


| Basic Information | |
|---|---|
| Family ID | F056384 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 137 |
| Average Sequence Length | 42 residues |
| Representative Sequence | QGLARVLAHGFVAPLANIPDIGCGSLRALSQNRDSASRVSLC |
| Number of Associated Samples | 91 |
| Number of Associated Scaffolds | 137 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 26.47 % |
| % of genes near scaffold ends (potentially truncated) | 86.13 % |
| % of genes from short scaffolds (< 2000 bps) | 83.21 % |
| Associated GOLD sequencing projects | 90 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.30 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (71.533 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil (46.715 % of family members) |
| Environment Ontology (ENVO) | Unclassified (56.934 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Subsurface (non-saline) (64.964 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 47.14% β-sheet: 0.00% Coil/Unstructured: 52.86% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.30 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 137 Family Scaffolds |
|---|---|---|
| PF03401 | TctC | 3.65 |
| PF06808 | DctM | 2.19 |
| PF03641 | Lysine_decarbox | 2.19 |
| PF00175 | NAD_binding_1 | 1.46 |
| PF11412 | DsbC | 1.46 |
| PF00561 | Abhydrolase_1 | 1.46 |
| PF00076 | RRM_1 | 1.46 |
| PF03881 | Fructosamin_kin | 1.46 |
| PF02515 | CoA_transf_3 | 1.46 |
| PF02777 | Sod_Fe_C | 1.46 |
| PF06580 | His_kinase | 1.46 |
| PF13242 | Hydrolase_like | 1.46 |
| PF00034 | Cytochrom_C | 1.46 |
| PF01066 | CDP-OH_P_transf | 1.46 |
| PF14492 | EFG_III | 0.73 |
| PF13472 | Lipase_GDSL_2 | 0.73 |
| PF00586 | AIRS | 0.73 |
| PF02540 | NAD_synthase | 0.73 |
| PF01494 | FAD_binding_3 | 0.73 |
| PF08502 | LeuA_dimer | 0.73 |
| PF02803 | Thiolase_C | 0.73 |
| PF04909 | Amidohydro_2 | 0.73 |
| PF00691 | OmpA | 0.73 |
| PF07072 | ZapD | 0.73 |
| PF03972 | MmgE_PrpD | 0.73 |
| PF02817 | E3_binding | 0.73 |
| PF13366 | PDDEXK_3 | 0.73 |
| PF00009 | GTP_EFTU | 0.73 |
| PF00216 | Bac_DNA_binding | 0.73 |
| PF08282 | Hydrolase_3 | 0.73 |
| PF00497 | SBP_bac_3 | 0.73 |
| PF16177 | ACAS_N | 0.73 |
| PF02852 | Pyr_redox_dim | 0.73 |
| PF00174 | Oxidored_molyb | 0.73 |
| PF00027 | cNMP_binding | 0.73 |
| PF13549 | ATP-grasp_5 | 0.73 |
| PF13714 | PEP_mutase | 0.73 |
| PF02780 | Transketolase_C | 0.73 |
| PF06629 | MipA | 0.73 |
| PF00313 | CSD | 0.73 |
| PF02776 | TPP_enzyme_N | 0.73 |
| PF04945 | YHS | 0.73 |
| PF08459 | UvrC_RNaseH_dom | 0.73 |
| PF00406 | ADK | 0.73 |
| PF04355 | SmpA_OmlA | 0.73 |
| PF02746 | MR_MLE_N | 0.73 |
| PF08501 | Shikimate_dh_N | 0.73 |
| PF02653 | BPD_transp_2 | 0.73 |
| PF04166 | PdxA | 0.73 |
| PF02616 | SMC_ScpA | 0.73 |
| PF00293 | NUDIX | 0.73 |
| PF13489 | Methyltransf_23 | 0.73 |
| PF14693 | Ribosomal_TL5_C | 0.73 |
| PF14076 | DUF4258 | 0.73 |
| PF07681 | DoxX | 0.73 |
| PF00334 | NDK | 0.73 |
| PF05199 | GMC_oxred_C | 0.73 |
| PF02313 | Fumarate_red_D | 0.73 |
| PF08695 | Coa1 | 0.73 |
| PF03992 | ABM | 0.73 |
| PF00180 | Iso_dh | 0.73 |
| PF01565 | FAD_binding_4 | 0.73 |
| PF00342 | PGI | 0.73 |
| PF13742 | tRNA_anti_2 | 0.73 |
| PF12643 | MazG-like | 0.73 |
| PF02784 | Orn_Arg_deC_N | 0.73 |
| PF07883 | Cupin_2 | 0.73 |
| PF07726 | AAA_3 | 0.73 |
| PF07690 | MFS_1 | 0.73 |
| PF01206 | TusA | 0.73 |
| PF03061 | 4HBT | 0.73 |
| PF02844 | GARS_N | 0.73 |
| PF00033 | Cytochrome_B | 0.73 |
| PF00795 | CN_hydrolase | 0.73 |
| PF00581 | Rhodanese | 0.73 |
| PF01042 | Ribonuc_L-PSP | 0.73 |
| PF00892 | EamA | 0.73 |
| PF08207 | EFP_N | 0.73 |
| PF13247 | Fer4_11 | 0.73 |
| PF00266 | Aminotran_5 | 0.73 |
| PF13292 | DXP_synthase_N | 0.73 |
| PF01300 | Sua5_yciO_yrdC | 0.73 |
| PF13478 | XdhC_C | 0.73 |
| PF00248 | Aldo_ket_red | 0.73 |
| PF16491 | Peptidase_M48_N | 0.73 |
| PF00990 | GGDEF | 0.73 |
| PF00069 | Pkinase | 0.73 |
| PF02738 | MoCoBD_1 | 0.73 |
| PF07244 | POTRA | 0.73 |
| PF05157 | T2SSE_N | 0.73 |
| PF07366 | SnoaL | 0.73 |
| PF01257 | 2Fe-2S_thioredx | 0.73 |
| COG ID | Name | Functional Category | % Frequency in 137 Family Scaffolds |
|---|---|---|---|
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 3.65 |
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 2.92 |
| COG1611 | Nucleotide monophosphate nucleosidase PpnN/YdgH, Lonely Guy (LOG) family | Nucleotide transport and metabolism [F] | 2.19 |
| COG0558 | Phosphatidylglycerophosphate synthase | Lipid transport and metabolism [I] | 1.46 |
| COG0605 | Superoxide dismutase | Inorganic ion transport and metabolism [P] | 1.46 |
| COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 1.46 |
| COG1183 | Phosphatidylserine synthase | Lipid transport and metabolism [I] | 1.46 |
| COG1804 | Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferases | Lipid transport and metabolism [I] | 1.46 |
| COG2972 | Sensor histidine kinase YesM | Signal transduction mechanisms [T] | 1.46 |
| COG3001 | Fructosamine-3-kinase | Carbohydrate transport and metabolism [G] | 1.46 |
| COG3275 | Sensor histidine kinase, LytS/YehU family | Signal transduction mechanisms [T] | 1.46 |
| COG4948 | L-alanine-DL-glutamate epimerase or related enzyme of enolase superfamily | Cell wall/membrane/envelope biogenesis [M] | 1.46 |
| COG5050 | sn-1,2-diacylglycerol ethanolamine- and cholinephosphotranferases | Lipid transport and metabolism [I] | 1.46 |
| COG0019 | Diaminopimelate decarboxylase | Amino acid transport and metabolism [E] | 0.73 |
| COG0105 | Nucleoside diphosphate kinase | Nucleotide transport and metabolism [F] | 0.73 |
| COG0119 | Isopropylmalate/homocitrate/citramalate synthases | Amino acid transport and metabolism [E] | 0.73 |
| COG0151 | Phosphoribosylamine-glycine ligase | Nucleotide transport and metabolism [F] | 0.73 |
| COG0166 | Glucose-6-phosphate isomerase | Carbohydrate transport and metabolism [G] | 0.73 |
| COG0169 | Shikimate 5-dehydrogenase | Amino acid transport and metabolism [E] | 0.73 |
