


| Basic Information | |
|---|---|
| Family ID | F056174 |
| Family Type | Metagenome |
| Number of Sequences | 138 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MRKGLSGGVKSGPPPKKGPNPQGIKLKDAKKLLRKAVRKK |
| Number of Associated Samples | 99 |
| Number of Associated Scaffolds | 138 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 55.80 % |
| % of genes near scaffold ends (potentially truncated) | 42.75 % |
| % of genes from short scaffolds (< 2000 bps) | 73.19 % |
| Associated GOLD sequencing projects | 78 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.30 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (79.710 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (38.406 % of family members) |
| Environment Ontology (ENVO) | Unclassified (76.087 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (88.406 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 20.59% β-sheet: 0.00% Coil/Unstructured: 79.41% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.30 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 138 Family Scaffolds |
|---|---|---|
| PF00961 | LAGLIDADG_1 | 6.52 |
| PF00166 | Cpn10 | 2.17 |
| PF13640 | 2OG-FeII_Oxy_3 | 1.45 |
| PF13578 | Methyltransf_24 | 1.45 |
| PF07883 | Cupin_2 | 0.72 |
| COG ID | Name | Functional Category | % Frequency in 138 Family Scaffolds |
|---|---|---|---|
| COG0234 | Co-chaperonin GroES (HSP10) | Posttranslational modification, protein turnover, chaperones [O] | 2.17 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 90.58 % |
| Unclassified | root | N/A | 7.97 % |
| unclassified Hyphomonas | no rank | unclassified Hyphomonas | 1.45 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000947|BBAY92_10113551 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 718 | Open in IMG/M |
| 3300000973|BBAY93_10153376 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 579 | Open in IMG/M |
| 3300001419|JGI11705J14877_10067164 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1153 | Open in IMG/M |
| 3300002231|KVRMV2_101564916 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 703 | Open in IMG/M |
| 3300002482|JGI25127J35165_1117917 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 526 | Open in IMG/M |
| 3300002483|JGI25132J35274_1002825 | All Organisms → cellular organisms → Bacteria | 4501 | Open in IMG/M |
| 3300002483|JGI25132J35274_1018077 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1690 | Open in IMG/M |
| 3300004097|Ga0055584_100258560 | All Organisms → cellular organisms → Bacteria | 1779 | Open in IMG/M |
| 3300004097|Ga0055584_100920766 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 915 | Open in IMG/M |
| 3300004951|Ga0068513_1025608 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 639 | Open in IMG/M |
| 3300005074|Ga0070431_1015872 | All Organisms → cellular organisms → Bacteria | 4348 | Open in IMG/M |
| 3300005346|Ga0074242_10902505 | Not Available | 2383 | Open in IMG/M |
| 3300006025|Ga0075474_10169482 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 679 | Open in IMG/M |
| 3300006026|Ga0075478_10112410 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 864 | Open in IMG/M |
| 3300006027|Ga0075462_10018592 | All Organisms → cellular organisms → Bacteria | 2240 | Open in IMG/M |
| 3300006027|Ga0075462_10209582 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 584 | Open in IMG/M |
| 3300006637|Ga0075461_10216567 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 569 | Open in IMG/M |
| 3300006735|Ga0098038_1005315 | Not Available | 5245 | Open in IMG/M |
| 3300006735|Ga0098038_1031509 | All Organisms → cellular organisms → Bacteria | 1976 | Open in IMG/M |
| 3300006735|Ga0098038_1041991 | All Organisms → cellular organisms → Bacteria | 1675 | Open in IMG/M |
| 3300006735|Ga0098038_1042509 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 1663 | Open in IMG/M |
| 3300006735|Ga0098038_1048140 | All Organisms → cellular organisms → Bacteria | 1546 | Open in IMG/M |
| 3300006735|Ga0098038_1068248 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 1261 | Open in IMG/M |
| 3300006737|Ga0098037_1116780 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 915 | Open in IMG/M |
| 3300006737|Ga0098037_1123848 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 882 | Open in IMG/M |
| 3300006749|Ga0098042_1046113 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 1194 | Open in IMG/M |
| 3300006752|Ga0098048_1142261 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 717 | Open in IMG/M |
| 3300006789|Ga0098054_1219757 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 690 | Open in IMG/M |
