


| Basic Information | |
|---|---|
| Family ID | F056368 |
| Family Type | Metagenome |
| Number of Sequences | 137 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MGSFRKRLLVLIIGLVIVTQTVTLAAVLASTRRTVEARAAEQL |
| Number of Associated Samples | 124 |
| Number of Associated Scaffolds | 137 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 81.02 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 90.51 % |
| Associated GOLD sequencing projects | 122 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.55 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (94.161 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (32.847 % of family members) |
| Environment Ontology (ENVO) | Unclassified (30.657 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (38.686 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 57.75% β-sheet: 0.00% Coil/Unstructured: 42.25% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.55 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 137 Family Scaffolds |
|---|---|---|
| PF02775 | TPP_enzyme_C | 3.65 |
| PF09863 | DUF2090 | 0.73 |
| PF13620 | CarboxypepD_reg | 0.73 |
| PF13458 | Peripla_BP_6 | 0.73 |
| PF01855 | POR_N | 0.73 |
| PF00037 | Fer4 | 0.73 |
| COG ID | Name | Functional Category | % Frequency in 137 Family Scaffolds |
|---|---|---|---|
| COG0674 | Pyruvate:ferredoxin oxidoreductase or related 2-oxoacid:ferredoxin oxidoreductase, alpha subunit | Energy production and conversion [C] | 0.73 |
| COG4231 | TPP-dependent indolepyruvate ferredoxin oxidoreductase, alpha subunit | Energy production and conversion [C] | 0.73 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 94.16 % |
| Unclassified | root | N/A | 5.84 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001593|JGI12635J15846_10044333 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 3438 | Open in IMG/M |
| 3300001593|JGI12635J15846_10394930 | All Organisms → cellular organisms → Bacteria | 836 | Open in IMG/M |
| 3300001661|JGI12053J15887_10359556 | All Organisms → cellular organisms → Bacteria | 703 | Open in IMG/M |
| 3300005328|Ga0070676_10980814 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
| 3300005344|Ga0070661_101396268 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
| 3300005437|Ga0070710_10590028 | All Organisms → cellular organisms → Bacteria | 772 | Open in IMG/M |
| 3300005532|Ga0070739_10549032 | Not Available | 515 | Open in IMG/M |
| 3300005546|Ga0070696_101351688 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
| 3300005576|Ga0066708_10454930 | All Organisms → cellular organisms → Bacteria | 822 | Open in IMG/M |
| 3300005586|Ga0066691_10324676 | All Organisms → cellular organisms → Bacteria | 910 | Open in IMG/M |
| 3300005591|Ga0070761_10127231 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1482 | Open in IMG/M |
| 3300005610|Ga0070763_10664970 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
| 3300005764|Ga0066903_101370667 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1326 | Open in IMG/M |
| 3300005834|Ga0068851_10164135 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1222 | Open in IMG/M |
| 3300005836|Ga0074470_11102620 | All Organisms → cellular organisms → Bacteria | 956 | Open in IMG/M |
| 3300005844|Ga0068862_101035020 | All Organisms → cellular organisms → Bacteria | 813 | Open in IMG/M |
| 3300005921|Ga0070766_10938017 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
| 3300006034|Ga0066656_10795000 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
| 3300006893|Ga0073928_10162957 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1786 | Open in IMG/M |
| 3300009143|Ga0099792_10910688 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
| 3300009148|Ga0105243_12045523 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
| 3300009176|Ga0105242_13170523 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
| 3300009430|Ga0114938_1330638 | Not Available | 554 | Open in IMG/M |
| 3300009551|Ga0105238_10317428 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1544 | Open in IMG/M |
| 3300009665|Ga0116135_1166825 | All Organisms → cellular organisms → Bacteria | 829 | Open in IMG/M |
| 3300010361|Ga0126378_10456068 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1393 | Open in IMG/M |
