


| Basic Information | |
|---|---|
| Family ID | F056286 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 137 |
| Average Sequence Length | 43 residues |
| Representative Sequence | SVLVRLSRVTPDVLRDLLGMAHKFVTAHAARRSPSRNRRKRI |
| Number of Associated Samples | 115 |
| Number of Associated Scaffolds | 137 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 2.21 % |
| % of genes near scaffold ends (potentially truncated) | 94.16 % |
| % of genes from short scaffolds (< 2000 bps) | 90.51 % |
| Associated GOLD sequencing projects | 110 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.34 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (91.241 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment (11.679 % of family members) |
| Environment Ontology (ENVO) | Unclassified (24.818 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (42.336 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 34.29% β-sheet: 0.00% Coil/Unstructured: 65.71% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.34 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 137 Family Scaffolds |
|---|---|---|
| PF00903 | Glyoxalase | 8.76 |
| PF04075 | F420H2_quin_red | 6.57 |
| PF08734 | GYD | 3.65 |
| PF00378 | ECH_1 | 2.92 |
| PF00069 | Pkinase | 2.92 |
| PF00072 | Response_reg | 1.46 |
| PF07786 | HGSNAT_cat | 1.46 |
| PF00144 | Beta-lactamase | 1.46 |
| PF00239 | Resolvase | 1.46 |
| PF14329 | DUF4386 | 1.46 |
| PF07508 | Recombinase | 1.46 |
| PF13231 | PMT_2 | 1.46 |
| PF00106 | adh_short | 0.73 |
| PF03693 | ParD_antitoxin | 0.73 |
| PF02358 | Trehalose_PPase | 0.73 |
| PF13637 | Ank_4 | 0.73 |
| PF05139 | Erythro_esteras | 0.73 |
| PF12680 | SnoaL_2 | 0.73 |
| PF01569 | PAP2 | 0.73 |
| PF01951 | Archease | 0.73 |
| PF01741 | MscL | 0.73 |
| PF03729 | DUF308 | 0.73 |
| PF13620 | CarboxypepD_reg | 0.73 |
| PF03544 | TonB_C | 0.73 |
| PF12770 | CHAT | 0.73 |
| PF13360 | PQQ_2 | 0.73 |
| PF02954 | HTH_8 | 0.73 |
| PF08327 | AHSA1 | 0.73 |
| PF04389 | Peptidase_M28 | 0.73 |
| PF03992 | ABM | 0.73 |
| PF08695 | Coa1 | 0.73 |
| PF13671 | AAA_33 | 0.73 |
| PF14595 | Thioredoxin_9 | 0.73 |
| PF13455 | MUG113 | 0.73 |
| PF13229 | Beta_helix | 0.73 |
| PF01066 | CDP-OH_P_transf | 0.73 |
| PF13751 | DDE_Tnp_1_6 | 0.73 |
| PF12681 | Glyoxalase_2 | 0.73 |
| PF13147 | Obsolete Pfam Family | 0.73 |
| PF02687 | FtsX | 0.73 |
| PF07883 | Cupin_2 | 0.73 |
| PF00202 | Aminotran_3 | 0.73 |
| PF07244 | POTRA | 0.73 |
| PF07690 | MFS_1 | 0.73 |
| PF01244 | Peptidase_M19 | 0.73 |
| PF03683 | UPF0175 | 0.73 |
| PF07366 | SnoaL | 0.73 |
| PF13419 | HAD_2 | 0.73 |
| COG ID | Name | Functional Category | % Frequency in 137 Family Scaffolds |
|---|---|---|---|
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 11.68 |
| COG4274 | Uncharacterized conserved protein, contains GYD domain | Function unknown [S] | 3.65 |
| COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 2.92 |
| COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 1.46 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 1.46 |
| COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 1.46 |
| COG2452 | Predicted site-specific integrase-resolvase | Mobilome: prophages, transposons [X] | 1.46 |
| COG3503 | Uncharacterized membrane protein, DUF1624 family | Function unknown [S] | 1.46 |
| COG0558 | Phosphatidylglycerophosphate synthase | Lipid transport and metabolism [I] | 0.73 |
| COG0810 | Periplasmic protein TonB, links inner and outer membranes | Cell wall/membrane/envelope biogenesis [M] | 0.73 |
| COG1183 | Phosphatidylserine synthase | Lipid transport and metabolism [I] | 0.73 |
| COG1371 | Archease, activates RNA ligation by RtcB (tRNA splicing) | Translation, ribosomal structure and biogenesis [J] | 0.73 |
| COG1877 | Trehalose-6-phosphate phosphatase | Carbohydrate transport and metabolism [G] | 0.73 |
| COG1970 | Large-conductance mechanosensitive channel | Cell wall/membrane/envelope biogenesis [M] | 0.73 |
| COG2312 | Erythromycin esterase homolog | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.73 |
| COG2355 | Zn-dependent dipeptidase, microsomal dipeptidase homolog | Posttranslational modification, protein turnover, chaperones [O] | 0.73 |
| COG2886 | Predicted antitoxin, contains HTH domain | General function prediction only [R] | 0.73 |
| COG3247 | Acid resistance membrane protein HdeD, DUF308 family | General function prediction only [R] | 0.73 |
| COG3609 | Transcriptional regulator, contains Arc/MetJ-type RHH (ribbon-helix-helix) DNA-binding domain | Transcription [K] | 0.73 |
| COG5050 | sn-1,2-diacylglycerol ethanolamine- and cholinephosphotranferases | Lipid transport and metabolism [I] | 0.73 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 91.24 % |
| Unclassified | root | N/A | 8.76 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2070309004|prs_FIHLEPW02S5CWQ | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