| 3300006790|Ga0098074_1047032 | All Organisms → cellular organisms → Bacteria | 1215 | Open in IMG/M |
| 3300006793|Ga0098055_1337864 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 561 | Open in IMG/M |
| 3300006802|Ga0070749_10135955 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 1437 | Open in IMG/M |
| 3300006867|Ga0075476_10273801 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 597 | Open in IMG/M |
| 3300006868|Ga0075481_10016386 | All Organisms → cellular organisms → Bacteria | 2945 | Open in IMG/M |
| 3300006916|Ga0070750_10019190 | Not Available | 3489 | Open in IMG/M |
| 3300006916|Ga0070750_10101614 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 1332 | Open in IMG/M |
| 3300006919|Ga0070746_10516716 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 522 | Open in IMG/M |
| 3300006921|Ga0098060_1113363 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 763 | Open in IMG/M |
| 3300006921|Ga0098060_1154336 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 636 | Open in IMG/M |
| 3300006922|Ga0098045_1019387 | Not Available | 1825 | Open in IMG/M |
| 3300006924|Ga0098051_1054628 | All Organisms → cellular organisms → Bacteria | 1100 | Open in IMG/M |
| 3300006928|Ga0098041_1068146 | All Organisms → cellular organisms → Bacteria | 1149 | Open in IMG/M |
| 3300006928|Ga0098041_1109554 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 891 | Open in IMG/M |
| 3300006928|Ga0098041_1117773 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 857 | Open in IMG/M |
| 3300006929|Ga0098036_1078785 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1015 | Open in IMG/M |
| 3300006929|Ga0098036_1262739 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 521 | Open in IMG/M |
| 3300006958|Ga0101660_103026 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 662 | Open in IMG/M |
| 3300009027|Ga0102957_1055924 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1355 | Open in IMG/M |
| 3300010299|Ga0129342_1093933 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1130 | Open in IMG/M |
| 3300010318|Ga0136656_1124344 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 893 | Open in IMG/M |
| 3300012920|Ga0160423_10334681 | unclassified Hyphomonas → Hyphomonas sp. | 1039 | Open in IMG/M |
| 3300012920|Ga0160423_10616485 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 734 | Open in IMG/M |
| 3300017721|Ga0181373_1088277 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 551 | Open in IMG/M |
| 3300017726|Ga0181381_1016432 | Not Available | 1705 | Open in IMG/M |
| 3300017755|Ga0181411_1007755 | All Organisms → cellular organisms → Bacteria | 3628 | Open in IMG/M |
| 3300017756|Ga0181382_1196393 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 511 | Open in IMG/M |
| 3300017767|Ga0181406_1119018 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 797 | Open in IMG/M |
| 3300017769|Ga0187221_1169962 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 640 | Open in IMG/M |
| 3300017781|Ga0181423_1016748 | Not Available | 3025 | Open in IMG/M |
| 3300017824|Ga0181552_10017809 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 4498 | Open in IMG/M |
| 3300017963|Ga0180437_11287101 | Not Available | 519 | Open in IMG/M |
| 3300018080|Ga0180433_10140971 | All Organisms → cellular organisms → Bacteria | 2021 | Open in IMG/M |
| 3300018080|Ga0180433_10614632 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 815 | Open in IMG/M |
| 3300018415|Ga0181559_10781768 | Not Available | 508 | Open in IMG/M |
| 3300018416|Ga0181553_10118279 | All Organisms → cellular organisms → Bacteria | 1613 | Open in IMG/M |
| 3300018416|Ga0181553_10381244 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 769 | Open in IMG/M |
| 3300018420|Ga0181563_10251531 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 1053 | Open in IMG/M |
| 3300018420|Ga0181563_10703835 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 557 | Open in IMG/M |
| 3300018421|Ga0181592_10343533 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 1068 | Open in IMG/M |
| 3300018424|Ga0181591_10086940 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 2575 | Open in IMG/M |
| 3300020051|Ga0181555_1099308 | All Organisms → cellular organisms → Bacteria | 1291 | Open in IMG/M |
| 3300020400|Ga0211636_10333118 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 575 | Open in IMG/M |
| 3300020403|Ga0211532_10351843 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 560 | Open in IMG/M |
| 3300020410|Ga0211699_10252983 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 680 | Open in IMG/M |