| 3300010361|Ga0126378_12972348 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
| 3300010376|Ga0126381_103358421 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
| 3300010396|Ga0134126_10799787 | All Organisms → cellular organisms → Bacteria | 1066 | Open in IMG/M |
| 3300010399|Ga0134127_13134012 | Not Available | 540 | Open in IMG/M |
| 3300010403|Ga0134123_12326038 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
| 3300012203|Ga0137399_10949860 | All Organisms → cellular organisms → Bacteria | 724 | Open in IMG/M |
| 3300012205|Ga0137362_11783587 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 502 | Open in IMG/M |
| 3300012211|Ga0137377_10053334 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3743 | Open in IMG/M |
| 3300012929|Ga0137404_10291227 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1414 | Open in IMG/M |
| 3300012931|Ga0153915_10245884 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1980 | Open in IMG/M |
| 3300012971|Ga0126369_10824551 | All Organisms → cellular organisms → Bacteria | 1011 | Open in IMG/M |
| 3300012984|Ga0164309_10003478 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 7337 | Open in IMG/M |
| 3300014201|Ga0181537_11115716 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300014322|Ga0075355_1133935 | All Organisms → cellular organisms → Bacteria | 645 | Open in IMG/M |
| 3300014325|Ga0163163_10569362 | All Organisms → cellular organisms → Bacteria | 1196 | Open in IMG/M |
| 3300014501|Ga0182024_12578395 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300014745|Ga0157377_11445396 | Not Available | 544 | Open in IMG/M |
| 3300015054|Ga0137420_1497811 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1364 | Open in IMG/M |
| 3300015262|Ga0182007_10396416 | Not Available | 525 | Open in IMG/M |
| 3300016294|Ga0182041_11620844 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
| 3300016357|Ga0182032_11343584 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
| 3300016357|Ga0182032_11393931 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
| 3300017970|Ga0187783_10533159 | All Organisms → cellular organisms → Bacteria | 850 | Open in IMG/M |
| 3300017973|Ga0187780_10793431 | All Organisms → cellular organisms → Bacteria | 685 | Open in IMG/M |
| 3300017993|Ga0187823_10196857 | All Organisms → cellular organisms → Bacteria | 659 | Open in IMG/M |
| 3300017999|Ga0187767_10321675 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
| 3300018060|Ga0187765_10906580 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
| 3300020170|Ga0179594_10057148 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1330 | Open in IMG/M |
| 3300020199|Ga0179592_10419707 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
| 3300021170|Ga0210400_11622013 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
| 3300021377|Ga0213874_10098858 | All Organisms → cellular organisms → Bacteria | 968 | Open in IMG/M |
| 3300021402|Ga0210385_11340634 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300021403|Ga0210397_10368656 | All Organisms → cellular organisms → Bacteria | 1068 | Open in IMG/M |
| 3300021420|Ga0210394_10149415 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2029 | Open in IMG/M |
| 3300021420|Ga0210394_10960454 | All Organisms → cellular organisms → Bacteria | 742 | Open in IMG/M |
| 3300021432|Ga0210384_10125691 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2300 | Open in IMG/M |
| 3300021432|Ga0210384_10593114 | All Organisms → cellular organisms → Bacteria | 995 | Open in IMG/M |
| 3300021477|Ga0210398_11210173 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
| 3300021479|Ga0210410_10231952 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1655 | Open in IMG/M |
| 3300021559|Ga0210409_10545139 | All Organisms → cellular organisms → Bacteria | 1026 | Open in IMG/M |
| 3300021560|Ga0126371_10386137 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1540 | Open in IMG/M |
| 3300021560|Ga0126371_12226882 | All Organisms → cellular organisms → Bacteria | 661 | Open in IMG/M |
| 3300021560|Ga0126371_12637297 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
| 3300022897|Ga0247764_1219797 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
| 3300023275|Ga0247776_10111527 | All Organisms → cellular organisms → Bacteria | 1057 | Open in IMG/M |