| COG0171 | NH3-dependent NAD+ synthetase | Coenzyme transport and metabolism [H] | 0.73 |
| COG0183 | Acetyl-CoA acetyltransferase | Lipid transport and metabolism [I] | 0.73 |
| COG0231 | Translation elongation factor P (EF-P)/translation initiation factor 5A (eIF-5A) | Translation, ribosomal structure and biogenesis [J] | 0.73 |
| COG0251 | Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 family | Defense mechanisms [V] | 0.73 |
| COG0322 | Excinuclease UvrABC, nuclease subunit | Replication, recombination and repair [L] | 0.73 |
| COG0425 | Sulfur carrier protein TusA (tRNA thiolation, molybdenum cofactor biosynthesis) | Translation, ribosomal structure and biogenesis [J] | 0.73 |
| COG0508 | Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase (E2) component | Energy production and conversion [C] | 0.73 |
| COG0560 | Phosphoserine phosphatase | Amino acid transport and metabolism [E] | 0.73 |
| COG0561 | Hydroxymethylpyrimidine pyrophosphatase and other HAD family phosphatases | Coenzyme transport and metabolism [H] | 0.73 |
| COG0563 | Adenylate kinase or related kinase | Nucleotide transport and metabolism [F] | 0.73 |
| COG0578 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.73 |
| COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 0.73 |
| COG0665 | Glycine/D-amino acid oxidase (deaminating) | Amino acid transport and metabolism [E] | 0.73 |
| COG0776 | Bacterial nucleoid DNA-binding protein IHF-alpha | Replication, recombination and repair [L] | 0.73 |
| COG1166 | Arginine decarboxylase (spermidine biosynthesis) | Amino acid transport and metabolism [E] | 0.73 |
| COG1290 | Cytochrome b subunit of the bc complex | Energy production and conversion [C] | 0.73 |
| COG1354 | Chromatin segregation and condensation protein Rec8/ScpA/Scc1, kleisin family | Replication, recombination and repair [L] | 0.73 |
| COG1877 | Trehalose-6-phosphate phosphatase | Carbohydrate transport and metabolism [G] | 0.73 |
| COG1905 | NADH:ubiquinone oxidoreductase 24 kD subunit (chain E) | Energy production and conversion [C] | 0.73 |
| COG1995 | 4-hydroxy-L-threonine phosphate dehydrogenase PdxA | Coenzyme transport and metabolism [H] | 0.73 |
| COG2041 | Molybdopterin-dependent catalytic subunit of periplasmic DMSO/TMAO and protein-methionine-sulfoxide reductases | Energy production and conversion [C] | 0.73 |
| COG2079 | 2-methylcitrate dehydratase PrpD | Carbohydrate transport and metabolism [G] | 0.73 |
| COG2217 | Cation-transporting P-type ATPase | Inorganic ion transport and metabolism [P] | 0.73 |
| COG2259 | Uncharacterized membrane protein YphA, DoxX/SURF4 family | Function unknown [S] | 0.73 |
| COG2303 | Choline dehydrogenase or related flavoprotein | Lipid transport and metabolism [I] | 0.73 |
| COG2913 | Outer membrane protein assembly factor BamE, lipoprotein component of the BamABCDE complex | Cell wall/membrane/envelope biogenesis [M] | 0.73 |
| COG3080 | Fumarate reductase subunit D | Energy production and conversion [C] | 0.73 |
| COG3713 | Outer membrane scaffolding protein for murein synthesis, MipA/OmpV family | Cell wall/membrane/envelope biogenesis [M] | 0.73 |
| COG3769 | Mannosyl-3-phosphoglycerate phosphatase YedP/MpgP, HAD superfamily | Carbohydrate transport and metabolism [G] | 0.73 |
| COG3915 | Uncharacterized conserved protein | Function unknown [S] | 0.73 |
| COG4270 | Uncharacterized membrane protein | Function unknown [S] | 0.73 |
| COG4582 | Cell division protein ZapD, interacts with FtsZ | Cell cycle control, cell division, chromosome partitioning [D] | 0.73 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 72.99 % |
| Unclassified | root | N/A | 27.01 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002122|C687J26623_10030944 | Not Available | 1427 | Open in IMG/M |
| 3300005829|Ga0074479_10303547 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2492 | Open in IMG/M |
| 3300005829|Ga0074479_10313667 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales | 7437 | Open in IMG/M |
| 3300005829|Ga0074479_10529621 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Sulfuricellaceae → Sulfuricella → Sulfuricella denitrificans | 8246 | Open in IMG/M |
| 3300006853|Ga0075420_100393581 | Not Available | 1198 | Open in IMG/M |
| 3300009091|Ga0102851_10074642 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2840 | Open in IMG/M |
| 3300009609|Ga0105347_1000138 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 34923 | Open in IMG/M |
| 3300009609|Ga0105347_1001461 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 10144 | Open in IMG/M |
| 3300009609|Ga0105347_1197084 | All Organisms → cellular organisms → Bacteria | 808 | Open in IMG/M |
| 3300009609|Ga0105347_1394093 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
| 3300009610|Ga0105340_1015227 | All Organisms → cellular organisms → Bacteria | 3020 | Open in IMG/M |
| 3300009610|Ga0105340_1128412 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1034 | Open in IMG/M |
| 3300009678|Ga0105252_10041076 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1726 | Open in IMG/M |
| 3300009678|Ga0105252_10041104 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1725 | Open in IMG/M |
| 3300009678|Ga0105252_10395744 | Not Available | 632 | Open in IMG/M |
| 3300009805|Ga0105079_1042417 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 521 | Open in IMG/M |
| 3300009807|Ga0105061_1054335 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
| 3300009808|Ga0105071_1084511 | Not Available | 558 | Open in IMG/M |
| 3300009813|Ga0105057_1022326 | Not Available | 932 | Open in IMG/M |
| 3300009816|Ga0105076_1072005 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_62_13 | 645 | Open in IMG/M |
| 3300010391|Ga0136847_12524045 | All Organisms → cellular organisms → Bacteria | 1827 | Open in IMG/M |
| 3300011395|Ga0137315_1000110 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4605 | Open in IMG/M |
| 3300011398|Ga0137348_1012772 | All Organisms → cellular organisms → Bacteria | 1271 | Open in IMG/M |