| 3300020436|Ga0211708_10003323 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 6014 | Open in IMG/M |
| 3300020436|Ga0211708_10156524 | All Organisms → cellular organisms → Bacteria | 907 | Open in IMG/M |
| 3300020439|Ga0211558_10138157 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 1179 | Open in IMG/M |
| 3300021356|Ga0213858_10194011 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 987 | Open in IMG/M |
| 3300021959|Ga0222716_10093801 | All Organisms → cellular organisms → Bacteria | 2040 | Open in IMG/M |
| 3300021964|Ga0222719_10056993 | All Organisms → Viruses → Predicted Viral | 2959 | Open in IMG/M |
| 3300022057|Ga0212025_1050657 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 716 | Open in IMG/M |
| 3300022063|Ga0212029_1062562 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 544 | Open in IMG/M |
| 3300022065|Ga0212024_1006419 | Not Available | 1624 | Open in IMG/M |
| 3300022068|Ga0212021_1053224 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 823 | Open in IMG/M |
| 3300022069|Ga0212026_1076508 | Not Available | 509 | Open in IMG/M |
| 3300022071|Ga0212028_1026222 | All Organisms → cellular organisms → Bacteria | 1045 | Open in IMG/M |
| 3300022158|Ga0196897_1013590 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1004 | Open in IMG/M |
| 3300022164|Ga0212022_1051849 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 634 | Open in IMG/M |
| 3300022168|Ga0212027_1005171 | All Organisms → Viruses → Predicted Viral | 1745 | Open in IMG/M |
| 3300022183|Ga0196891_1032493 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 977 | Open in IMG/M |
| 3300022907|Ga0255775_1200748 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 763 | Open in IMG/M |
| 3300022929|Ga0255752_10071764 | All Organisms → Viruses | 2013 | Open in IMG/M |
| 3300024301|Ga0233451_10199569 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 854 | Open in IMG/M |
| 3300024433|Ga0209986_10025456 | All Organisms → cellular organisms → Bacteria | 3883 | Open in IMG/M |
| 3300024433|Ga0209986_10063651 | All Organisms → Viruses | 2122 | Open in IMG/M |
| 3300025070|Ga0208667_1002862 | All Organisms → cellular organisms → Bacteria | 5416 | Open in IMG/M |
| 3300025070|Ga0208667_1013110 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 1810 | Open in IMG/M |
| 3300025083|Ga0208791_1003018 | All Organisms → cellular organisms → Bacteria | 5322 | Open in IMG/M |
| 3300025086|Ga0208157_1006966 | All Organisms → Viruses | 3959 | Open in IMG/M |
| 3300025086|Ga0208157_1028981 | All Organisms → Viruses | 1612 | Open in IMG/M |
| 3300025086|Ga0208157_1029102 | All Organisms → cellular organisms → Bacteria | 1608 | Open in IMG/M |
| 3300025099|Ga0208669_1086044 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 670 | Open in IMG/M |
| 3300025101|Ga0208159_1010722 | All Organisms → cellular organisms → Bacteria | 2482 | Open in IMG/M |
| 3300025101|Ga0208159_1042825 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 971 | Open in IMG/M |
| 3300025101|Ga0208159_1098844 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 522 | Open in IMG/M |
| 3300025102|Ga0208666_1012505 | All Organisms → Viruses | 2872 | Open in IMG/M |
| 3300025102|Ga0208666_1084359 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 811 | Open in IMG/M |
| 3300025110|Ga0208158_1009006 | All Organisms → Viruses → Predicted Viral | 2765 | Open in IMG/M |
| 3300025120|Ga0209535_1024005 | All Organisms → cellular organisms → Bacteria | 3017 | Open in IMG/M |
| 3300025127|Ga0209348_1001853 | All Organisms → Viruses | 10138 | Open in IMG/M |
| 3300025127|Ga0209348_1010851 | All Organisms → cellular organisms → Bacteria | 3650 | Open in IMG/M |
| 3300025127|Ga0209348_1011381 | Not Available | 3543 | Open in IMG/M |
| 3300025127|Ga0209348_1078631 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 1056 | Open in IMG/M |
| 3300025127|Ga0209348_1171971 | unclassified Hyphomonas → Hyphomonas sp. | 624 | Open in IMG/M |
| 3300025128|Ga0208919_1000216 | All Organisms → cellular organisms → Bacteria | 42247 | Open in IMG/M |
| 3300025128|Ga0208919_1036830 | All Organisms → Viruses → Predicted Viral | 1739 | Open in IMG/M |
| 3300025128|Ga0208919_1160370 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 692 | Open in IMG/M |
| 3300025137|Ga0209336_10124942 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 702 | Open in IMG/M |
| 3300025151|Ga0209645_1012677 | All Organisms → Viruses | 3351 | Open in IMG/M |
| 3300025151|Ga0209645_1044397 | All Organisms → Viruses | 1583 | Open in IMG/M |