| 3300025928|Ga0207700_11078809 | All Organisms → cellular organisms → Bacteria | 718 | Open in IMG/M |
| 3300025937|Ga0207669_10896141 | All Organisms → cellular organisms → Bacteria | 741 | Open in IMG/M |
| 3300025960|Ga0207651_10085332 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2291 | Open in IMG/M |
| 3300026061|Ga0208541_1029225 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
| 3300026088|Ga0207641_12472736 | Not Available | 518 | Open in IMG/M |
| 3300026118|Ga0207675_100758060 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 982 | Open in IMG/M |
| 3300026142|Ga0207698_11390446 | All Organisms → cellular organisms → Bacteria | 717 | Open in IMG/M |
| 3300026333|Ga0209158_1018221 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3222 | Open in IMG/M |
| 3300026376|Ga0257167_1078980 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 519 | Open in IMG/M |
| 3300027043|Ga0207800_1029766 | All Organisms → cellular organisms → Bacteria | 805 | Open in IMG/M |
| 3300027884|Ga0209275_10042655 | All Organisms → cellular organisms → Bacteria | 2146 | Open in IMG/M |
| 3300027894|Ga0209068_10366344 | All Organisms → cellular organisms → Bacteria | 818 | Open in IMG/M |
| 3300028808|Ga0302228_10089579 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1447 | Open in IMG/M |
| 3300028906|Ga0308309_11349045 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
| 3300030043|Ga0302306_10223892 | All Organisms → cellular organisms → Bacteria | 723 | Open in IMG/M |
| 3300030906|Ga0302314_10846472 | All Organisms → cellular organisms → Bacteria | 907 | Open in IMG/M |
| 3300031250|Ga0265331_10555684 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300031544|Ga0318534_10461112 | All Organisms → cellular organisms → Bacteria | 728 | Open in IMG/M |
| 3300031679|Ga0318561_10101473 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1512 | Open in IMG/M |
| 3300031680|Ga0318574_10288885 | All Organisms → cellular organisms → Bacteria | 952 | Open in IMG/M |
| 3300031681|Ga0318572_10332655 | All Organisms → cellular organisms → Bacteria | 900 | Open in IMG/M |
| 3300031682|Ga0318560_10008090 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 4412 | Open in IMG/M |
| 3300031716|Ga0310813_10169248 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1771 | Open in IMG/M |
| 3300031719|Ga0306917_10733123 | All Organisms → cellular organisms → Bacteria | 776 | Open in IMG/M |
| 3300031724|Ga0318500_10516023 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
| 3300031764|Ga0318535_10424210 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
| 3300031765|Ga0318554_10669047 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
| 3300031770|Ga0318521_10061367 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1974 | Open in IMG/M |
| 3300031778|Ga0318498_10029178 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2385 | Open in IMG/M |
| 3300031778|Ga0318498_10174551 | All Organisms → cellular organisms → Bacteria | 977 | Open in IMG/M |
| 3300031781|Ga0318547_10590518 | All Organisms → cellular organisms → Bacteria | 688 | Open in IMG/M |
| 3300031793|Ga0318548_10003923 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 5217 | Open in IMG/M |
| 3300031793|Ga0318548_10211558 | All Organisms → cellular organisms → Bacteria | 952 | Open in IMG/M |
| 3300031795|Ga0318557_10182138 | All Organisms → cellular organisms → Bacteria | 956 | Open in IMG/M |
| 3300031795|Ga0318557_10327587 | All Organisms → cellular organisms → Bacteria | 703 | Open in IMG/M |
| 3300031799|Ga0318565_10013235 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 3477 | Open in IMG/M |
| 3300031821|Ga0318567_10806160 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300031823|Ga0307478_10956946 | All Organisms → cellular organisms → Bacteria | 716 | Open in IMG/M |
| 3300031897|Ga0318520_10038158 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2455 | Open in IMG/M |
| 3300031897|Ga0318520_10826104 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
| 3300031912|Ga0306921_10513483 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1392 | Open in IMG/M |
| 3300031912|Ga0306921_10667914 | All Organisms → cellular organisms → Bacteria | 1197 | Open in IMG/M |
| 3300031945|Ga0310913_11002031 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