| 3300011398|Ga0137348_1024604 | Not Available | 958 | Open in IMG/M |
| 3300011402|Ga0137356_1104981 | Not Available | 534 | Open in IMG/M |
| 3300011403|Ga0137313_1002986 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3437 | Open in IMG/M |
| 3300011403|Ga0137313_1003712 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2930 | Open in IMG/M |
| 3300011405|Ga0137340_1004585 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2518 | Open in IMG/M |
| 3300011409|Ga0137323_1010613 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Acidiferrobacterales → Acidiferrobacteraceae → Sulfurifustis → Sulfurifustis variabilis | 2133 | Open in IMG/M |
| 3300011415|Ga0137325_1027675 | Not Available | 1148 | Open in IMG/M |
| 3300011415|Ga0137325_1069345 | All Organisms → cellular organisms → Bacteria | 772 | Open in IMG/M |
| 3300011416|Ga0137422_1089273 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 738 | Open in IMG/M |
| 3300011420|Ga0137314_1038356 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1163 | Open in IMG/M |
| 3300011422|Ga0137425_1024685 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae | 1280 | Open in IMG/M |
| 3300011427|Ga0137448_1025245 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae | 1398 | Open in IMG/M |
| 3300011427|Ga0137448_1079531 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 867 | Open in IMG/M |
| 3300011428|Ga0137456_1106830 | Not Available | 728 | Open in IMG/M |
| 3300011430|Ga0137423_1037344 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1470 | Open in IMG/M |
| 3300011430|Ga0137423_1040088 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1411 | Open in IMG/M |
| 3300011432|Ga0137428_1061240 | All Organisms → cellular organisms → Bacteria | 1013 | Open in IMG/M |
| 3300011433|Ga0137443_1160563 | Not Available | 668 | Open in IMG/M |
| 3300011437|Ga0137429_1045614 | All Organisms → cellular organisms → Bacteria | 1276 | Open in IMG/M |
| 3300011437|Ga0137429_1107871 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 849 | Open in IMG/M |
| 3300011437|Ga0137429_1293725 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 501 | Open in IMG/M |
| 3300011439|Ga0137432_1068794 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1081 | Open in IMG/M |
| 3300011440|Ga0137433_1067732 | Not Available | 1081 | Open in IMG/M |
| 3300011441|Ga0137452_1217883 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 648 | Open in IMG/M |
| 3300011445|Ga0137427_10070975 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1388 | Open in IMG/M |
| 3300011445|Ga0137427_10317037 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 657 | Open in IMG/M |
| 3300012035|Ga0137445_1131287 | Not Available | 512 | Open in IMG/M |
| 3300012038|Ga0137431_1154962 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 655 | Open in IMG/M |
| 3300012039|Ga0137421_1044523 | All Organisms → cellular organisms → Bacteria | 1188 | Open in IMG/M |
| 3300012143|Ga0137354_1028156 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 865 | Open in IMG/M |
| 3300012146|Ga0137322_1081655 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300012157|Ga0137353_1049466 | Not Available | 762 | Open in IMG/M |
| 3300012160|Ga0137349_1086102 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 580 | Open in IMG/M |
| 3300012161|Ga0137336_1049965 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 766 | Open in IMG/M |
| 3300012164|Ga0137352_1110240 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 544 | Open in IMG/M |
| 3300012175|Ga0137321_1068334 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 786 | Open in IMG/M |
| 3300012175|Ga0137321_1107212 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Candidatus Tenderia → Candidatus Tenderia electrophaga | 630 | Open in IMG/M |
| 3300012179|Ga0137334_1165401 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Pycnogonida → Pantopoda → Nymphonidae → Nymphon → Nymphon striatum | 501 | Open in IMG/M |
| 3300012672|Ga0137317_1029728 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300012931|Ga0153915_10748136 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_62_58 | 1131 | Open in IMG/M |
| 3300012931|Ga0153915_11504573 | Not Available | 787 | Open in IMG/M |
| 3300012931|Ga0153915_11507046 | All Organisms → cellular organisms → Bacteria | 786 | Open in IMG/M |
| 3300012931|Ga0153915_11703149 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_62_13 | 738 | Open in IMG/M |
| 3300014315|Ga0075350_1136233 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
| 3300014324|Ga0075352_1097809 | Not Available | 766 | Open in IMG/M |
| 3300014324|Ga0075352_1118120 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 715 | Open in IMG/M |
| 3300014861|Ga0180061_1078172 | Not Available | 556 | Open in IMG/M |
| 3300014865|Ga0180078_1018057 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1042 | Open in IMG/M |
| 3300014870|Ga0180080_1040814 | Not Available | 742 | Open in IMG/M |
| 3300014873|Ga0180066_1005136 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_02_FULL_67_26 | 2046 | Open in IMG/M |
| 3300014873|Ga0180066_1091952 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 624 | Open in IMG/M |
| 3300014874|Ga0180084_1059079 | All Organisms → cellular organisms → Bacteria | 771 | Open in IMG/M |
| 3300015254|Ga0180089_1052952 | Not Available | 803 | Open in IMG/M |
| 3300015256|Ga0180073_1048148 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 865 | Open in IMG/M |
| 3300015256|Ga0180073_1108033 | Not Available | 600 | Open in IMG/M |
| 3300015259|Ga0180085_1082788 | Not Available | 937 | Open in IMG/M |
| 3300017939|Ga0187775_10200579 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 740 | Open in IMG/M |
| 3300017966|Ga0187776_11090149 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → unclassified Polyangiaceae → Polyangiaceae bacterium | 592 | Open in IMG/M |