| 3300025151|Ga0209645_1075609 | All Organisms → Viruses → Predicted Viral | 1128 | Open in IMG/M |
| 3300025151|Ga0209645_1219321 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 549 | Open in IMG/M |
| 3300025647|Ga0208160_1045239 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1273 | Open in IMG/M |
| 3300025674|Ga0208162_1012968 | All Organisms → Viruses | 3420 | Open in IMG/M |
| 3300025674|Ga0208162_1121299 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 750 | Open in IMG/M |
| 3300025687|Ga0208019_1022970 | All Organisms → cellular organisms → Bacteria | 2412 | Open in IMG/M |
| 3300025759|Ga0208899_1144940 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 820 | Open in IMG/M |
| 3300025759|Ga0208899_1148700 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 804 | Open in IMG/M |
| 3300025810|Ga0208543_1036101 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1236 | Open in IMG/M |
| 3300025815|Ga0208785_1046779 | All Organisms → cellular organisms → Bacteria | 1228 | Open in IMG/M |
| 3300025815|Ga0208785_1067961 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 947 | Open in IMG/M |
| 3300025897|Ga0209425_10059695 | All Organisms → Viruses | 2470 | Open in IMG/M |
| 3300026138|Ga0209951_1050845 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 889 | Open in IMG/M |
| 3300026187|Ga0209929_1009914 | All Organisms → cellular organisms → Bacteria | 3115 | Open in IMG/M |
| 3300029309|Ga0183683_1000084 | All Organisms → cellular organisms → Bacteria | 56835 | Open in IMG/M |
| 3300029309|Ga0183683_1005274 | All Organisms → cellular organisms → Bacteria | 3966 | Open in IMG/M |
| 3300029792|Ga0183826_1021750 | All Organisms → cellular organisms → Bacteria | 1031 | Open in IMG/M |
| 3300034374|Ga0348335_111379 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 833 | Open in IMG/M |
| 3300034375|Ga0348336_020819 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 3400 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 38.41% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 23.19% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 8.70% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 6.52% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 4.35% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 2.17% |
| Pond Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water | 2.17% |
| Hypersaline Lake Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Sediment → Hypersaline Lake Sediment | 2.17% |
| Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 1.45% |
| Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 1.45% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 1.45% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 1.45% |
| Saline Water And Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Sediment → Saline Water And Sediment | 1.45% |
| Macroalgal Surface | Host-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface | 1.45% |
| Marine Water | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine Water | 0.72% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 0.72% |
| Marine Sediment | Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment | 0.72% |
| Marine Benthic Sponge Stylissa Massa Associated | Host-Associated → Porifera → Unclassified → Unclassified → Unclassified → Marine Benthic Sponge Stylissa Massa Associated | 0.72% |
| Coelocarteria Singaporensis (Marine Sponge) | Host-Associated → Porifera → Unclassified → Unclassified → Unclassified → Coelocarteria Singaporensis (Marine Sponge) | 0.72% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000947 | Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY92 | Host-Associated | Open in IMG/M |
| 3300000973 | Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY93 | Host-Associated | Open in IMG/M |
| 3300001419 | Saline surface water microbial communities from Etoliko Lagoon, Greece - halocline water (15 m) | Environmental | Open in IMG/M |
| 3300002231 | Marine sediment microbial communities from Santorini caldera mats, Greece - red mat | Environmental | Open in IMG/M |
| 3300002482 | Marine viral communities from the Pacific Ocean - ETNP_2_30 | Environmental | Open in IMG/M |
| 3300002483 | Marine viral communities from the Pacific Ocean - ETNP_6_30 | Environmental | Open in IMG/M |
| 3300004097 | Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - OSD3 (Helgoland) metaG | Environmental | Open in IMG/M |
| 3300004951 | Marine water microbial communities from the East Sea, Korea with extracellular vesicles - East-Sea-EVs | Environmental | Open in IMG/M |