| 3300032001|Ga0306922_10649927 | All Organisms → cellular organisms → Bacteria | 1114 | Open in IMG/M |
| 3300032008|Ga0318562_10232841 | All Organisms → cellular organisms → Bacteria | 1069 | Open in IMG/M |
| 3300032008|Ga0318562_10759070 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
| 3300032009|Ga0318563_10083990 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales | 1667 | Open in IMG/M |
| 3300032025|Ga0318507_10177092 | All Organisms → cellular organisms → Bacteria | 917 | Open in IMG/M |
| 3300032035|Ga0310911_10166268 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1246 | Open in IMG/M |
| 3300032041|Ga0318549_10214775 | All Organisms → cellular organisms → Bacteria | 864 | Open in IMG/M |
| 3300032043|Ga0318556_10677425 | Not Available | 537 | Open in IMG/M |
| 3300032044|Ga0318558_10059312 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1714 | Open in IMG/M |
| 3300032054|Ga0318570_10066223 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales | 1529 | Open in IMG/M |
| 3300032060|Ga0318505_10119704 | All Organisms → cellular organisms → Bacteria | 1205 | Open in IMG/M |
| 3300032067|Ga0318524_10061233 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales | 1812 | Open in IMG/M |
| 3300032068|Ga0318553_10638399 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
| 3300032174|Ga0307470_11875858 | Not Available | 509 | Open in IMG/M |
| 3300032177|Ga0315276_11596054 | All Organisms → cellular organisms → Bacteria | 676 | Open in IMG/M |
| 3300032205|Ga0307472_100430350 | All Organisms → cellular organisms → Bacteria | 1114 | Open in IMG/M |
| 3300032261|Ga0306920_100487760 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1829 | Open in IMG/M |
| 3300032783|Ga0335079_10334876 | All Organisms → cellular organisms → Bacteria | 1644 | Open in IMG/M |
| 3300032805|Ga0335078_10441850 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1692 | Open in IMG/M |
| 3300033158|Ga0335077_12097027 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300033290|Ga0318519_10177910 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1203 | Open in IMG/M |
| 3300033412|Ga0310810_11158657 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
| 3300034894|Ga0373916_0052143 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 32.85% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.84% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.84% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.11% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.65% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.92% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.92% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.19% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.19% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.19% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.19% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.19% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.19% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 2.19% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.19% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 1.46% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.46% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 1.46% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.46% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.46% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.46% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.73% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.73% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.73% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.73% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.73% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater | 0.73% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.73% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 0.73% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.73% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.73% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.73% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.73% |
| Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.73% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.73% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.73% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.73% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.73% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.73% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.73% |
| Sediment Slurry | Engineered → Bioremediation → Metal → Unclassified → Unclassified → Sediment Slurry | 0.73% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
| 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005532 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1 | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Host-Associated | Open in IMG/M |
| 3300005836 | Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBB | Environmental | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009430 | Groundwater microbial communities from Big Spring, Nevada to study Microbial Dark Matter (Phase II) - Ash Meadows Big Spring | Environmental | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009665 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300014201 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaG | Environmental | Open in IMG/M |
| 3300014322 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_CattailA_D1 | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Host-Associated | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300017993 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_3 | Environmental | Open in IMG/M |
| 3300017999 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MG | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Host-Associated | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022897 | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L051-202B-4 | Environmental | Open in IMG/M |
| 3300023275 | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L199-509C-5 | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026061 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleB_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes) | Environmental | Open in IMG/M |
| 3300026376 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-02-B | Environmental | Open in IMG/M |
| 3300027043 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 11 (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028808 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_2 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300030043 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_1 | Environmental | Open in IMG/M |
| 3300030906 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N2_3 | Environmental | Open in IMG/M |
| 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Host-Associated | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031778 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
| 3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
| 3300031799 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21 | Environmental | Open in IMG/M |
| 3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
| 3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
| 3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
| 3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
| 3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
| 3300032054 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23 | Environmental | Open in IMG/M |
| 3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
| 3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
| 3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032177 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_0 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| 3300034894 | Uranium-contaminated sediment microbial communities from bioreactor in Oak Ridge, Tennessee, United States - A1A0.2 | Engineered | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12635J15846_100443331 | 3300001593 | Forest Soil | MGSFRKRLLVLIIGLVIVTQTVTLAAVLASTRRTVEARAAEQLRS |
| JGI12635J15846_103949301 | 3300001593 | Forest Soil | MGSFRKRLLVLIIGLVIVTQTVTLAAVLVSTQRTVEARAALELR |
| JGI12053J15887_103595561 | 3300001661 | Forest Soil | MGSFRKRLLVLIIGLVIVTQTVTLAAVLASTRRTVEARAAEQ |
| Ga0070676_109808141 | 3300005328 | Miscanthus Rhizosphere | MGSFRNRLLVLIIGLVIATQSVTLIAVLARVEGTVEGRAAEQLTA |
| Ga0070661_1013962681 | 3300005344 | Corn Rhizosphere | MGSFRKRLLVLIIGLVIVTQTVTLAAVLVSTAHDVEGRAAGELRSGGSFA |