| 3300018031|Ga0184634_10003731 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4920 | Open in IMG/M |
| 3300018063|Ga0184637_10129350 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1557 | Open in IMG/M |
| 3300018063|Ga0184637_10222172 | All Organisms → cellular organisms → Bacteria | 1155 | Open in IMG/M |
| 3300018063|Ga0184637_10235819 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_62_58 | 1117 | Open in IMG/M |
| 3300018063|Ga0184637_10387535 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 834 | Open in IMG/M |
| 3300018063|Ga0184637_10598294 | Not Available | 624 | Open in IMG/M |
| 3300018063|Ga0184637_10644665 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
| 3300018077|Ga0184633_10040423 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2359 | Open in IMG/M |
| 3300018077|Ga0184633_10083865 | All Organisms → cellular organisms → Bacteria | 1640 | Open in IMG/M |
| 3300018077|Ga0184633_10207852 | Not Available | 1011 | Open in IMG/M |
| 3300018077|Ga0184633_10286726 | Not Available | 841 | Open in IMG/M |
| 3300018077|Ga0184633_10341223 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Neisseriales → Chromobacteriaceae → Andreprevotia → Andreprevotia chitinilytica | 758 | Open in IMG/M |
| 3300018082|Ga0184639_10633564 | Not Available | 520 | Open in IMG/M |
| 3300018469|Ga0190270_10099223 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2225 | Open in IMG/M |
| 3300018469|Ga0190270_10173245 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1786 | Open in IMG/M |
| 3300021332|Ga0210339_1697272 | Not Available | 563 | Open in IMG/M |
| 3300022226|Ga0224512_10440740 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 639 | Open in IMG/M |
| 3300025159|Ga0209619_10063155 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2289 | Open in IMG/M |
| 3300025159|Ga0209619_10428084 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 673 | Open in IMG/M |
| 3300025165|Ga0209108_10095651 | All Organisms → cellular organisms → Bacteria | 1605 | Open in IMG/M |
| 3300025173|Ga0209824_10141054 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 871 | Open in IMG/M |
| 3300025311|Ga0209343_10297512 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1120 | Open in IMG/M |
| 3300025318|Ga0209519_10497487 | Not Available | 684 | Open in IMG/M |
| 3300025325|Ga0209341_10339382 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces somaliensis | 1229 | Open in IMG/M |
| 3300025957|Ga0210089_1039245 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
| 3300025959|Ga0210116_1074267 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 661 | Open in IMG/M |
| 3300025985|Ga0210117_1004882 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1600 | Open in IMG/M |
| 3300026452|Ga0256821_1039874 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis → Candidatus Accumulibacter | 540 | Open in IMG/M |
| 3300027573|Ga0208454_1003348 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 5015 | Open in IMG/M |
| 3300027573|Ga0208454_1004987 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3810 | Open in IMG/M |
| 3300027573|Ga0208454_1030488 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1264 | Open in IMG/M |
| 3300027876|Ga0209974_10437916 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300031965|Ga0326597_10214165 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2248 | Open in IMG/M |
| 3300031965|Ga0326597_10575371 | Not Available | 1210 | Open in IMG/M |
| 3300032144|Ga0315910_11177538 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
| 3300032144|Ga0315910_11375869 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 551 | Open in IMG/M |
| 3300033004|Ga0335084_10605110 | Not Available | 1121 | Open in IMG/M |
| 3300033233|Ga0334722_11119839 | Not Available | 552 | Open in IMG/M |
| 3300033233|Ga0334722_11330627 | Not Available | 502 | Open in IMG/M |
| 3300033407|Ga0214472_11185502 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae → Lupinus → Lupinus albus | 666 | Open in IMG/M |
| 3300033408|Ga0316605_11471677 | All Organisms → cellular organisms → Bacteria | 661 | Open in IMG/M |
| 3300033483|Ga0316629_10826602 | Not Available | 714 | Open in IMG/M |
| 3300033513|Ga0316628_101214631 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1004 | Open in IMG/M |
| 3300033513|Ga0316628_103948757 | Not Available | 530 | Open in IMG/M |
| 3300033813|Ga0364928_0006474 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales | 2072 | Open in IMG/M |
| 3300033813|Ga0364928_0024870 | Not Available | 1217 | Open in IMG/M |
| 3300033814|Ga0364930_0002268 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales | 6721 | Open in IMG/M |
| 3300033815|Ga0364946_057617 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis → Candidatus Accumulibacter → unclassified Candidatus Accumulibacter → Candidatus Accumulibacter sp. SK-11 | 815 | Open in IMG/M |
| 3300033815|Ga0364946_135069 | Not Available | 564 | Open in IMG/M |
| 3300034148|Ga0364927_0040446 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1190 | Open in IMG/M |
| 3300034165|Ga0364942_0024113 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1938 | Open in IMG/M |
| 3300034165|Ga0364942_0147700 | All Organisms → cellular organisms → Bacteria | 765 | Open in IMG/M |
| 3300034178|Ga0364934_0038320 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae | 1765 | Open in IMG/M |
| 3300034178|Ga0364934_0193639 | Not Available | 770 | Open in IMG/M |
| 3300034178|Ga0364934_0338883 | Not Available | 569 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 46.72% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 9.49% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 8.03% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.38% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.65% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 3.65% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 2.92% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.92% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 2.19% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 2.19% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 2.19% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 1.46% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.46% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 1.46% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment | 0.73% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.73% |
| Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Sediment | 0.73% |
| Wastewater | Environmental → Aquatic → Freshwater → Drinking Water → Unchlorinated → Wastewater | 0.73% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater | 0.73% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.73% |
| Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 0.73% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.73% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.73% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.73% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002122 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_2 | Environmental | Open in IMG/M |
| 3300005829 | Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.190_CBC | Environmental | Open in IMG/M |
| 3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
| 3300009091 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300009609 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890 | Environmental | Open in IMG/M |
| 3300009610 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700 | Environmental | Open in IMG/M |
| 3300009678 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT100 | Environmental | Open in IMG/M |
| 3300009805 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_0_10 | Environmental | Open in IMG/M |
| 3300009807 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_0_10 | Environmental | Open in IMG/M |
| 3300009808 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_40_50 | Environmental | Open in IMG/M |
| 3300009813 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_10_20 | Environmental | Open in IMG/M |
| 3300009816 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_0_10 | Environmental | Open in IMG/M |
| 3300010391 | Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406 | Environmental | Open in IMG/M |
| 3300011395 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT200_2 | Environmental | Open in IMG/M |
| 3300011398 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT600_2 | Environmental | Open in IMG/M |
| 3300011402 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT830_2 | Environmental | Open in IMG/M |
| 3300011403 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT166_2 | Environmental | Open in IMG/M |
| 3300011405 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT400_2 | Environmental | Open in IMG/M |
| 3300011409 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT423_2 | Environmental | Open in IMG/M |
| 3300011415 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT469_2 | Environmental | Open in IMG/M |
| 3300011416 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT551_2 | Environmental | Open in IMG/M |
| 3300011420 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT199_2 | Environmental | Open in IMG/M |
| 3300011422 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT640_2 | Environmental | Open in IMG/M |
| 3300011427 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT418_2 | Environmental | Open in IMG/M |
| 3300011428 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT615_2 | Environmental | Open in IMG/M |
| 3300011430 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT600_2 | Environmental | Open in IMG/M |
| 3300011432 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT718_2 | Environmental | Open in IMG/M |
| 3300011433 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT300_2 | Environmental | Open in IMG/M |
| 3300011437 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT736_2 | Environmental | Open in IMG/M |
| 3300011439 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT820_2 | Environmental | Open in IMG/M |
| 3300011440 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT840_2 | Environmental | Open in IMG/M |
| 3300011441 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT513_2 | Environmental | Open in IMG/M |
| 3300011445 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT700_2 | Environmental | Open in IMG/M |
| 3300012035 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT338_2 | Environmental | Open in IMG/M |
| 3300012038 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT800_2 | Environmental | Open in IMG/M |
| 3300012039 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT534_2 | Environmental | Open in IMG/M |
| 3300012143 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT790_2 | Environmental | Open in IMG/M |
| 3300012146 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT400_2 | Environmental | Open in IMG/M |
| 3300012157 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT760_2 | Environmental | Open in IMG/M |
| 3300012160 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT630_2 | Environmental | Open in IMG/M |
| 3300012161 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT300_2 | Environmental | Open in IMG/M |
| 3300012164 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT730_2 | Environmental | Open in IMG/M |
| 3300012175 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT399_2 | Environmental | Open in IMG/M |
| 3300012179 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT262_2 | Environmental | Open in IMG/M |
| 3300012672 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT266_2 | Environmental | Open in IMG/M |
| 3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
| 3300014315 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleC_D1 | Environmental | Open in IMG/M |