| 3300005074 | Marine benthic sponge Stylissa massa associated microbial communities from Guam, USA | Host-Associated | Open in IMG/M |
| 3300005346 | Saline sediment microbial community from Etoliko Lagoon, Greece | Environmental | Open in IMG/M |
| 3300006025 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006026 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006027 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006637 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006735 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG | Environmental | Open in IMG/M |
| 3300006737 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG | Environmental | Open in IMG/M |
| 3300006749 | Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaG | Environmental | Open in IMG/M |
| 3300006752 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG | Environmental | Open in IMG/M |
| 3300006789 | Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG | Environmental | Open in IMG/M |
| 3300006790 | Marine viral communities from the Gulf of Mexico - 32_GoM_OMZ_CsCl metaG | Environmental | Open in IMG/M |
| 3300006793 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006867 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006868 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006916 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 | Environmental | Open in IMG/M |
| 3300006919 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 | Environmental | Open in IMG/M |
| 3300006921 | Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG | Environmental | Open in IMG/M |
| 3300006922 | Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaG | Environmental | Open in IMG/M |
| 3300006924 | Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG | Environmental | Open in IMG/M |
| 3300006928 | Marine viral communities from the Subarctic Pacific Ocean - 8_ETSP_OMZ_AT15162 metaG | Environmental | Open in IMG/M |
| 3300006929 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG | Environmental | Open in IMG/M |
| 3300006958 | Marine sponge C. singaporensis. microbiome, Papua New Guinea CO2 seep, Upa-Upasina 'bubble', co31is | Host-Associated | Open in IMG/M |
| 3300009027 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_A_H2O_MG | Environmental | Open in IMG/M |
| 3300010299 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.2_DNA | Environmental | Open in IMG/M |
| 3300010318 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.8_DNA | Environmental | Open in IMG/M |
| 3300012920 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St8 metaG | Environmental | Open in IMG/M |
| 3300017721 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_09 viral metaG | Environmental | Open in IMG/M |
| 3300017726 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 4 SPOT_SRF_2009-09-24 | Environmental | Open in IMG/M |
| 3300017755 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 34 SPOT_SRF_2012-07-09 | Environmental | Open in IMG/M |
| 3300017756 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 5 SPOT_SRF_2009-10-22 | Environmental | Open in IMG/M |
| 3300017767 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 29 SPOT_SRF_2011-12-20 | Environmental | Open in IMG/M |
| 3300017769 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 5 SPOT_SRF_2009-10-22 (version 2) | Environmental | Open in IMG/M |
| 3300017781 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 46 SPOT_SRF_2013-08-14 | Environmental | Open in IMG/M |
| 3300017824 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011501BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017963 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_3_D_1 metaG | Environmental | Open in IMG/M |
| 3300018080 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_1_D_1 metaG | Environmental | Open in IMG/M |
| 3300018415 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011508AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018416 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018420 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018421 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018424 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300020051 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011504AT metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020400 | Marine microbial communities from Tara Oceans - TARA_B100001115 (ERX555947-ERR598992) | Environmental | Open in IMG/M |
| 3300020403 | Marine microbial communities from Tara Oceans - TARA_B100000085 (ERX556015-ERR599145) | Environmental | Open in IMG/M |