| 3300000567|JGI12270J11330_10063922 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1878 | Open in IMG/M |
| 3300001124|JGI12692J13336_1008572 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 556 | Open in IMG/M |
| 3300004152|Ga0062386_101146389 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 646 | Open in IMG/M |
| 3300005171|Ga0066677_10589566 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 632 | Open in IMG/M |
| 3300005363|Ga0008090_15064307 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 636 | Open in IMG/M |
| 3300005436|Ga0070713_101685994 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 615 | Open in IMG/M |
| 3300005436|Ga0070713_102102043 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 547 | Open in IMG/M |
| 3300005534|Ga0070735_10202900 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1212 | Open in IMG/M |
| 3300005564|Ga0070664_101116522 | All Organisms → cellular organisms → Bacteria | 743 | Open in IMG/M |
| 3300005602|Ga0070762_10005990 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5906 | Open in IMG/M |
| 3300005602|Ga0070762_10774694 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 648 | Open in IMG/M |
| 3300005993|Ga0080027_10338768 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
| 3300006052|Ga0075029_100735281 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
| 3300006059|Ga0075017_101678928 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 502 | Open in IMG/M |
| 3300006086|Ga0075019_11146193 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300006162|Ga0075030_100175798 | All Organisms → cellular organisms → Bacteria | 1728 | Open in IMG/M |
| 3300006162|Ga0075030_101132729 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 615 | Open in IMG/M |
| 3300006162|Ga0075030_101443968 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 539 | Open in IMG/M |
| 3300009038|Ga0099829_10542615 | Not Available | 966 | Open in IMG/M |
| 3300009519|Ga0116108_1041042 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1495 | Open in IMG/M |
| 3300009552|Ga0116138_1075975 | All Organisms → cellular organisms → Bacteria | 941 | Open in IMG/M |
| 3300009636|Ga0116112_1127913 | All Organisms → cellular organisms → Bacteria | 710 | Open in IMG/M |
| 3300009698|Ga0116216_10671527 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 623 | Open in IMG/M |
| 3300009700|Ga0116217_10357880 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 931 | Open in IMG/M |
| 3300010048|Ga0126373_11043049 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 883 | Open in IMG/M |
| 3300010343|Ga0074044_10554089 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 750 | Open in IMG/M |
| 3300010358|Ga0126370_10366738 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1170 | Open in IMG/M |
| 3300010361|Ga0126378_11460877 | Not Available | 775 | Open in IMG/M |
| 3300010371|Ga0134125_11208295 | Not Available | 826 | Open in IMG/M |
| 3300010373|Ga0134128_10466963 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1408 | Open in IMG/M |
| 3300010376|Ga0126381_103193679 | Not Available | 648 | Open in IMG/M |
| 3300010379|Ga0136449_101551085 | All Organisms → cellular organisms → Bacteria | 1010 | Open in IMG/M |
| 3300010379|Ga0136449_101937685 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 874 | Open in IMG/M |
| 3300010379|Ga0136449_103321023 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
| 3300011120|Ga0150983_11535110 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 786 | Open in IMG/M |
| 3300011270|Ga0137391_10127925 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2207 | Open in IMG/M |
| 3300011271|Ga0137393_10896518 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 757 | Open in IMG/M |
| 3300012189|Ga0137388_11490749 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 614 | Open in IMG/M |
| 3300012203|Ga0137399_10461145 | All Organisms → cellular organisms → Bacteria | 1063 | Open in IMG/M |
| 3300012203|Ga0137399_10464031 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1060 | Open in IMG/M |
| 3300012363|Ga0137390_11082302 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 751 | Open in IMG/M |
| 3300012930|Ga0137407_10643438 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 997 | Open in IMG/M |
| 3300014152|Ga0181533_1124498 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1097 | Open in IMG/M |
| 3300014153|Ga0181527_1135041 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1100 | Open in IMG/M |
| 3300014153|Ga0181527_1268144 | Not Available | 683 | Open in IMG/M |
| 3300014165|Ga0181523_10267601 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 972 | Open in IMG/M |
| 3300014165|Ga0181523_10706488 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