| Ga0070710_105900281 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MGSFRKRLLVLIIGLVLVTQTVTLAAVLASTAHTVEGRAAAE |
| Ga0070739_105490321 | 3300005532 | Surface Soil | MGSFRKRLLVLIIGLVIVTQTVTLAAVLASTAHNVEARAAEQLRSGSSF |
| Ga0070696_1013516881 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | MGSFRNRLLVLIIGLVIATQSVTLIAVLARVEGTVEGRAAEQLTAGGKLIEQF |
| Ga0066708_104549302 | 3300005576 | Soil | MGSFRKRLLVLIIGLGVVTQTVTLAAVLVSTRHTVEARAAEQLRSGGAFAE |
| Ga0066691_103246762 | 3300005586 | Soil | MGSFRKRLLVLIIGLVIVTQTVTLAAVLASTRRTVEARAAEQLRSGGSLAE |
| Ga0070761_101272313 | 3300005591 | Soil | MGSFRKRLLVLIIGLVIVTQTVTLAAVLVSTRRTVEAR |
| Ga0070763_106649701 | 3300005610 | Soil | MNSFRKRLLVLIIGLVVVTQTVTLAAVLASTRRTVEARSWEQLRSGAGL |
| Ga0066903_1013706671 | 3300005764 | Tropical Forest Soil | MGSFRNRLLVLIIGLVIVTQTVTLAAVLLSTRRTVEAR |
| Ga0068851_101641353 | 3300005834 | Corn Rhizosphere | MGSFRKRLLVLIIGLVVVTQTVTLAAVLVSTAHDVEGRAAGELRSG |
| Ga0074470_111026201 | 3300005836 | Sediment (Intertidal) | MNSFRNRLLVLIIGLIAVTQTVTLVAVLESTRRSVETRAAEQLTAGTSYA |
| Ga0068862_1010350202 | 3300005844 | Switchgrass Rhizosphere | MRSFRKRLLVLIIGLVIVTQTVTLAAVLASTRRTVEARSWEQLRSGAGIAD |
| Ga0070766_109380171 | 3300005921 | Soil | MGSFRKRLLVLIIGLVIVTQTVTLAAVLASTRRTVEARAAEQLR |
| Ga0066656_107950002 | 3300006034 | Soil | MGSFRKRLLVLIIGLVIVTQTVTLAAVLISTRRTVEARAAE |
| Ga0073928_101629571 | 3300006893 | Iron-Sulfur Acid Spring | MGSFRKRLLVLIIGLVIVTQTVTLAAVLMSTRRTVEARAALEL |
| Ga0099792_109106881 | 3300009143 | Vadose Zone Soil | MGSFRKRLLVLIIGLVVVTQTVTLAAVLASTAHTVEGRAVQELRSGG |
| Ga0105243_120455231 | 3300009148 | Miscanthus Rhizosphere | MFHIRADAMGSFRNRLLVLIIGLVIVTQSVTLIAVLARVEQTVAGRASDELGS |
| Ga0105242_131705232 | 3300009176 | Miscanthus Rhizosphere | MFHIRADAMGSFRNRLLVLIIALVVVTQSVTLIAVLARVEQTVEGRA |
| Ga0114938_13306382 | 3300009430 | Groundwater | MRTFRNRLLVLIIGLVVVAQTVTLVAVLARTERDVRSRAAD |
| Ga0105238_103174281 | 3300009551 | Corn Rhizosphere | MGSFRKRLLVLIIGLVVVTQTVTLAAVLARTAHDVEGRAADELRSGGSF |
| Ga0116135_11668252 | 3300009665 | Peatland | MGSFRKRLLVLIIGLVIVTQTVTLAAVLASTAHNVEARAAEQLRSGGSFV |
| Ga0126378_104560681 | 3300010361 | Tropical Forest Soil | MGSFRKRLLLLIIGLVIVTQTVTLAAVLAITRRTVEARAAEQLRSGGAF |
| Ga0126378_129723482 | 3300010361 | Tropical Forest Soil | MGSFRKRLLVLIIGLVIVTQTVTLAAVLASTRGAVEERA |
| Ga0126381_1033584212 | 3300010376 | Tropical Forest Soil | MGSFRKRLLVLIIGLVIVTQTVTLAAVLASTRGTVEARAR |
| Ga0134126_107997871 | 3300010396 | Terrestrial Soil | MRSFRKRLLVLIIGLAVLTQTVTLFAVLASTARDVRARA |
| Ga0134127_131340121 | 3300010399 | Terrestrial Soil | MGSFRKRLLVLIIGLAVLTQTVTLFAVLASTSRNVQARGAEQLTAAGS |
| Ga0134123_123260382 | 3300010403 | Terrestrial Soil | VTSFRKRILVLIIGLIAVTRTVTLVAVLASTRRNVESRAAEQLAAGSSY |
| Ga0137399_109498601 | 3300012203 | Vadose Zone Soil | MGSFRKRLLVLIIGLVIVTQTVTLAAVLASTARTVEARAAEQLRSGG |
| Ga0137362_117835871 | 3300012205 | Vadose Zone Soil | MGSFRKRLLVLIIGLVIVTQTVTLAAVLASTRRTVEARA |
| Ga0137377_100533341 | 3300012211 | Vadose Zone Soil | MGSFRKRLLVLIIGLGVVTQTVTLAAVLVSTRQTVEARAAEQLRSG |
| Ga0137404_102912273 | 3300012929 | Vadose Zone Soil | MGSFRKRLLVLIIGLVIVTQTVTLAAVLASTRRTVEARAAEQL |
| Ga0153915_102458841 | 3300012931 | Freshwater Wetlands | MGSFRKRLLVLIIGLVVVTQTVTLAAVLASTAHTVEGRASDELR |
| Ga0126369_108245511 | 3300012971 | Tropical Forest Soil | MRSFRKRLLVLLIGLVIVTQTVTLAAVLLSTRRTVETRSGEQLRSGNAL |
| Ga0164309_100034787 | 3300012984 | Soil | MRSFRKRLLVLIIGLVIVTQTVTLAAVLASTRRTVEARSWEQ |
| Ga0181537_111157161 | 3300014201 | Bog | MRSFRKRLLVLIIGLVIVTQTVTLAAVLASTAHNVEARAVEQLRSGGT |
| Ga0075355_11339352 | 3300014322 | Natural And Restored Wetlands | MRSFRKRLLVLIIGLVIVTQTVTLAAVLASTRRAVETRSAAQLRSG |
| Ga0163163_105693621 | 3300014325 | Switchgrass Rhizosphere | MGSFRKRLLVLIIGLAIVTQTVTLAAVLASTAHNVEARAAEQLRSGSS |
| Ga0182024_125783951 | 3300014501 | Permafrost | MGSFRKRLLVLIIGLVVVTQTVTLAAVLASTAHNVEARAAEQLRS |
| Ga0157377_114453961 | 3300014745 | Miscanthus Rhizosphere | MNSFRNRLLVLIIGLIAVTQTVTLVAVLASTRRNV |
| Ga0137420_14978113 | 3300015054 | Vadose Zone Soil | VIIIRVCFHGSFRKRLLVLIIGLVVVTQTVTLAAVLASTAHTVEGRAAEQLRS |
| Ga0182007_103964161 | 3300015262 | Rhizosphere | MGSFRKRLLVLIIGLVVLTQTVTLAAVLASTSLNVQGRAGERLRAGG |
| Ga0182041_116208442 | 3300016294 | Soil | MGSFRNRLLVLTIGVVIVPQTVTLAAVLISTRQTGAARAA |