| 3300020410 | Marine microbial communities from Tara Oceans - TARA_B100000519 (ERX555959-ERR599148) | Environmental | Open in IMG/M |
| 3300020436 | Marine microbial communities from Tara Oceans - TARA_B100000424 (ERX556009-ERR598984) | Environmental | Open in IMG/M |
| 3300020439 | Marine microbial communities from Tara Oceans - TARA_B100001939 (ERX556062-ERR599029) | Environmental | Open in IMG/M |
| 3300021356 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO245 | Environmental | Open in IMG/M |
| 3300021959 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13D | Environmental | Open in IMG/M |
| 3300021964 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_34D | Environmental | Open in IMG/M |
| 3300022057 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 (v2) | Environmental | Open in IMG/M |
| 3300022063 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v2) | Environmental | Open in IMG/M |
| 3300022065 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (v2) | Environmental | Open in IMG/M |
| 3300022068 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (v2) | Environmental | Open in IMG/M |
| 3300022069 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v2) | Environmental | Open in IMG/M |
| 3300022071 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v2) | Environmental | Open in IMG/M |
| 3300022158 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v3) | Environmental | Open in IMG/M |
| 3300022164 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (v2) | Environmental | Open in IMG/M |
| 3300022168 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v2) | Environmental | Open in IMG/M |
| 3300022183 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (v3) | Environmental | Open in IMG/M |
| 3300022907 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011511BT metaG | Environmental | Open in IMG/M |
| 3300022929 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG | Environmental | Open in IMG/M |
| 3300024301 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011504CT (spades assembly) | Environmental | Open in IMG/M |
| 3300024433 | Deep subsurface microbial communities from Black Sea to uncover new lineages of life (NeLLi) - Black_00105 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025070 | Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025083 | Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025086 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025099 | Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025101 | Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025102 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025110 | Marine viral communities from the Subarctic Pacific Ocean - 8_ETSP_OMZ_AT15162 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025120 | Marine viral communities from the Pacific Ocean - LP-28 (SPAdes) | Environmental | Open in IMG/M |
| 3300025127 | Marine viral communities from the Pacific Ocean - ETNP_2_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300025128 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025137 | Marine viral communities from the Pacific Ocean - LP-32 (SPAdes) | Environmental | Open in IMG/M |
| 3300025151 | Marine viral communities from the Pacific Ocean - ETNP_6_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300025647 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025674 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025687 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025759 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (SPAdes) | Environmental | Open in IMG/M |
| 3300025810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025815 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025897 | Pelagic Microbial community sample from North Sea - COGITO 998_met_05 (SPAdes) | Environmental | Open in IMG/M |
| 3300026138 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_A_H2O_MG (SPAdes) | Environmental | Open in IMG/M |
| 3300026187 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MG (SPAdes) | Environmental | Open in IMG/M |
| 3300029309 | Marine viral communities collected during Tara Oceans survey from station TARA_100 - TARA_R100001440 | Environmental | Open in IMG/M |
| 3300029792 | Marine giant viral communities collected during Tara Oceans survey from station TARA_041 - TARA_Y100000052 | Environmental | Open in IMG/M |
| 3300034374 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v4) | Environmental | Open in IMG/M |
| 3300034375 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v4) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| BBAY92_101135512 | 3300000947 | Macroalgal Surface | MRSEEQNKRKGLSGGVKSGPPPKRGPNPQGISLKNAKKFLRKSFRKK* |