| 3300014491|Ga0182014_10481354 | Not Available | 610 | Open in IMG/M |
| 3300014638|Ga0181536_10375150 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 641 | Open in IMG/M |
| 3300014969|Ga0157376_10848509 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 929 | Open in IMG/M |
| 3300015372|Ga0132256_100559473 | All Organisms → cellular organisms → Bacteria | 1257 | Open in IMG/M |
| 3300015373|Ga0132257_103683396 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 558 | Open in IMG/M |
| 3300017822|Ga0187802_10016658 | All Organisms → cellular organisms → Bacteria | 2473 | Open in IMG/M |
| 3300017822|Ga0187802_10236570 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 705 | Open in IMG/M |
| 3300017822|Ga0187802_10246208 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 691 | Open in IMG/M |
| 3300017823|Ga0187818_10022628 | All Organisms → cellular organisms → Bacteria | 2687 | Open in IMG/M |
| 3300017926|Ga0187807_1299224 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 534 | Open in IMG/M |
| 3300017933|Ga0187801_10395166 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 574 | Open in IMG/M |
| 3300017935|Ga0187848_10107630 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1262 | Open in IMG/M |
| 3300017938|Ga0187854_10110964 | All Organisms → cellular organisms → Bacteria | 1276 | Open in IMG/M |
| 3300017940|Ga0187853_10059699 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1937 | Open in IMG/M |
| 3300017943|Ga0187819_10170296 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1292 | Open in IMG/M |
| 3300017943|Ga0187819_10331487 | All Organisms → cellular organisms → Bacteria | 881 | Open in IMG/M |
| 3300017943|Ga0187819_10788285 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300017955|Ga0187817_10015450 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 4465 | Open in IMG/M |
| 3300017955|Ga0187817_10987549 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 539 | Open in IMG/M |
| 3300017966|Ga0187776_10495896 | All Organisms → cellular organisms → Bacteria | 834 | Open in IMG/M |
| 3300017995|Ga0187816_10134128 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1068 | Open in IMG/M |
| 3300018007|Ga0187805_10199755 | All Organisms → cellular organisms → Bacteria | 913 | Open in IMG/M |
| 3300018007|Ga0187805_10297424 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 742 | Open in IMG/M |
| 3300018009|Ga0187884_10004127 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 10868 | Open in IMG/M |
| 3300018009|Ga0187884_10088474 | All Organisms → cellular organisms → Bacteria | 1368 | Open in IMG/M |
| 3300018012|Ga0187810_10217650 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 779 | Open in IMG/M |
| 3300018012|Ga0187810_10272922 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 696 | Open in IMG/M |
| 3300018037|Ga0187883_10625662 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
| 3300018042|Ga0187871_10299178 | All Organisms → cellular organisms → Bacteria | 891 | Open in IMG/M |
| 3300018043|Ga0187887_10732730 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 584 | Open in IMG/M |
| 3300018062|Ga0187784_10333932 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 1229 | Open in IMG/M |
| 3300018062|Ga0187784_10573985 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 907 | Open in IMG/M |
| 3300018086|Ga0187769_10216842 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1419 | Open in IMG/M |
| 3300018088|Ga0187771_11078990 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 681 | Open in IMG/M |
| 3300018090|Ga0187770_10305381 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1239 | Open in IMG/M |
| 3300020579|Ga0210407_10359857 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1138 | Open in IMG/M |
| 3300020580|Ga0210403_10027061 | All Organisms → cellular organisms → Bacteria | 4571 | Open in IMG/M |
| 3300020581|Ga0210399_10773537 | All Organisms → cellular organisms → Bacteria | 785 | Open in IMG/M |
| 3300021171|Ga0210405_11156822 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 575 | Open in IMG/M |
| 3300021178|Ga0210408_10428139 | Not Available | 1054 | Open in IMG/M |
| 3300021181|Ga0210388_10103193 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2443 | Open in IMG/M |
| 3300021402|Ga0210385_11340046 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300021404|Ga0210389_10188604 | All Organisms → cellular organisms → Bacteria | 1606 | Open in IMG/M |
| 3300021479|Ga0210410_11341066 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
| 3300021560|Ga0126371_11501413 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 802 | Open in IMG/M |
| 3300021560|Ga0126371_12687369 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 603 | Open in IMG/M |
| 3300022508|Ga0222728_1026459 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae → Nitrosomonas → unclassified Nitrosomonas → Nitrosomonas sp. Is79A3 | 873 | Open in IMG/M |