| 3300014324 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleA_D1 | Environmental | Open in IMG/M |
| 3300014861 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT27_16_10D | Environmental | Open in IMG/M |
| 3300014865 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT499_16_10D | Environmental | Open in IMG/M |
| 3300014870 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT560_16_10D | Environmental | Open in IMG/M |
| 3300014873 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT200B_16_10D | Environmental | Open in IMG/M |
| 3300014874 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT660_2_16_10D | Environmental | Open in IMG/M |
| 3300015254 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT860_16_10D | Environmental | Open in IMG/M |
| 3300015256 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT333_16_10D | Environmental | Open in IMG/M |
| 3300015259 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT730_16_10D | Environmental | Open in IMG/M |
| 3300017939 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_10_MG | Environmental | Open in IMG/M |
| 3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
| 3300018031 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1 | Environmental | Open in IMG/M |
| 3300018063 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2 | Environmental | Open in IMG/M |
| 3300018077 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b1 | Environmental | Open in IMG/M |
| 3300018082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2 | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300021332 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Oregon, United States ? S.384 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022226 | Sediment microbial communities from San Francisco Bay, California, United States - SF_May12_sed_USGS_13 | Environmental | Open in IMG/M |
| 3300025159 | Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 3 | Environmental | Open in IMG/M |
| 3300025165 | Soil microbial communities from Rifle, Colorado, USA - sediment 10ft 1 | Environmental | Open in IMG/M |
| 3300025173 | Wastewater microbial communities from Netherlands to study Microbial Dark Matter (Phase II) - VDW unchlorinated drinking water (SPAdes) | Environmental | Open in IMG/M |
| 3300025311 | Groundwater microbial communities from Rifle, Colorado - Rifle CSP2_plank lowO2_0.2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025318 | Soil microbial communities from Rifle, Colorado, USA - sediment 13ft 1 | Environmental | Open in IMG/M |
| 3300025325 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025957 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqB_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025959 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqB_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025985 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqC_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300026452 | Sediment microbial communities from tidal freshwater marsh on Altamaha River, Georgia, United States - 7-17 PU4 | Environmental | Open in IMG/M |
| 3300027573 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT100 (SPAdes) | Environmental | Open in IMG/M |
| 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300031965 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185 | Environmental | Open in IMG/M |
| 3300032144 | Garden soil microbial communities collected in Santa Monica, California, United States - Edamame soil | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300033233 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_bottom | Environmental | Open in IMG/M |
| 3300033407 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT140D175 | Environmental | Open in IMG/M |
| 3300033408 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day20_noCT | Environmental | Open in IMG/M |
| 3300033483 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D1_A | Environmental | Open in IMG/M |
| 3300033513 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_C | Environmental | Open in IMG/M |
| 3300033813 | Sediment microbial communities from East River floodplain, Colorado, United States - 30_j17 | Environmental | Open in IMG/M |
| 3300033814 | Sediment microbial communities from East River floodplain, Colorado, United States - 55_j17 | Environmental | Open in IMG/M |
| 3300033815 | Sediment microbial communities from East River floodplain, Colorado, United States - 31_s17 | Environmental | Open in IMG/M |
| 3300034148 | Sediment microbial communities from East River floodplain, Colorado, United States - 18_j17 | Environmental | Open in IMG/M |
| 3300034165 | Sediment microbial communities from East River floodplain, Colorado, United States - 19_s17 | Environmental | Open in IMG/M |
| 3300034178 | Sediment microbial communities from East River floodplain, Colorado, United States - 27_j17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| C687J26623_100309444 | 3300002122 | Soil | QGFVAPLANIPDIGCGSLRALSQNRDSASRVSLG* |
| Ga0074479_103035471 | 3300005829 | Sediment (Intertidal) | AHGFVAPLANIRDIGGGSLRALSQNRDSASRVSLC* |
| Ga0074479_103136671 | 3300005829 | Sediment (Intertidal) | MKIQGLARILAQGFVAPLANIRDIGGGSLRALSQNRDSASRVSLC* |
| Ga0074479_105296218 | 3300005829 | Sediment (Intertidal) | LAQGFVAPLANIRDIGGGSLRALSQNRDSASRVSLC* |
| Ga0075420_1003935811 | 3300006853 | Populus Rhizosphere | AHGFVARLANIAYMGCGSLRALSQNRDSASCVSLC* |
| Ga0102851_100746421 | 3300009091 | Freshwater Wetlands | QPFGLARVLAHDIVAPLANIRDIGCGKLRVLSQNRASASRVSLCYGL* |
| Ga0105347_10001381 | 3300009609 | Soil | MTTQGLARVLAHGFVAPLANIPDIGCGSLRALSQNRDSASRVS |
| Ga0105347_10014611 | 3300009609 | Soil | QGLARVLAHGFVAPLANIPDIGCGSLRALSQNRDSASRVSSC* |
| Ga0105347_11970842 | 3300009609 | Soil | GLARILAHGIVANLVNIPDIHCGPLRALSQNRASAARESLC* |
| Ga0105347_13940931 | 3300009609 | Soil | QGLARVLAHGFVAPLANIPDIGCGSLRALSQNRDSASRVSLC* |
| Ga0105340_10152271 | 3300009610 | Soil | MEYPMIIQGLARVLAHGFVARLANMAYMGCGSLRALSQNRDSAARV |