| BBAY93_101533762 | 3300000973 | Macroalgal Surface | MRSERQNVRKGLSGGVKFGPPPKKGPNPQGIKIMRSKDGKKRLRKSIRKK* |
| JGI11705J14877_100671642 | 3300001419 | Saline Water And Sediment | MRKGLSGGKKYGPPPKKGPNPQGIKLKDAKKLLRKTL |
| KVRMV2_1015649162 | 3300002231 | Marine Sediment | LRRNNEKGLSGAVKFGPPPKRGPNPQGIKMVRSNGKKLLRKS |
| JGI25127J35165_11179172 | 3300002482 | Marine | MRSEEQNKRKGLSGGVKSGPPPKRGPNPQGITVKHAKKVLRKFKRNK* |
| JGI25132J35274_100282510 | 3300002483 | Marine | MNKRKGLSGGVKSGPPPKKGPNPQGITVKDAKRVLRKLKRNK* |
| JGI25132J35274_10180772 | 3300002483 | Marine | MQSERQNKRKGLSGGVKFGPPPKRGPNPQGIKIVRSKNAKKLVRKSSKRT* |
| Ga0055584_1002585602 | 3300004097 | Pelagic Marine | MTRSNEKGLSGGKRYGPPPKRGPNPQGITIAKAKKLLRKAVKKK* |
| Ga0055584_1009207663 | 3300004097 | Pelagic Marine | LTQRNNNSLSGGVKSGPPPKRGPNPQGIKIRDAKKLLRKTFKKK* |
| Ga0068513_10256082 | 3300004951 | Marine Water | MRSEELNKRKGLSGGVRSGPPPKRGPNPQGITVKHAKKVLQKSKRNK* |
| Ga0070431_10158724 | 3300005074 | Marine Benthic Sponge Stylissa Massa Associated | MQSERRDVRKGLSGGVKFGPPPKKGPNPQGIKIMRSSNGKKRLRKSTRKK* |
| Ga0074242_109025054 | 3300005346 | Saline Water And Sediment | MRKGLSGGKKYGPPPKKGPNPQGIKLKDAKKLLRKTLKKK* |
| Ga0075474_101694821 | 3300006025 | Aqueous | KRSTRKNKGKGLSGGVKYGPPPKKGPNPQGIELNRVKKLLRKAIGKK* |
| Ga0075478_101124102 | 3300006026 | Aqueous | MRKGLSGGKKYGPPPKKGPNPQGIKLKDAKKILRKTLKKK* |
| Ga0075462_100185924 | 3300006027 | Aqueous | MRKGLSGGVKSGPPPKKGPNPQGIKLKNAKKLLRKTLKKK* |
| Ga0075462_102095822 | 3300006027 | Aqueous | MRKGLSGGVKYGPPPKRGPNPQGIKILNKGSKNKNIYK |
| Ga0075461_102165671 | 3300006637 | Aqueous | SGGVKYGPPPKKGPNPQGIELNRAKRLLRQALKKK* |
| Ga0098038_100531513 | 3300006735 | Marine | GGVRYGPPPKKGPNPQGIKVSERKKLLRKLAGKA* |
| Ga0098038_10315093 | 3300006735 | Marine | MRKGLSGGVKSGPPPKKGPNPQGIKLKHAKKLLRKAVRKK* |
| Ga0098038_10419913 | 3300006735 | Marine | MQSERQNKRRGLSGGVKFGPPPKRGPNPQGIKIVRSKNAKKLVRKSTKKS* |
| Ga0098038_10425093 | 3300006735 | Marine | MRLEKQKKRKGLSGGVRYGPPPKKGPNPQGIKVSERKKLLRKLAGKA* |
| Ga0098038_10481403 | 3300006735 | Marine | MRSEEQNKRKGLSGGVKSGPPPKKGPNSQGITVKDAKKVLRKSKRNK* |
| Ga0098038_10682483 | 3300006735 | Marine | MRSEKQKKRKGLSGGVRYGPPPKKGPNPQGIKVSERKKLLRKLAGKA* |
| Ga0098037_11167801 | 3300006737 | Marine | MRKGLSGGVKSGPPPKRGPNPQGIKLKHAKKLLRKAVRKK* |
| Ga0098037_11238483 | 3300006737 | Marine | MRSEKQKKRKGLSGGVRYGPPPKKGPNPQGIKVSERKKLLRKLAGK |
| Ga0098042_10461133 | 3300006749 | Marine | MRSEEQNKRKGLSGGVRSGPPPKRGPNPQGITVKHAKKVLQKSKRNK* |
| Ga0098048_11422613 | 3300006752 | Marine | RRNNEKGLSGGVRSGPPPKRGPNPQGISVKHAKKVLRKSQRKK* |
| Ga0098054_12197572 | 3300006789 | Marine | MQSEKQKKRKGLSGGVRYGPPPKKGPNPQGIKVSERKKLLQKLAGKA* |
| Ga0098074_10470323 | 3300006790 | Marine | MQSEKQKKRKGLSGGVRYGPPPKKGPNPQGIKVSERKKLLRKLAGKA* |
| Ga0098055_13378643 | 3300006793 | Marine | TIKMRKGLSGGVKSGPPPKRGPNPQGIKLKHAKKLLRKAVRKK* |
| Ga0070749_101359552 | 3300006802 | Aqueous | MRKGLSGGVKSGPPPKKGPNPQGITLKDAKKLLRKTFKKK* |
| Ga0075476_102738011 | 3300006867 | Aqueous | STRKNKGKGLSGGVKYGPPPKKGPNPQGIELNRVKKLLRKAIGKK* |
| Ga0075481_100163864 | 3300006868 | Aqueous | MRKGLSGGVKSGPPPKKGPNPQGIKLRNAKKLLRKTFKKK* |
| Ga0070750_100191903 | 3300006916 | Aqueous | MRRNNEKGLSGGVRSGPPPKRGPNPQGITVKHAKKVLRRSQRKK* |
| Ga0070750_101016142 | 3300006916 | Aqueous | MRKGLSGGVKSGPPPKKGPNPQGITLKNAKKFLRKSFRKK* |
| Ga0070746_105167161 | 3300006919 | Aqueous | KRSTRKNKGKGLSGGVKYGPPPKKGPNPQGIKLNRAKRLLRQALKKK* |
| Ga0098060_11133632 | 3300006921 | Marine | MRKGLSGGVKSGPPPKKGPNPQGIKLKNAKKLLRKVVRKK* |
| Ga0098060_11543362 | 3300006921 | Marine | MRKGLSGGVRSGPPPKRGPNPQGIKLKHAKKLLRKAV |
| Ga0098045_10193871 | 3300006922 | Marine | KMRKGLSGGVKSGPPPKKGPNPQGIKLKNDKKFVRKIVRKK* |
| Ga0098051_10546281 | 3300006924 | Marine | NNEKGLSGGVKSGPPPKKGPNPQGITVKDAKRVLRKLKRNK* |
| Ga0098041_10681465 | 3300006928 | Marine | MRSEEQNKRKGLSGGVKSGPPPKRGPNPQGITVKDAKRVLRKLKRNK* |
| Ga0098041_11095541 | 3300006928 | Marine | SEKQKKRKGLSGGVRYGPPPKKGPNPQGIKVSERKKLLQKLAGKA* |
| Ga0098041_11177731 | 3300006928 | Marine | MQSEKQKKRKGLSGGVRYGPPPKRGPNPQGLKVGDAKKLLRKSSGKV* |
| Ga0098036_10787852 | 3300006929 | Marine | MRSEEQSKRKGLSGGVKSGPPPKRGPNPQGITVKDAKRVLRKLKRNK* |
| Ga0098036_12627392 | 3300006929 | Marine | MRSEEQNKRKGLSGGVRSGPPPKRGPNPQGITIKDAKRILRKLKREK* |
| Ga0101660_1030263 | 3300006958 | Coelocarteria Singaporensis (Marine Sponge) | KNKNTKRKGLSGGVRYGPPPKKGPNPQGINVSDAKKLLRKSSTKA* |
| Ga0102957_10559241 | 3300009027 | Pond Water | MRKGLSGGKKYGPPPKKGPNPQGIKLKDAKKLLRKAHKKK* |
| Ga0129342_10939332 | 3300010299 | Freshwater To Marine Saline Gradient | MRKGLSGGKKYGPPPKKGPNPQGIKLKDAKKLLRKTLK |