| 3300022731|Ga0224563_1000400 | All Organisms → cellular organisms → Bacteria | 1834 | Open in IMG/M |
| 3300022734|Ga0224571_114978 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
| 3300025414|Ga0208935_1047245 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
| 3300025454|Ga0208039_1036385 | All Organisms → cellular organisms → Bacteria | 948 | Open in IMG/M |
| 3300025506|Ga0208937_1047789 | Not Available | 1010 | Open in IMG/M |
| 3300025509|Ga0208848_1037245 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter lichenicola | 1053 | Open in IMG/M |
| 3300025928|Ga0207700_11204261 | Not Available | 676 | Open in IMG/M |
| 3300025945|Ga0207679_11050351 | All Organisms → cellular organisms → Bacteria | 747 | Open in IMG/M |
| 3300027590|Ga0209116_1039464 | All Organisms → cellular organisms → Bacteria | 1008 | Open in IMG/M |
| 3300027645|Ga0209117_1003234 | All Organisms → cellular organisms → Bacteria | 5677 | Open in IMG/M |
| 3300027867|Ga0209167_10288092 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 886 | Open in IMG/M |
| 3300027879|Ga0209169_10149921 | All Organisms → cellular organisms → Bacteria | 1214 | Open in IMG/M |
| 3300027908|Ga0209006_10440921 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1092 | Open in IMG/M |
| 3300029915|Ga0311358_10731063 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 721 | Open in IMG/M |
| 3300029939|Ga0311328_10267219 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1282 | Open in IMG/M |
| 3300029939|Ga0311328_10455704 | All Organisms → cellular organisms → Bacteria | 907 | Open in IMG/M |
| 3300029943|Ga0311340_10589107 | All Organisms → cellular organisms → Bacteria | 974 | Open in IMG/M |
| 3300029953|Ga0311343_10752746 | All Organisms → cellular organisms → Bacteria | 803 | Open in IMG/M |
| 3300030042|Ga0302300_1083718 | All Organisms → cellular organisms → Bacteria | 975 | Open in IMG/M |
| 3300030053|Ga0302177_10662819 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300030580|Ga0311355_11536984 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 574 | Open in IMG/M |
| 3300031231|Ga0170824_124340101 | All Organisms → cellular organisms → Bacteria | 812 | Open in IMG/M |
| 3300031446|Ga0170820_15420176 | Not Available | 951 | Open in IMG/M |
| 3300031525|Ga0302326_13072709 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300031718|Ga0307474_10745257 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 774 | Open in IMG/M |
| 3300031754|Ga0307475_10107815 | All Organisms → cellular organisms → Bacteria | 2181 | Open in IMG/M |
| 3300031754|Ga0307475_10454359 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1029 | Open in IMG/M |
| 3300031954|Ga0306926_12396340 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 582 | Open in IMG/M |
| 3300032076|Ga0306924_10653692 | All Organisms → cellular organisms → Bacteria | 1185 | Open in IMG/M |
| 3300032160|Ga0311301_10447984 | Not Available | 1946 | Open in IMG/M |
| 3300032180|Ga0307471_100321866 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1644 | Open in IMG/M |
| 3300032205|Ga0307472_101229118 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 717 | Open in IMG/M |
| 3300032783|Ga0335079_10627616 | All Organisms → cellular organisms → Bacteria | 1131 | Open in IMG/M |
| 3300032828|Ga0335080_10697914 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1058 | Open in IMG/M |
| 3300032829|Ga0335070_11456760 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 624 | Open in IMG/M |
| 3300032892|Ga0335081_10331402 | All Organisms → cellular organisms → Bacteria | 1995 | Open in IMG/M |
| 3300033289|Ga0310914_11156199 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 675 | Open in IMG/M |
| 3300033402|Ga0326728_10178863 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2200 | Open in IMG/M |
| 3300033755|Ga0371489_0104470 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1645 | Open in IMG/M |
| 3300033977|Ga0314861_0036914 | All Organisms → cellular organisms → Bacteria | 2843 | Open in IMG/M |