| Ga0182032_113435841 | 3300016357 | Soil | MGSFRNRLLVLIIGLVIVTQTVTLAAVLISTRQTVEVRA |
| Ga0182032_113939311 | 3300016357 | Soil | MGSFRNRLLVLIIGLVIVTQTVTLAAVLISTRQTVE |
| Ga0187783_105331592 | 3300017970 | Tropical Peatland | MGSFRNRLLVLIIGLVVVTQTVTLAAVLISTHRTVETRAAEQLRA |
| Ga0187780_107934311 | 3300017973 | Tropical Peatland | MGSFRNRLLVLIIGLVIVTQTVTLAAVLLSTRRTVEARAAEQL |
| Ga0187823_101968571 | 3300017993 | Freshwater Sediment | MRSFRNRLLVLIIGLDIVTQTVTLAAVLLSTRRTVEARAA |
| Ga0187767_103216751 | 3300017999 | Tropical Peatland | MGSFRNRLLVLIIGLVVVTQTVTLAAVLVSTRRTVETRAAEQL |
| Ga0187765_109065801 | 3300018060 | Tropical Peatland | MRSFRKRLLVLIIGLVVVTQTVTLAAVLASTRRTVEARSWEQL |
| Ga0179594_100571483 | 3300020170 | Vadose Zone Soil | MGSFRKRLLVLIIGLVIVTQTVTLAAVLASTRRTVEARAA |
| Ga0179592_104197071 | 3300020199 | Vadose Zone Soil | MGSFRKRLLVLIIGLVVVTQTVTLAAVLASTAHTVEGRAAQELRSGGS |
| Ga0210400_116220131 | 3300021170 | Soil | MGSFRKRLLVLIIGLVIVTQTVTLAAVLASTSTTV |
| Ga0213874_100988582 | 3300021377 | Plant Roots | MNSFRNRLLVLLIGLVVLIQTVTLFAVLARTSRNVEARAAEELRSGGSVVQQFV |
| Ga0210385_113406342 | 3300021402 | Soil | MGSFRKRLLVLIIGLVIVTQTVTLAAVLASTAHNVEARAAEQLRSG |
| Ga0210397_103686563 | 3300021403 | Soil | MRSFRKRLLVLIIGLVIVTQTVTLAAVLASTRRAVETRSAAQLRAGGSL |
| Ga0210394_101494153 | 3300021420 | Soil | MGSFRKRLLVLIIGLVIVTQTVTLAAVLASTRGAVEQRA |
| Ga0210394_109604542 | 3300021420 | Soil | MGSFRKRLLVLIIGLVIVTQTVTLAAVLASTAHNVEARAAEQLRSGGSFVQ |
| Ga0210384_101256911 | 3300021432 | Soil | MGDIFEGFMGSFRKRLLVLIIGLSVVTQTVTLAAVLISTRRTV |
| Ga0210384_105931141 | 3300021432 | Soil | MGSFRKRLLVLIIGLVIVTQTVTLAAVLASTRRTVE |
| Ga0210398_112101731 | 3300021477 | Soil | MRSFRKRLLVLLIGLVIVTQTVTLAAVLASTRRTVEARSWDQLRSGAAL |
| Ga0210410_102319523 | 3300021479 | Soil | MGSFRKRLLVLIIGLVIVTQTVTLAAVLASTRGAVEQRAKEQLGSG |
| Ga0210409_105451393 | 3300021559 | Soil | MGSFRKRLLALIIGLVVVTQTVTLAAVLASTRRTVEARAAEQLRS |
| Ga0126371_103861373 | 3300021560 | Tropical Forest Soil | MGSFRKRLLVLIIGLVIVTQTVTLAAVLASTRGTVEERAKE |
| Ga0126371_122268822 | 3300021560 | Tropical Forest Soil | MRSFRKRLLVLLIGLVIVTQTVTLAAVLLSTRRTVEARSAEQLRSG |
| Ga0126371_126372971 | 3300021560 | Tropical Forest Soil | MGSFRNRLLVLIIGLVIVTQTVTLAAVLLSTRRTVE |
| Ga0247764_12197971 | 3300022897 | Plant Litter | MGSFRNRLLVLIIGLVVVTQSVTLIAVLARVEQTVEGRAAGELGAGG |
| Ga0247776_101115271 | 3300023275 | Plant Litter | MGSFRKRLLVLIIGLVVVTQTVTLAAVLASIAHDVESRAAE |
| Ga0207700_110788091 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MGSFRNRLLVLIIGLVIVTQTVTLAAVLLSTRRTVEA |
| Ga0207669_108961412 | 3300025937 | Miscanthus Rhizosphere | MNSFRNRLLVLIIGLIAVTQTVTLVAVLASTRRNVEAR |
| Ga0207651_100853323 | 3300025960 | Switchgrass Rhizosphere | MNSFRNRLLVLIIGLIAVTQTVTLVAVLASTRRNVEA |
| Ga0208541_10292251 | 3300026061 | Natural And Restored Wetlands | MNSFRNRLLVLIIGLIAVTQTVTLVAVLESTRRSVEARAAEQLTA |
| Ga0207641_124727362 | 3300026088 | Switchgrass Rhizosphere | MGSFRNRLLVLIIGLVVVTQSVTLIAVLARVEQTVEGRAAGELGAGGA |
| Ga0207675_1007580601 | 3300026118 | Switchgrass Rhizosphere | MGSFRNQLLALIIGLIIVTQSVTLIAVLARVDGSVAQRATEQLESVSNFIE |
| Ga0207698_113904461 | 3300026142 | Corn Rhizosphere | MSSFRKRLLVLIIGLVVVTQTVTLAAVLASTAHNVAARAAEQLRSGSS |
| Ga0209158_10182211 | 3300026333 | Soil | MGSFRKRLLVLIIGLGVVTQTVTLAAVLVSTRHTVEARAAEQLRS |
| Ga0257167_10789801 | 3300026376 | Soil | MGSFRKRLLVLIIGLVIVTQTVTLAAVLASTRRTVEAR |
| Ga0207800_10297661 | 3300027043 | Tropical Forest Soil | MTSFRKRLLVLIIGLVIVTQTVTLAAVLLGTRQTVEARAAEQLRSGGTLA |
| Ga0209275_100426551 | 3300027884 | Soil | MGSFRKRLLVLIIGLVIVTQTVTLAAVLASTAHNV |
| Ga0209068_103663442 | 3300027894 | Watersheds | MRSFRKRLLVLIIGLVIVTQTVTLAAVLASTRRAVE |
| Ga0302228_100895791 | 3300028808 | Palsa | MGSFRNQLLAVIIGLVCVTQTVTLIAVLARTEHSVEERAAKQLV |
| Ga0308309_113490452 | 3300028906 | Soil | MNSFRKRLLVLIIGLVVVTQTVTLAAVLASTRRTVEARSWEQ |
| Ga0302306_102238922 | 3300030043 | Palsa | MGSFRNRLLAVIIGLVCVTQTVTLIAVLARTEHSVQERAAKQLVAGS |
| Ga0302314_108464722 | 3300030906 | Palsa | MGSFRKRLLVLIIGLVIVTQTVTLAAVLASTAHNVEARAAEQLRSGGSFVE |
| Ga0265331_105556842 | 3300031250 | Rhizosphere | MGSFRKRLLVLIIGLVIVTQTVTLAAVLASTAHDVQARAAEQLRSGG |
| Ga0318534_104611121 | 3300031544 | Soil | MGSFRNRLLVLIIGLVIVTETVTLAAVLISTRRTVEAR |
| Ga0318561_101014733 | 3300031679 | Soil | MGSFRNRLLVLIIGLVIVTQTVTLAAVLLSTRRTV |
