHL |
| Ga0310130_0282792_254_394 | 3300034073 | Fracking Water | MSKMSAKTRYEAFMEWHKWAQNRYQSMKRKKKARPDYMAYGADNEY |
| Ga0335035_0652661_373_513 | 3300034105 | Freshwater | MSKVSSKARYIAFQEWYKWASQRYTSMKRKKKVRPDHLAYGTEDDN |
| Ga0335016_0442518_637_747 | 3300034166 | Freshwater | MSKVSAKARYEAFSEWFKWAQNKYPSMKKKKKARPDY |
| Ga0348337_130326_3_113 | 3300034418 | Aqueous | EAFSEWHKWAQHKYPIMKKKKKPRPDYITYGTPNDY |
| ⦗Top⦘ |