| 3300033977|Ga0314861_0506060 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 11.68% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 8.76% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 5.84% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.84% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 5.11% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 4.38% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 4.38% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 4.38% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.38% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 4.38% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.65% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.65% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 3.65% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.92% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 2.92% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.19% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.19% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.46% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.46% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.46% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.46% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 1.46% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 1.46% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.46% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.73% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.73% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.73% |
| Green-Waste Compost | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Green-Waste Compost | 0.73% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.73% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.73% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.73% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.73% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.73% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.73% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.73% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.73% |
| Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 0.73% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2070309004 | Green-waste compost microbial communities at University of California, Davis, USA, from solid state bioreactor - Luquillo Rain Forest, Puerto Rico | Environmental | Open in IMG/M |
| 3300000567 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 | Environmental | Open in IMG/M |
| 3300001124 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O3 | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
| 3300005363 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005993 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009519 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_150 | Environmental | Open in IMG/M |
| 3300009552 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_150 | Environmental | Open in IMG/M |
| 3300009636 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_150 | Environmental | Open in IMG/M |
| 3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014152 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_60_metaG | Environmental | Open in IMG/M |
| 3300014153 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_60_metaG | Environmental | Open in IMG/M |
| 3300014165 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaG | Environmental | Open in IMG/M |
| 3300014491 | Permafrost microbial communities from Stordalen Mire, Sweden - 612S2D metaG | Environmental | Open in IMG/M |
| 3300014638 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_60_metaG | Environmental | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017926 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2 | Environmental | Open in IMG/M |
| 3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
| 3300017935 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_40 | Environmental | Open in IMG/M |
| 3300017938 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_150 | Environmental | Open in IMG/M |
| 3300017940 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_100 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
| 3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
| 3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
| 3300018009 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_40 | Environmental | Open in IMG/M |
| 3300018012 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5 | Environmental | Open in IMG/M |
| 3300018037 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10 | Environmental | Open in IMG/M |
| 3300018042 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10 | Environmental | Open in IMG/M |
| 3300018043 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10 | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022508 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-19-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022731 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSU4 | Environmental | Open in IMG/M |
| 3300022734 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZU3 | Host-Associated | Open in IMG/M |
| 3300025414 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025454 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300025506 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025509 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-1 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027590 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027645 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300029915 | III_Bog_E1 coassembly | Environmental | Open in IMG/M |