| Ga0318574_102888851 | 3300031680 | Soil | MNSFRNRLLVLIVGLVIVTQTVTFFAVAARTQRDVEA |
| Ga0318572_103326552 | 3300031681 | Soil | MGSFRKRLLVLIIGLSVVTQTVTLAAVLISTRQTVQA |
| Ga0318560_100080901 | 3300031682 | Soil | MGSFRNRLLVLIIGLVIVTQTVTLAAVLISTRQTVEVR |
| Ga0310813_101692481 | 3300031716 | Soil | MSSFRNRLLVLIIGLVIVTQTVTLAAVLLSTRRTVEARAAE |
| Ga0306917_107331232 | 3300031719 | Soil | MGRFRNRLLVLIIGLVIVTQTVTLAAVLISTRRMV |
| Ga0318500_105160231 | 3300031724 | Soil | MGSFRNRLLVLIIGLVIVTQTVTLAAVLLSTRRTVEARAAEQLR |
| Ga0318535_104242102 | 3300031764 | Soil | MGSFRNRLLVLIIGLVIVTETVTLAAVLISTRRTVEARAAEQM |
| Ga0318554_106690471 | 3300031765 | Soil | MGSFRNRLLVLIIGLVIVTQTVTLAAVLLSTRRTVEARAAEELRAGGTLAEH |
| Ga0318521_100613673 | 3300031770 | Soil | MGRFRNRLLVLIIGLVIVTQTVTLAAVLISTRRMVETRA |
| Ga0318498_100291781 | 3300031778 | Soil | MGRFRNRLLVLIIGLVIVTQTVTLAAVLISTRRTVETRAAEQLR |
| Ga0318498_101745511 | 3300031778 | Soil | MNSFRNRLLVLIVGLVIVTQTVTFFAVAARTQRDVEARAAE |
| Ga0318547_105905182 | 3300031781 | Soil | MGSFRNRLLVLIIGLVIVTQFVTLAAVLLSTRRTVEARAAEELRTGGALA |
| Ga0318548_100039231 | 3300031793 | Soil | MSSFRNRLLVLIIGLVIVTQTVTLAAVLISTRRMVEARAAEQL |
| Ga0318548_102115581 | 3300031793 | Soil | MGSFRNRLLVLIIGLVIVTETVTLAAVMISTRRTVEARAAEQMR |
| Ga0318557_101821381 | 3300031795 | Soil | MGRFRNRLLVLIIGLVIVTQTVTLAAVLISTRRTVETRAAEQLRSGGT |
| Ga0318557_103275872 | 3300031795 | Soil | MGRFRNRLLVLIIGLVIVTQTVTLAAVLISTRRMVETRAAEQLRSGATL |
| Ga0318565_100132355 | 3300031799 | Soil | MGRFRNRLLVLIIGLVIVTQTVTLAAVLISTRRTV |
| Ga0318567_108061602 | 3300031821 | Soil | MGSFRNRLLVLIIGLVIVTQTVTLAAVLISTRQTV |
| Ga0307478_109569461 | 3300031823 | Hardwood Forest Soil | MGSFRNRFLVLIIGLVIVTQTVTLAAVLLSTRRTVEARAAEQLRAGGTL |
| Ga0318520_100381584 | 3300031897 | Soil | MGRFRNRLLVLIIGLVIVTQTVTLAAVLISTRRTVEARAAEQLRS |
| Ga0318520_108261041 | 3300031897 | Soil | MGSFRNRLLVLIIGLVIVTETVTLAAVLISTRRTVEARAAE |
| Ga0306921_105134833 | 3300031912 | Soil | MGRFRNRLLVLIIGLVIVTQTVTLAAVLISTRRTVEARAAEQLRSG |
| Ga0306921_106679143 | 3300031912 | Soil | MGSFRKRLLVLIIGLSVVTQTVTLAAVLISTRQTVQARAAEE |
| Ga0310913_110020311 | 3300031945 | Soil | MGSFRNRLLVLIIGLVIVTQTVTLAAVLISTRRTVEARAAEQLRSGGA |
| Ga0306922_106499273 | 3300032001 | Soil | MNSFRNRLLVLIVGLVIVTQTVTFFAVAARTQRDVEAR |
| Ga0318562_102328413 | 3300032008 | Soil | MGSFRNRLLVLIIGLVIVTQTVTLAAVLLSTRRTVEARAAEQLRSGAALAD |
| Ga0318562_107590702 | 3300032008 | Soil | MGSFRNRLLVLIIGLVIVTETVTLAAVLISTRRTVEARAAEQMRSGAA |
| Ga0318563_100839901 | 3300032009 | Soil | MGRFRNRLLVLIIGLVIVTQTVTLAAVLISTRRTVEAR |
| Ga0318507_101770921 | 3300032025 | Soil | MGSFRNRLLVLIIGLVIVTQTVTLAAVLISTRRTVE |
| Ga0310911_101662681 | 3300032035 | Soil | MGSFRNRLLVLIIGLVIVTQTVTLAAVLISTRQTVEAR |
| Ga0318549_102147752 | 3300032041 | Soil | MGRFRNRLLVLIIGLVIVTQTVTLAAVLISTRRTVEARAAEQLR |
| Ga0318556_106774251 | 3300032043 | Soil | MNSFRNRVLVLIVGLVIVTQTVTFFAVAARTQRDVQARAAEQ |
| Ga0318558_100593123 | 3300032044 | Soil | MGSFRNRLLVLIIGLVIVTQTVTLAAVLISTRRTV |
| Ga0318570_100662233 | 3300032054 | Soil | MGRFRNRLLVLIIGLVIVTQTVTLAAVLISTRRTVEARAAEQLRSGGTLA |
| Ga0318505_101197041 | 3300032060 | Soil | MGSFRKRLLVLIIGLSVVTQTVTLAAVLISTRQTVQARAAEELRSGG |
| Ga0318524_100612331 | 3300032067 | Soil | MGRFRNRLLVLIIGLVIVTQTVTLAAVLISTRRTVE |
| Ga0318553_106383992 | 3300032068 | Soil | MGSFRNRLLVLIIGLVIVTETVTLAAVLISTRRTVEARAAEQMRS |
| Ga0307470_118758582 | 3300032174 | Hardwood Forest Soil | MNSFRNRLLVLIIGLIAVTQTVTLVAVLASTRRNVE |
| Ga0315276_115960541 | 3300032177 | Sediment | MNSFRNRLLVLIIGLIAVTQTVTLVAVLESTRRNVEARAADQLTAGASYA |
| Ga0307472_1004303501 | 3300032205 | Hardwood Forest Soil | MGSFRKRLLVLIIGLVVVTQTVTLAAVLVSTRRTVEARAAEQLR |
| Ga0306920_1004877601 | 3300032261 | Soil | MGSFRNRLLVLIIGLVIVTQTVTLAAVLISTRRMVEARAAEQL |
| Ga0335079_103348763 | 3300032783 | Soil | MNSFRNRLLVLIIGLVIVTQTVTFFAVLARTRSAVETRAAEQLRSGGSVVQQFM |
| Ga0335078_104418501 | 3300032805 | Soil | MGSFRKRLLVLIIGLVVVTQTVTLAAVLASTRGTVEERAAEQLSSGG |
| Ga0335077_120970271 | 3300033158 | Soil | MGSFRKRLLVLIIGLVIVTQTVTLAAVLASTRGTVRARAAEQLSQGGALA |
| Ga0318519_101779103 | 3300033290 | Soil | MGSFRNRLLVLIIGLVIVTQTVTLAAVLISTRRMV |
| Ga0310810_111586571 | 3300033412 | Soil | MGSFRNRLLVLIIGLVIVTQTVTLAAVLLSTRRTVEARAA |
| Ga0373916_0052143_442_591 | 3300034894 | Sediment Slurry | MRSFRNRLLVLIIGLIIVTQTVTVFAVLASARRNVEARAAEQLAAGGSYA |
| ⦗Top⦘ |