| Ga0105340_11284121 | 3300009610 | Soil | MEYPMFIQGLARVLAHGFVARLANMAYMGCGSLRALSQNRDSAARV |
| Ga0105252_100410761 | 3300009678 | Soil | IQGLARVLAHGFVARLANIAYMGCGSLRALSQNRDSAARVSLC* |
| Ga0105252_100411041 | 3300009678 | Soil | QAMEYPMTIQGLARVLAHGFVARLANMAYMGRGSLRALSQNRDSAARVSLC* |
| Ga0105252_103957441 | 3300009678 | Soil | VLAHGFVAHLTNIPDIGCGSLRALSQNRDSASRVSLC* |
| Ga0105079_10424171 | 3300009805 | Groundwater Sand | MLIQGLARILAQGFVAPLANIRDIGGGSLRALSQNRDSASRVSL |
| Ga0105061_10543351 | 3300009807 | Groundwater Sand | GLARVLAHGFVAHLANIRDIGCGSLRALSQNRDSASRVSSCQGL* |
| Ga0105071_10845111 | 3300009808 | Groundwater Sand | AFEYPMLIQGLARVLAQGFVAPLANIPDIGYGSLRALSQNRDSASRVSLC* |
| Ga0105057_10223263 | 3300009813 | Groundwater Sand | MVIQGLARILAQGFVAPLANIPDIGGGSLRALSQNRDSASRVSSC* |
| Ga0105076_10720051 | 3300009816 | Groundwater Sand | MAIQGLARVLAHGFVAHLANIRDIGCGSLRALSQNR |
| Ga0136847_125240451 | 3300010391 | Freshwater Sediment | MLIQGLARVLAQSFVAHLANIRDIGGGSLRALSQNRDSASRVSSC |
| Ga0137315_10001101 | 3300011395 | Soil | MTTQGLARVLAHGFVAHLTNIPDIGCGSLRALSQNRDSASR |
| Ga0137348_10127721 | 3300011398 | Soil | MASQGLARVLAHGFVAPLANIPDIGCGSLRALSQNRDSASRVS |
| Ga0137348_10246041 | 3300011398 | Soil | VLAHGFVAPLAHIPDMGCGSLRALSQNRDSASRVSLC* |
| Ga0137356_11049812 | 3300011402 | Soil | VLAHGFVARLANIPDIGCGSLRALSQNRDSASRVSLC* |
| Ga0137313_10029863 | 3300011403 | Soil | MTTQELARVLAHGFVAPLANIPDIGCGSLRALSQNRDSASR |
| Ga0137313_10037121 | 3300011403 | Soil | MTTQELARVLAHGFVAPLANIPDIGCGSLRALSQNRDSASRISLC* |
| Ga0137340_10045851 | 3300011405 | Soil | IQGLARILAHGFVASLANIPDIGCGSLRALSQNRDSASRVSSC* |
| Ga0137323_10106135 | 3300011409 | Soil | RILAHGFVAHLTNIPDIGCGSLRALSQNRDSASRVSLC* |
| Ga0137325_10276751 | 3300011415 | Soil | VLAHGFVAHLTNIPDMGCGSLRALSQNRDSASRVSLC* |
| Ga0137325_10693451 | 3300011415 | Soil | MTTQGLARVLAHGFVAHLTNIPDIGCGSLRALSQNRDSASRVS |
| Ga0137422_10892731 | 3300011416 | Soil | MSSQGLAEVLAHGFVAHLTNIPDIGCGSLRALSQNRDSASRV |
| Ga0137314_10383561 | 3300011420 | Soil | IQGLARVLAHGFVARLANMAYMGCGSLRALSQNRDSAARVSLC* |
| Ga0137425_10246851 | 3300011422 | Soil | SEYPRAAQGLARVLAQGFVAHLANMAYMGCGSLRALSQNRDSASRVSLC* |
| Ga0137448_10233713 | 3300011427 | Soil | VLAQGFVARLANIRDIVCVALRALSQNRASAARVSF* |
| Ga0137448_10252452 | 3300011427 | Soil | VLAQGFVARLANIRDIVCVALRALSQNRASAARVSLC* |
| Ga0137448_10795311 | 3300011427 | Soil | MKPGGLARVLAQGFVARLANIRDIVCVALRALSQNRASAARV |
| Ga0137456_11068301 | 3300011428 | Soil | ARVLAQGFVARLANIRDIVCVALRALSQNRASAAWVSF* |
| Ga0137423_10373443 | 3300011430 | Soil | AHGFVAPLANIPDIGCGSLRALSQNRDSASRVSLC* |
| Ga0137423_10400881 | 3300011430 | Soil | QGLARVLAHGFVAPLAHIPDMGCGSLRALSQNRDSASRVSLC* |
| Ga0137428_10612401 | 3300011432 | Soil | LARVLAHGFVAPLANIPDIGCGSLRALSQNRDSASRVSLC* |
| Ga0137443_11605631 | 3300011433 | Soil | QPGGLARVLAQGFVARLANIRDIVCVALRALSQNRASAARVLSR* |
| Ga0137429_10456144 | 3300011437 | Soil | LAHGFVAHLTNIPDIGCGSLRALSQNRDSASRVSLC* |
| Ga0137429_11078712 | 3300011437 | Soil | YLMIIQGLARVLAHGFVARLANMTYMGCSSLRALSQNRDSASCVSLC* |
| Ga0137429_12937252 | 3300011437 | Soil | EYSTAIQGLARVLAHGFVARLANIAYMGCGSLRALSQNRDSASCVSLC* |
| Ga0137432_10687941 | 3300011439 | Soil | IQGLARVLAHGFVARLANMAYMGCGSLRALSQNRDSASCVSLC* |
| Ga0137433_10677321 | 3300011440 | Soil | ILAHGFVAPLANIPDIGCGSLRALSQNRDSASRVSLC* |
| Ga0137452_12178832 | 3300011441 | Soil | PMIIQGLTRVLAHGFVARLANMAYMGCGSLRALSQNRDSAARVSLC* |
| Ga0137427_100709751 | 3300011445 | Soil | MITQGLARVLAHGFVARLANMAYMGCGSLRALSQNRDSASCVS |
| Ga0137427_103170371 | 3300011445 | Soil | MATQGLARVLAQGFVAHLTNIPDMGCGSLRALSQNRDSASRVSL |
| Ga0137445_11312872 | 3300012035 | Soil | RFWPQPGGLARVLAQGFVARLANIRDIVCVALRALSQNRASAARVSF* |
| Ga0137431_11549622 | 3300012038 | Soil | EYPMATQGLARVLAQGFVAHLANIPDIGCGSLRALSQNRDSASRVSLC* |
| Ga0137421_10445231 | 3300012039 | Soil | HGFVAHLTNIPDIGCGSLRALSQNRDSASRVSLC* |
| Ga0137354_10281561 | 3300012143 | Soil | MAIQGLARVLAHGFVAPLAHIPDMGCGSLRALSQNRDSASRVS |
| Ga0137322_10816551 | 3300012146 | Soil | MTTQGLARVLAHGFVAPLANIPDIGCGSLRALSQNRDSAS |
| Ga0137353_10494661 | 3300012157 | Soil | IQGLARVLAHGFVAHLTNIPDIGCGSLRALSQNRDSASRVSLC* |
| Ga0137349_10861021 | 3300012160 | Soil | MSRGLARVLAQGFVAHLTNIPDIGCGSLRALSQNRDSA |
| Ga0137336_10499651 | 3300012161 | Soil | ILAHGFVAPLAHIPDIGRGSLRALSQNRDSASRVSLC* |
| Ga0137352_11102401 | 3300012164 | Soil | HGFVARLANIPDIGCGSLRTLSQNRDSASRVSWR* |
| Ga0137321_10683341 | 3300012175 | Soil | MIVRGLARVLAHGFVARPANIAYMGCGSLRALSQNRDSASCVSLC* |
| Ga0137321_11072122 | 3300012175 | Soil | LAHGFVAPLANIPDIGCGSLRALSQNRDSASRVSLC* |
| Ga0137334_11654011 | 3300012179 | Soil | HGFVAPLANIPDIGCGSLRALSQNRDSASRVSLS* |
| Ga0137317_10297281 | 3300012672 | Soil | HGFVARLANIAYMGCGSLRALSQNRDSASCVSLC* |
| Ga0153915_107481362 | 3300012931 | Freshwater Wetlands | GLARILAHGFVAHLVNIRDIHCGELRALSQNRDSASRGSLCQAL* |
| Ga0153915_115045731 | 3300012931 | Freshwater Wetlands | ARILAHGFVASLVNIRDIHCGQLRALSQNRDSASRVSLC* |
| Ga0153915_115070462 | 3300012931 | Freshwater Wetlands | GLARILAHGFVAHLVNIRDIHCGELRALSQNRDSASRGSLC* |
| Ga0153915_117031492 | 3300012931 | Freshwater Wetlands | RRFWLQPFGLARVLAHGIVASLANIRDIGCGQLRALSQNRASASRVSLGYGLL* |
| Ga0075350_11362331 | 3300014315 | Natural And Restored Wetlands | FGLARVLAHGIVAPLANIRDIDCGELRALSQNRASASRVSLC* |
| Ga0075352_10978092 | 3300014324 | Natural And Restored Wetlands | MAIQGLARVLAQGFVAPLANIRDIGGGSLRALSQNRDSASRV |
| Ga0075352_11181201 | 3300014324 | Natural And Restored Wetlands | MVIQGLARILAQGFVAPLANIRDIGGGSLRALSQNRDSASRVSLC* |
| Ga0180061_10781721 | 3300014861 | Soil | MVIQGLARVLAHGFVARLANIAYMGCGSLRALSQNRDSASC |
| Ga0180078_10180571 | 3300014865 | Soil | QGLARVLAQGFVAPLANIPDIGCGSLRALSQNRDSALRVSLC* |
| Ga0180080_10408141 | 3300014870 | Soil | MVIQGLARVLAQGFVAPLANIPDIGCGSLRALSHNRDSALR |
| Ga0180066_10051361 | 3300014873 | Soil | IQGLARVLAQGFVAPLANIPDIGCGSLRALSQNRDSASRVSLC* |
| Ga0180066_10919523 | 3300014873 | Soil | MVIQGLARILAQSFVAPLANIPDIGCGSLRALSQNR |
| Ga0180084_10590792 | 3300014874 | Soil | LAQGFVASLANIPDIGCGSLRALSQNRDSASRVSLC* |