| 3300029939 | I_Bog_E3 coassembly | Environmental | Open in IMG/M |
| 3300029943 | I_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300029953 | II_Bog_E3 coassembly | Environmental | Open in IMG/M |
| 3300030042 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E1_1 | Environmental | Open in IMG/M |
| 3300030053 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_2 | Environmental | Open in IMG/M |
| 3300030580 | II_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033402 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MN | Environmental | Open in IMG/M |
| 3300033755 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB26FY SIP fraction | Environmental | Open in IMG/M |
| 3300033977 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - SJ75 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| prs_01797190 | 2070309004 | Green-Waste Compost | VGNAVLVRLSRVNPDVLRDLLGTAYKYVTRNAARSPARKCS |
| JGI12270J11330_100639223 | 3300000567 | Peatlands Soil | RLSRITPNVLRDLLGMAHKFVTAHKARRLPSRSRRKPV* |
| JGI12692J13336_10085721 | 3300001124 | Forest Soil | GYSAVLVRLSRVTPDVLRDLLGMAHKFVTAHAPRRLPSRNRRKPV* |
| Ga0062386_1011463892 | 3300004152 | Bog Forest Soil | SAVLVRLSRVNPDALRDLLGMAYKFVTRKTEPRSPARKRR* |
| Ga0066677_105895661 | 3300005171 | Soil | YSAVLVRLSCVNPDVLRDLLGMAYKFVTRNPAPRSPARKRRK* |
| Ga0008090_150643071 | 3300005363 | Tropical Rainforest Soil | LVRLSKVNPNALRDLLGMAYKFVTRKAASPSLARRHRRSP* |
| Ga0070713_1016859941 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | YNVVLVRLSRVKRDVLRDLLGMAHKFVSRNVGPRPPARKPR* |
| Ga0070713_1021020432 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | VGYTAVLVRMSRVAPDVLRDLLGMAHKFVAAPAPRRTPSRKRRKPV* |
| Ga0070735_102029002 | 3300005534 | Surface Soil | VTDHYLGYTAVLVRLSRVTPDVLRDLLGMAHKFVTGDKERRSPSRNRRIYHQP* |
| Ga0070664_1011165221 | 3300005564 | Corn Rhizosphere | VLVRLSKVNPNVLRDLLGMAYKFVTRKSAPRPRSRKTRIG* |
| Ga0070762_100059906 | 3300005602 | Soil | VTAHYLNYSALLVRLSRVTPDILRDLLGMAHKFVTADGARRSPSRSRRKPV* |
| Ga0070762_107746941 | 3300005602 | Soil | VTDHSLGYTTVLARLSRVTPDVLRDLLGKAHKFVTADAARRSPSRNRRK |
| Ga0080027_103387682 | 3300005993 | Prmafrost Soil | VTPDVLRDLLSMAHKFVTADAVRRSPSRNKRKRI* |
| Ga0075029_1007352811 | 3300006052 | Watersheds | VRLSRVTPDVLKDLLGMAHKFVTAETARRSPTRHRRKPA* |
| Ga0075017_1016789282 | 3300006059 | Watersheds | SCVNPDVLRDLLRMAYKFVTRNPAPRSPARKRGK* |
| Ga0075019_111461931 | 3300006086 | Watersheds | SRVTPDVLRDLLGMAHKFVTAHEARRSLSRNRRKPV* |
| Ga0075030_1001757984 | 3300006162 | Watersheds | RVTPDVLRDLLGMAHKFVTADTARRSPSRNKRKPV* |
| Ga0075030_1011327291 | 3300006162 | Watersheds | HYAGYSAVLVRLARVNPDALRDLLGMAHKFVTRKPAPRKPARKRKGR* |
| Ga0075030_1014439681 | 3300006162 | Watersheds | SVLVRLSRVTPDVLRDLLGMAHKFVTADAARRSTSRHRKPGRNADSGC* |
| Ga0099829_105426151 | 3300009038 | Vadose Zone Soil | YVGYNAVLVRLSRVNRDVLRGLLGMAYKFVTRGAAPRSPARKRRKLRPRT* |
| Ga0116108_10410423 | 3300009519 | Peatland | MSRIAPDVLRDLLGLAHKFVTADAARRSPSRNKRKRI* |
| Ga0116138_10759753 | 3300009552 | Peatland | SRIAPDVLRDLLGLAHKFVTADAARRSPSRNKRKRI* |
| Ga0116112_11279131 | 3300009636 | Peatland | RLSRVTPDVLRDLLGMAHKFVTADTARRSPSRNKRKRI* |
| Ga0116216_106715272 | 3300009698 | Peatlands Soil | VRLSRVNLDVLRDLLGMAHKFVTRRAAPRSPARNRRKLGPRK* |
| Ga0116217_103578802 | 3300009700 | Peatlands Soil | ADYSGVLVRLSRVNPNVLRDLLGMAYKFVTANIAPRSPSRKRRKVGPGK* |
| Ga0126373_110430491 | 3300010048 | Tropical Forest Soil | TFVLVRLSRVTPDVLRDLLGMAHKFVTAHEARRSASRKKRKRI* |
| Ga0074044_105540892 | 3300010343 | Bog Forest Soil | LVRLSRVNPGLLRDLLGMAYKFVTASVAPSRKRRKLRPRKGM* |
| Ga0126370_103667381 | 3300010358 | Tropical Forest Soil | AVLVRLSRVNPDVLRDLLGMAYKFVTRNASRRWPSQKRR* |
| Ga0126378_114608771 | 3300010361 | Tropical Forest Soil | HVLQDLLGMAHQFVTRNAAPRSPARKRRKVDSRK* |
| Ga0134125_112082952 | 3300010371 | Terrestrial Soil | SVVSVNPNVSRDLLGMAYKFVTRKSTPRPPARNRR* |
| Ga0134128_104669631 | 3300010373 | Terrestrial Soil | VRLSRIEEGVLRDLLGMAYKFVTSKGKRGTSGSSSPKSKKTTQKK* |
| Ga0126381_1031936791 | 3300010376 | Tropical Forest Soil | GYSAVLVRLSRVNSHVLQDLLGMAHQFVTRNAAPVR* |
| Ga0136449_1015510851 | 3300010379 | Peatlands Soil | VRLSRVNLDVVRDLLGMAHKFVTRNAAPHSPARKRRKLGPRK* |
| Ga0136449_1019376853 | 3300010379 | Peatlands Soil | VRLSRVNPDALRDLLGMAYKFVTRKAAPRSPARKRR* |
| Ga0136449_1033210231 | 3300010379 | Peatlands Soil | DHYLNYSAVLVRLSRVTPDVLRDLLGMAHKFVTSHEARRSPSRSRRKPV* |
| Ga0150983_115351103 | 3300011120 | Forest Soil | GYNAVLVRLSRVHRDVLRDLLGMAYKFVTRKAAPRSPARKP* |
| Ga0137391_101279253 | 3300011270 | Vadose Zone Soil | SVLVRLSRLDRDVLRDLLGMAYKFMTRKAAPRSPARKR* |
| Ga0137393_108965181 | 3300011271 | Vadose Zone Soil | HYIGYESVLVRLSRVNPDVLRDLLGMAYKFVTRKAAARSPAQKLRKLGPRTWTRV* |