| Ga0180089_10529521 | 3300015254 | Soil | YPMVIQGLARVLAQGFVAPLANIPDIGCGSLRALSQNRDSALRVSLC* |
| Ga0180073_10481481 | 3300015256 | Soil | ILAQGFVAPLANIPDIGCGSLRALSQNRDSASRVSSC* |
| Ga0180073_11080331 | 3300015256 | Soil | RILAQGFVAPLANIPDIGCGSLRALSQNRDSASRVSLS* |
| Ga0180085_10827881 | 3300015259 | Soil | MVIQGLARVLAQGFVAPLANIPDIGCGSLRALSQNRDSALRVSLC |
| Ga0187775_102005791 | 3300017939 | Tropical Peatland | ASEQPTPMRGLARILAHGFVARLDHIPDMACGSLGALSQNRDSASRVSLC |
| Ga0187776_110901491 | 3300017966 | Tropical Peatland | MRGLARILAHGFVARLDHIPDMACGSLGALSQNRDSASRVSLC |
| Ga0184634_100037311 | 3300018031 | Groundwater Sediment | VLAQGFVAPLANIPDIGGGSLRALSQNRDSASRVSLC |
| Ga0184637_101293501 | 3300018063 | Groundwater Sediment | VLAQGFVAPLANIPDIGCGSLRALSQNRDSASRVSLC |
| Ga0184637_102221721 | 3300018063 | Groundwater Sediment | FQGLARVLAHGFVAHLAHIPDMGGGSLRALSQNRDSASRVSLC |
| Ga0184637_102358191 | 3300018063 | Groundwater Sediment | MLIQGLARVLAQGFVAPLANIPDIGCGSLRALSQNRDSASRV |
| Ga0184637_103875353 | 3300018063 | Groundwater Sediment | QGLARVLAHGFVARLANIAYMGCGSLRALSQNRDSASRVSSC |
| Ga0184637_105982943 | 3300018063 | Groundwater Sediment | MIIQGLARVLAHGFVAHLADIPDMGGGSLRALSQNRDSASRVSLC |
| Ga0184637_106446652 | 3300018063 | Groundwater Sediment | MIIQGLARVLAQGFVARLAYIPDMGGGSLRALSQNRDSASRVSSC |
| Ga0184633_100404231 | 3300018077 | Groundwater Sediment | VLAQGFVAPLANIPDIGCGSLRALSQNRDSASRVSSC |
| Ga0184633_100838651 | 3300018077 | Groundwater Sediment | MIIQGLARILAQGFVAPLANIPDIGCGSLRALSQNRDSASRV |
| Ga0184633_102078523 | 3300018077 | Groundwater Sediment | MLIQGLARVLAQGFVAPLANIPDIGCGSLRALSQNRDSAS |
| Ga0184633_102867261 | 3300018077 | Groundwater Sediment | ILAQSFVAPLANIPDIGGGSLRALSQNRDSASRVSSC |
| Ga0184633_103412233 | 3300018077 | Groundwater Sediment | AQSFVAHLANILDMGGGSLRALSQNRDSASRVSLC |
| Ga0184639_106335641 | 3300018082 | Groundwater Sediment | IQGLARVLAQGFVAPLANIPDIGGGSLRALSQNRDSALRVSLC |
| Ga0190270_100992231 | 3300018469 | Soil | IFEYQTTFQGLARVLAQGFVASLANIPDMGCGSLRALSQNRDSASRVSWC |
| Ga0190270_101732451 | 3300018469 | Soil | IQGLARVLAHGFVARLANMTYMGCGSLRALSQNRDSAARVSSC |
| Ga0210339_16972722 | 3300021332 | Estuarine | WLQPFGLARILAHGFVAHLVNIRDIHCGELRALSQNRASASRVSLC |
| Ga0224512_104407401 | 3300022226 | Sediment | GLARILAHGFVAHLANIRDIGCGELRALSQNRASASRVSLCYGL |
| Ga0209619_100631553 | 3300025159 | Soil | VLAQGFVAPLANIPDIGCGSLRALSQNRDSASRVS |
| Ga0209619_104280843 | 3300025159 | Soil | MAIQGLARVLAQGFVAPLANIPDIGCGSLRALSQNRDSAS |
| Ga0209108_100956511 | 3300025165 | Soil | MLIQGLARVLAQSFVAPLANIPDIGCGSLRALSQNRDSASRVS |
| Ga0209824_101410542 | 3300025173 | Wastewater | RFWPQPGGLARVLAQGFVARLANIRDIVCVALRALSQNRASVARVSF |
| Ga0209343_102975121 | 3300025311 | Groundwater | RPLWLQPFGLARILAHDFVAHLVNIRDIHRGSLRVLSQNRASAARGSLC |
| Ga0209519_104974871 | 3300025318 | Soil | RVLAQGFVAPLANIPDIGCGSLRALSQNRDSASRVSLC |
| Ga0209341_103393821 | 3300025325 | Soil | EGLARVFAHGFVAHLANIRDIGCGELRALSENRDSASRVSLC |
| Ga0210089_10392451 | 3300025957 | Natural And Restored Wetlands | AKVFEYSIIIQGLARILAHSFVAPLANIRDIGGGSLRALSQNRDSASRVSSC |
| Ga0210116_10742672 | 3300025959 | Natural And Restored Wetlands | EYPNAKQGLARILAHGFVARLANIPDIGGGSLRALSQNRDSASRVSLC |
| Ga0210117_10048822 | 3300025985 | Natural And Restored Wetlands | MVIQGLARILAQGFVAPLANIRDIGGGSLRALSQNRDSASRVSSC |
| Ga0256821_10398741 | 3300026452 | Sediment | LARVLAQDFVAHLANIRDIGCGSLRALSQNRDSASRVSLC |
| Ga0208454_10033481 | 3300027573 | Soil | LAHGFVAHLTNIPDIGCGSLRALSQNRDSASRVSLC |
| Ga0208454_10049871 | 3300027573 | Soil | MITQGLARVLAHGFVARLANMAYMGCGSLRALSQN |
| Ga0208454_10304883 | 3300027573 | Soil | MIIQGLARVLAHGFVARLANMAYMGCGSLRALSQNRDSASC |
| Ga0209974_104379161 | 3300027876 | Arabidopsis Thaliana Rhizosphere | ASEYLTIFLGLARVLAHGFVARLANIAYMGCGSLRALSQNRDSASRVSLC |
| Ga0326597_102141651 | 3300031965 | Soil | LAQGFVAPLANIPDIGCGSLRALSQNRDSASRVSSC |
| Ga0326597_105753711 | 3300031965 | Soil | GLARILAHGFVAPLANIRDIGCGELRALSQNRDSASRVSLCYRL |
| Ga0315910_111775381 | 3300032144 | Soil | AGLARILAHGFVARLANMGYMGCGSLRALSQNRDSASRVSLC |
| Ga0315910_113758692 | 3300032144 | Soil | MGLARIFAHGFVARLANMGYMGCGSLRALSKNRDSASRVSL |
| Ga0335084_106051103 | 3300033004 | Soil | YRPVLPLPEGLARIFAHGIVARLAKVTYLGCAELRTLGKNRDSASRVSLC |
| Ga0334722_111198392 | 3300033233 | Sediment | MLIQGLARVLAQGFVAHLANIRDIGGGSLRALSQNRDSASRVSLC |
| Ga0334722_113306271 | 3300033233 | Sediment | VLAHGFVTHLANIRDIGGGSLRALSQNRDSASRVSSCLGLWVAGESGLRL |
| Ga0214472_111855022 | 3300033407 | Soil | IQGLARILAQGIVAPLANIPDIGCGSLRALSQNRDSASRVSLC |
| Ga0316605_114716771 | 3300033408 | Soil | ARVLAHGIVAPLANIRDIGCGELRALSQNRDSASRVSLC |
| Ga0316629_108266021 | 3300033483 | Soil | FWLQPFGLARILAHGIVAPLANIRDIGCGELRALSQNRDSALRVSSC |
| Ga0316628_1012146311 | 3300033513 | Soil | FAHGFVANLAHIRDMGCGSLRALSENRDSASRVSLC |
| Ga0316628_1039487572 | 3300033513 | Soil | AHGFVANLAHIRDMGCGSLRALSENRDSASRVSLC |
| Ga0364928_0006474_1913_2050 | 3300033813 | Sediment | MLIQGLARVLAQSFVAPLANIPDIGGGSLRALSQNRDSASRVSLC |
| Ga0364928_0024870_1002_1139 | 3300033813 | Sediment | MVIQGLARVLAQGFVAPLANIPDIGCGSLRALSQNRDSASRVSSC |
| Ga0364930_0002268_174_305 | 3300033814 | Sediment | MLIQGLARVLAQGFVAPLANIPDIGCGSLRALSQNRDSASRVS |
| Ga0364946_057617_7_144 | 3300033815 | Sediment | MAIQGLARVLAQGFVAHLTNIPDIGCGSLRALSQNRDSASRVSLG |
| Ga0364946_135069_407_544 | 3300033815 | Sediment | MTSQGLARILAQGFVARLTNIPDIGCGSLRALSQNRDSASRVSLC |
| Ga0364927_0040446_60_197 | 3300034148 | Sediment | MSSQGLAEVLAHGFVAHLTNIPDIGCGSLRALSQNRDSASRVSLC |
| Ga0364942_0024113_1658_1795 | 3300034165 | Sediment | MVIQGLARILAQGFVAPLANIPDIGCGSLRALSQNRDSASRVSLC |
| Ga0364942_0147700_465_602 | 3300034165 | Sediment | MAIQGLARILAHGFVARLANIPDIGGGSLRALSQNRDSASRVSSC |
| Ga0364934_0038320_20_157 | 3300034178 | Sediment | MAIQGLARVLAQGFVAPLANIPDIGGGSLRALSQNRDSASRVSSC |
| Ga0364934_0193639_565_702 | 3300034178 | Sediment | MAIQGLARVLAQSFVAPLANIPDIGCGSLRALSQNRDSASRISLC |
| Ga0364934_0338883_347_484 | 3300034178 | Sediment | MVIQGLARVLAQGFVAHLANIRDIGCGSLRALSQNRDSASRVSSC |
| ⦗Top⦘ |