| Ga0137388_114907492 | 3300012189 | Vadose Zone Soil | VRLSCVNPDVLRDLLGMAYKFVTRKPAPRSPTRKRGK* |
| Ga0137399_104611451 | 3300012203 | Vadose Zone Soil | YVTEHYVGYSSVLVRLSRVTPDVLGGLLRMAHKFVTRNAAPRSPAGKRRKLAPRK* |
| Ga0137399_104640311 | 3300012203 | Vadose Zone Soil | HYVGYNAVLVRLSRVTPDVLRDLLGMAHKFVTRNAAARPPARKRRKLGPGERTKV* |
| Ga0137390_110823022 | 3300012363 | Vadose Zone Soil | SRVNRDVLRDLLGMAYKFVTRGAAPHSPGRKGRKPRPEK* |
| Ga0137407_106434381 | 3300012930 | Vadose Zone Soil | GYSAVLVRLSCANPDVLRDLLRMAYKFVTRKPAPRSPARKRGK* |
| Ga0181533_11244982 | 3300014152 | Bog | RLSRVNPDVLRDLLGMAYKFVTRNAAPHSPVRKRRKLGPRK* |
| Ga0181527_11350411 | 3300014153 | Bog | SRVNRDVLRDLLGMAYKFVTRNAAPHSPVRKRRKLGPRK* |
| Ga0181527_12681441 | 3300014153 | Bog | VGYSAVLVRLSRVNREVLLDLLGMAYKFVTANSPSRPTSRKRRKTGPEGR* |
| Ga0181523_102676012 | 3300014165 | Bog | YTAVLVRLSRVNSDVLRDLLGMAHKFVTRNAAPRSPAGKRRKLGARK* |
| Ga0181523_107064882 | 3300014165 | Bog | LVRLSRVTPDVLRDLLGMAHKFVTADTARRSPSRNKRKRI* |
| Ga0182014_104813541 | 3300014491 | Bog | VNPDVLRDLLGMAYKFVTGGKVNRSPRQKRQKLPPAGRP* |
| Ga0181536_103751501 | 3300014638 | Bog | GYNAVLVRLSRVNRDVLRDLLGMAYKFVTRNAAPHSPVRKRRKLGPRK* |
| Ga0157376_108485091 | 3300014969 | Miscanthus Rhizosphere | AVLVRLSKVNPNVLRDLLGMAYKFVTRKSAPRPRSRKTRIG* |
| Ga0132256_1005594731 | 3300015372 | Arabidopsis Rhizosphere | YADYNAVPVRLSRVNSNMLQDLLGMAHKSVTRNAAPRSPARKRR* |
| Ga0132257_1036833962 | 3300015373 | Arabidopsis Rhizosphere | VYYVTDHYVGNAVLVRLSHVNPDVLRDLLSMAHKFVTKAAPRSPARKRH* |
| Ga0187802_100166581 | 3300017822 | Freshwater Sediment | LNDTSVLVRLSRVTPAVLRDLLGMAHKFVTAHEARRSPSRNRRKPV |
| Ga0187802_102365702 | 3300017822 | Freshwater Sediment | SAVLVRLSRITPDVLRDLLGMAHKFVTADAARRSPSRNKRKRI |
| Ga0187802_102462081 | 3300017822 | Freshwater Sediment | HYLNYSAVLVRLSRVTPDVLKDLLGMAHKFVTAHEARRSPSRSRRKAL |
| Ga0187818_100226281 | 3300017823 | Freshwater Sediment | DHYLNYTSVLVRLSRVTPDVLRDLLGMAHKFVTADTPRRSLSRYKRKRI |
| Ga0187807_12992241 | 3300017926 | Freshwater Sediment | DAVLVRLSRVNPAVLRDLLGMAYKFMTANAAPRPSRKRRNPGR |
| Ga0187801_103951662 | 3300017933 | Freshwater Sediment | VGYTAVLVRLSRVNADVLRDLLGMAHKFVTRGGARQPKAPKGRKSGPRK |
| Ga0187848_101076304 | 3300017935 | Peatland | YYVTDHYLNYSAVLVRMSRVTPDVLRDLLCMAHKFVTAHEPRRSPSRNRRRRV |
| Ga0187854_101109642 | 3300017938 | Peatland | LVRLSRVTPDILRDLLGMAHKFVTAQETRRPPNRNRRKPV |
| Ga0187853_100596991 | 3300017940 | Peatland | NYSAVLVRMSRVTPDVLRDLLCMAHKFVTAHEPRRSPSRNRRRRV |
| Ga0187819_101702963 | 3300017943 | Freshwater Sediment | HYLNYNAVLVRLSRVTPDVLRDLLGMAHKFVTSHESRRSPSRNRRKAL |
| Ga0187819_103314872 | 3300017943 | Freshwater Sediment | GYSAVLVRLSRVNPDVLRDVLGMAHKFVTRKVAPRSPARKRR |
| Ga0187819_107882851 | 3300017943 | Freshwater Sediment | RLSRVTPDVLRDLLGMAHKFVTAHAPRRSPSRSRRKPV |
| Ga0187817_100154501 | 3300017955 | Freshwater Sediment | NPEVLRGLLGMAYKFVTRAAVSRSSARKRRKLGPRK |
| Ga0187817_109875491 | 3300017955 | Freshwater Sediment | RITPNVLRDLIGMAHKFVTADAARRSPSRNKRKPV |
| Ga0187776_104958963 | 3300017966 | Tropical Peatland | LVRLSRVNRDVLRDLLGMAYKFVTSKTHRSPSRKRRDSAL |
| Ga0187816_101341283 | 3300017995 | Freshwater Sediment | SVLVRLSRVTPDVLRDLLGMAHKFVTAHAARRSPSRNRRKRI |
| Ga0187805_101997552 | 3300018007 | Freshwater Sediment | SRVTPDVLRDLLGMAHKFVTADAARRSPSRSRRKRT |
| Ga0187805_102974242 | 3300018007 | Freshwater Sediment | RLSRVTPDVLRDLLGMAHKFVTAHAARRSPSRNRRKRI |
| Ga0187884_1000412711 | 3300018009 | Peatland | VTDHYLNYTSVLLSLSRVTPDVPRDLLGMAHKFVTAHDARRSPSRNRRKRT |
| Ga0187884_100884742 | 3300018009 | Peatland | MSRIAPDVLRDLLGLAHKFVTADAARRSPSRNKRKRI |
| Ga0187810_102176502 | 3300018012 | Freshwater Sediment | AYNSVLVRMARVTPDVLRDLLGMAYKFVTQKARLRSAARKRRMQ |
| Ga0187810_102729221 | 3300018012 | Freshwater Sediment | NYNAVLVRLSRVTPDVLRDLLGMAHKFVTTHGARRLPSGNRRKRA |
| Ga0187883_106256622 | 3300018037 | Peatland | YLNYSAVLVRMSRVTPDVLRDLLGMAHKFVTADAARRSPSRNKRKRI |
| Ga0187871_102991781 | 3300018042 | Peatland | NPDVLRDLLGMAYKFVTRSAKPPSPARKRKKARAGK |
| Ga0187887_107327301 | 3300018043 | Peatland | YSAVLVRLSRVNPDVLRDLLGMAYTFVTRNAKPPSPSRKRQKTGARK |
| Ga0187784_103339324 | 3300018062 | Tropical Peatland | HYVGYTAVLVRMSSVTPDVLRDLLGMAHKFVTAPETRPSPSRKRRESA |
| Ga0187784_105739851 | 3300018062 | Tropical Peatland | YVDYSAVLVRLSRVTPDVLRDLLGMAHKFVTADKARRLASRKKRKRI |
| Ga0187769_102168424 | 3300018086 | Tropical Peatland | SVLVRLSRVTPDVLRDLLGMAHKFVTSHEARRSPARNRRRRV |
| Ga0187771_110789901 | 3300018088 | Tropical Peatland | AVLVRLARVTPDVLRDLLGMAHKFVTAHEARRSPSGKRRKPA |
| Ga0187770_103053814 | 3300018090 | Tropical Peatland | RVTPDVLRDLLGMAHKFVAADTSRRSQSRNRRKHT |
| Ga0210407_103598573 | 3300020579 | Soil | VGYNAVLVRLSRVHRDVLRDLLGMAYKFVTRKAAPRSPARKP |
| Ga0210403_100270611 | 3300020580 | Soil | VTDHYLNHTSVLVRLSRVTPDVLRDLLGMAHKFVTADAARHSPP |
| Ga0210399_107735371 | 3300020581 | Soil | HYLNYTAVLVRLSRVKPEVLRDLLGMAHKFLTAAARRPTSRHHRKRV |
| Ga0210405_111568221 | 3300021171 | Soil | VNHDVLRDLLGMAYKFVTRNATRQSPARRRRHQRTTK |
| Ga0210408_104281392 | 3300021178 | Soil | YAGYNAVLVRLSRINSNVLQDLLGMAHKFVTRNAAPRSPARKRRKVGSRK |
| Ga0210388_101031936 | 3300021181 | Soil | VTDHYLGYNAVLVRLSRVTPDVLRDLLSMAHKFVTALDARRSPSRSRRKPV |
| Ga0210385_113400461 | 3300021402 | Soil | RLSCVTSDVLRDVLGTAYKFVMEHEARRSPSRNRRKPV |
| Ga0210389_101886041 | 3300021404 | Soil | DYLNYSTVLVRLSRVTPDVLRDLLGMAHKFVTAHEARRSPSRNRRKPA |
| Ga0210391_109996993 | 3300021433 | Soil | NAVLVRLSRVKPDVLRDLLGMAHKFVTRKPRKPVRK |
| Ga0210410_113410661 | 3300021479 | Soil | AVLVRLSRITPDVLRDLLGMAHKFVTADAARRSPSRNKRKPV |
| Ga0126371_115014133 | 3300021560 | Tropical Forest Soil | LSRVTPDVLRDLLGMAHKFVTAHEARRSASRKKRKRI |
| Ga0126371_126873691 | 3300021560 | Tropical Forest Soil | YTSVLVRLSRVTPDVLRDLLGMAHKFVTQRLPSKKRRKKMKD |
| Ga0222728_10264593 | 3300022508 | Soil | GVLVRLARVTPDVLRDLLGMAYKFVTASVKPRAPARKSRKPGSGK |
| Ga0224563_10004005 | 3300022731 | Soil | IYYVTDHSLGYTTVLARLSRVTPDVLRDLLGKAHKFVTADAARRSPSRNRRKPV |
| Ga0224571_1149781 | 3300022734 | Rhizosphere | SAGAAVPDIYYVTDHSLGYTTVLARLSRVTPDVLRDLLGKAHKFVTADAARRSPSRNRRKPV |
| Ga0208935_10472451 | 3300025414 | Peatland | YSAVLVRMSRLTPDVLRDLLGMAHKFVTADVARRLPSQNKRTRI |
| Ga0208039_10363851 | 3300025454 | Peatland | SRIAPDVLRDLLGLAHKFVTADAARRSPSRNKRKRI |
| Ga0208937_10477893 | 3300025506 | Peatland | LVRLSRVNTGVLRDLLGMAYKYVTANSAGRSPSRKRRKPGIGN |
| Ga0208848_10372451 | 3300025509 | Arctic Peat Soil | GCNSVLVRLSRVNLDVLRDLLGMAHKFVTRNAEPRSPAWRRRKLGPRK |
| Ga0207700_112042611 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | INSNVLQDLLGMAHKFVTRNAAPRSPARKHRKVGSRK |
| Ga0207679_110503511 | 3300025945 | Corn Rhizosphere | VLVRLSKVNPNVLRDLLGMAYKFVTRKSAPRPRSRKTRIG |
| Ga0209116_10394644 | 3300027590 | Forest Soil | SRVTPDVLRDLLGMAHKFVTASDVGRSSSRNRRKPV |
| Ga0209117_10032341 | 3300027645 | Forest Soil | GYNAVLVRLSRVHRDVLRDLLGMAYKFVTRKAARRSPARKR |
| Ga0209167_102880921 | 3300027867 | Surface Soil | VLSSFHHRQRSHYVGYSAVLVRLARVNADVLRDLLGMAYKFVTRSTAPRSPARKLRKLRSGE |
| Ga0209169_101499213 | 3300027879 | Soil | SRVTPDVLRDLLGMAHKFVTADAARPSPSRNRRKPV |
| Ga0209006_104409212 | 3300027908 | Forest Soil | YVGHTSVLVRLSRVNPDALRDLLGMAHKFVTRKAVSRSPARKRRKLGPRK |
| Ga0311358_107310632 | 3300029915 | Bog | YAGYNFVLVRLSRVSADELRDLLGMAYKFLTRKAVPQSPVRKRRGTGNSK |
| Ga0311328_102672193 | 3300029939 | Bog | SHVTHDVLRDLLGMAHKFVTADAARRSPSRNKRKPV |
| Ga0311328_104557043 | 3300029939 | Bog | TDHYLNYSAVLVRMSRLTPDVLRDLLGMAHKFVTADVARRLPSQNKRTRI |
| Ga0311340_105891072 | 3300029943 | Palsa | VNPEVLQDLLGVAYKFVIRSAAPRSLARKSRKRAPGK |
| Ga0311343_107527461 | 3300029953 | Bog | LSRVTPDVLRDLLGMAHKFVTASDAGRSSSRNRRKPV |
| Ga0302300_10837183 | 3300030042 | Palsa | SRVTPDVLRDLLGMAHKFVTADAARRSPSRNRRKPV |
| Ga0302177_106628192 | 3300030053 | Palsa | VLVRLSRVNPEVLRDLLGVAYKFVTRTAAPRSPSRKLRKRAPGK |
| Ga0311355_115369842 | 3300030580 | Palsa | HYEGFDAVLVRLARVTPDVLRDLLSMAYKYVGRNTGRKPAVGKRRKPAGRA |
| Ga0170824_1243401012 | 3300031231 | Forest Soil | AVLVRLSRINSNVLRDLLGMAYKFVTRKSAPRPRVRKPR |
| Ga0170820_154201761 | 3300031446 | Forest Soil | VTDHYAGYNAVLVRLSRVNSNVLQDLLGMAHKLVTRNSAPRSPARKRR |
| Ga0302326_130727092 | 3300031525 | Palsa | TDHYAPHNVVLVRLPRVKRDVLRDLLGMAHKFVTRRVEPRPPARKRR |
| Ga0307474_107452572 | 3300031718 | Hardwood Forest Soil | YLNYTAVPVRLSRVTPDVLRDLLGMAHKFVTSHEARRSPSRSPRKHV |
| Ga0307475_101078151 | 3300031754 | Hardwood Forest Soil | TAVLVRLSRVTPDVLRDLLGLAQKFVTAHAARRSPSRNRRKPV |
| Ga0307475_104543592 | 3300031754 | Hardwood Forest Soil | YVGYSAVLVRLSCVNPDVLRDLLGMAYKFVTRKPAPRSPARKRGK |
| Ga0306926_123963402 | 3300031954 | Soil | AVLVRLSRVTPDVLRDLLGMAHKFVIADKARGSPTRKRGKRI |
| Ga0306924_106536923 | 3300032076 | Soil | GVLVRLSRVTPNVLRELLGMAHKFVTAHAAPRSPSRHRRKPV |
| Ga0311301_104479841 | 3300032160 | Peatlands Soil | VRLSRVNPDALRDLLGMAYKFVTRKAAPRSPARKRR |
| Ga0307471_1003218661 | 3300032180 | Hardwood Forest Soil | GYSAVLVRLSCVNPDVLRDLLGMAYKFVTRKPAPRSAARKRGK |
| Ga0307472_1012291182 | 3300032205 | Hardwood Forest Soil | DHYVGYSAVLVRLSCVNPDVLRDLLGMAYKFVTRKPAPRSAARKRGK |
| Ga0335079_106276163 | 3300032783 | Soil | LVRMSRIGPDELRDLLGMAYKFVTRKGPRRAAPRRRRSREGKPARS |
| Ga0335080_106979142 | 3300032828 | Soil | HYVGYSAVLVRLTRVTPDVLRDLLGMAHKFVTAKLAHPSPSKKRPRR |
| Ga0335070_114567602 | 3300032829 | Soil | AVLVRLGRINADALRDLLGMAHKFVTRKAAKPPARKRR |
| Ga0335081_103314024 | 3300032892 | Soil | YLDYSAVLVRLSRTTTNVLRGLLGMAHKFVTADAARRSPSRHRRKPA |
| Ga0310914_111561991 | 3300033289 | Soil | VGNAVLVRLSRVNPGVLRDLLGMAYKFVTRNAARRSPSRKRR |
| Ga0326728_101788633 | 3300033402 | Peat Soil | NRDVLRDLLGMAYKFVTRNAAPHSPVRKRRKLGPRK |
| Ga0371489_0104470_1494_1643 | 3300033755 | Peat Soil | MDYNGVLVRLSRVSPEVLRDLLGMAYKFVTSNVGPRSSSRKRRKRGPRR |
| Ga0314861_0036914_117_251 | 3300033977 | Peatland | MLVRLSRVSPGVLRDLLGMAYKFVTSKAGSRSSSRKRKKLGLGR |
| Ga0314861_0506060_2_145 | 3300033977 | Peatland | YNAVLVRLSRVSPDVLRDLLVMAYKFVTAKAGSRSSSRKRRKLRPRI |
| ⦗Top⦘ |