| Ga0136656_11243442 | 3300010318 | Freshwater To Marine Saline Gradient | MRKGLSGGKKYGPPPKKGPNPQGIKLKDAKKLLRKTFKKK* |
| Ga0160423_103346811 | 3300012920 | Surface Seawater | KRKGLSGGVRYGPPPKKGPNPQGIKVSERKKLLRKLAGKA* |
| Ga0160423_106164852 | 3300012920 | Surface Seawater | LQKNKDTKRKGLSGGVRYGPPPKKGPNPQGIKVSERKKLLRKLAGKA* |
| Ga0181373_10882772 | 3300017721 | Marine | MLRERNLRKNNEKGLSGGVRSGPPPKRGPNPQGISVKHAKKVLRKSQRK |
| Ga0181381_10164326 | 3300017726 | Seawater | QRRNNSLSGRVKSGPPPKRGPNPQGIKIQDAKKLLRKSFRKK |
| Ga0181411_100775513 | 3300017755 | Seawater | MLLEKNLRRNNEKGLSGGVRSGPPPKRGPNPQGISVKNAKKFLRKSVRKK |
| Ga0181382_11963931 | 3300017756 | Seawater | TQRRNNSLSGGVKSGPPPKRGPNPQGIKIQDAKKLLRKSFRKK |
| Ga0181406_11190182 | 3300017767 | Seawater | MQKKRKGLSGGVRSGPPPKRGPNPQGITFKHAKKILRKSKQNK |
| Ga0187221_11699621 | 3300017769 | Seawater | NEKGLSGGVRSGPPPKRGPNPQGIKIVRSKHGNKFLRKTSRGK |
| Ga0181423_10167481 | 3300017781 | Seawater | MLLEKNLRRNNEKGLSGGVRSGPPPKRGPNPQGISVKNAKKLLRKSVRKK |
| Ga0181552_100178094 | 3300017824 | Salt Marsh | MRKGLSGGVRSGPPPKRGPNPQGIKLKHAKKLLRKAVRKK |
| Ga0180437_112871011 | 3300017963 | Hypersaline Lake Sediment | MRKGLSGGKKYGPPPKKGPNPQGIKLKDAKKLLRKTLKKK |
| Ga0180433_101409712 | 3300018080 | Hypersaline Lake Sediment | MRKGLSGGVKSGPPPKKGPNPQGLKLKDVKKFLRKPSKKK |
| Ga0180433_106146321 | 3300018080 | Hypersaline Lake Sediment | GLSGGVKYGPPPKKGPNPQGIKLNRVKKLLRKAIGKK |
| Ga0181559_107817682 | 3300018415 | Salt Marsh | MRKGLSGGVRSGPPPKRGPNPQGIKLKHAKKLLRKAVRK |
| Ga0181553_101182793 | 3300018416 | Salt Marsh | MQSEKQKKRKGLSGGVRYGPPPKKGPNPQGIKVSERKKLLRKLAGKA |
| Ga0181553_103812443 | 3300018416 | Salt Marsh | MRRNNEKGLSGGVRSGPPPKRGPNPQGITVKHAKKVLRRSQRKK |
| Ga0181563_102515313 | 3300018420 | Salt Marsh | MRSEKQKKRKGLSGGVRYGPPPKKGPNPQGIKVSERKKLLRKLAGKA |
| Ga0181563_107038351 | 3300018420 | Salt Marsh | KRKGLSGGVRYGPPPKKGPNPQGIKVSERKKLLQKLAGKA |
| Ga0181592_103435332 | 3300018421 | Salt Marsh | MRKGLSGGVKSGPPPKKGPNPQGITLKDAKKILRKTFKKK |
| Ga0181591_100869403 | 3300018424 | Salt Marsh | MRKGLSGGVKSGPPPKKGPNPQGITLKDAKKVLRKTFKKK |
| Ga0181555_10993082 | 3300020051 | Salt Marsh | MRKGLSGGVRSGPPPKRGPNPQGIKLKHAKKLLRKAIRKK |
| Ga0211636_103331182 | 3300020400 | Marine | MQSERQTKRKGLSGGVKFGPPPKKGPNPQGIKMVRSKNAKKLVRNARKKS |
| Ga0211532_103518432 | 3300020403 | Marine | MRSERQNVRKGLSGGVKFGPPPKKGPNPQGIKIMRSKDGKKRLRKSIRKK |
| Ga0211699_102529832 | 3300020410 | Marine | MQSERRNVRKGLSGGVKFGPPPKRGPNPQGLQMMRSKDGKKRLRKSIKKK |
| Ga0211708_100033236 | 3300020436 | Marine | MQSERRNVRKGLSGGVKFGPPPKRGPNPQGLQMMRSKDGKKRLRKSIRKK |
| Ga0211708_101565242 | 3300020436 | Marine | MQSERRNVRKGLSGGVKYGPPPKKGPNPQGLKMMRSNNDKKRLRKSARKK |
| Ga0211558_101381574 | 3300020439 | Marine | MRKGLSGGVKSGPPPKRGPNPQGIKLKNVKKLLRKSQRKK |
| Ga0213858_101940111 | 3300021356 | Seawater | MRKGLSGGKKSGPPPKRGPNPQGISLKNAKKFLRKSFRKK |
| Ga0222716_100938016 | 3300021959 | Estuarine Water | MRKGLSGGVKSGPPPKRGPNPQGIKLKHAKKLLRKAVRKK |
| Ga0222719_100569933 | 3300021964 | Estuarine Water | MRKGLSGGVKSGPPPKKGPNPQGIKLKNAKKLLQKTLKKK |
| Ga0212025_10506571 | 3300022057 | Aqueous | SGGKKYGPPPKKGPNPQGIKLKDAKKLLRKTLKKK |
| Ga0212029_10625622 | 3300022063 | Aqueous | MRKGLSGGVKSGPPPKKGPNPQGITLKDAKKLLRKTFKKK |
| Ga0212024_10064195 | 3300022065 | Aqueous | MRKGLSGGVKSGPPPKKGPNPQGIKLKNAKKLLRKTLKKK |
| Ga0212021_10532242 | 3300022068 | Aqueous | MRKGLSGGKKYGPPPKKGPNPQGIKLKDAKKILRKTL |
| Ga0212026_10765082 | 3300022069 | Aqueous | MRKGLSGGKKYGPPPKKGPNPQGIKLKDAKKILRKTLKKK |
| Ga0212028_10262224 | 3300022071 | Aqueous | RSTRKNKGKGLSGGVKYGPPPKKGPNPQGIELNRVKKLLRKAIGKK |
| Ga0196897_10135901 | 3300022158 | Aqueous | MRKGLSGGVKYGPPPKRGPNPQGIKILNKGSKNKNIYKKRK |
| Ga0212022_10518491 | 3300022164 | Aqueous | ERKLTQRNNEKGLSGGVRSGPPPKRGPNPQGIKIQNAKKLLRKSFRKK |
| Ga0212027_10051713 | 3300022168 | Aqueous | MRKGLSGGVKSGPPPKKGPNPQGIKLRNAKKLLRKTFKKK |
| Ga0196891_10324931 | 3300022183 | Aqueous | EKGLSGGVRSGPPPKRGPNPQGIKIQNAKKLLRKSFRKK |
| Ga0255775_12007481 | 3300022907 | Salt Marsh | MRKGLSGGVRSGPPPKRGPNPQGIKLKHAKKLLRKA |
| Ga0255752_100717647 | 3300022929 | Salt Marsh | KQKKRKGLSGGVRYGPPPKKGPNPQGIKVSERKKLLRKLAGKA |
| Ga0233451_101995692 | 3300024301 | Salt Marsh | MRKGLSGGVRSGPPPKRGPNPQGIKLKHAKKLLRKS |
| Ga0209986_100254563 | 3300024433 | Deep Subsurface | MRKGLSGGVRSGPPPKRGPNPQGIKLKYAKKLLRKAIRKK |
| Ga0209986_100636518 | 3300024433 | Deep Subsurface | EDTIKMRKGLSGGVRSGPPPKRGPNPQGIKLKHAKKLLRKAVRKK |
| Ga0208667_10028625 | 3300025070 | Marine | MRKGLSGGVKSGPPPKKGPNPQGIKLKHAKKLLRKAVRKK |
| Ga0208667_10131102 | 3300025070 | Marine | MRKGLSGGVKSGPPPKKGPNPQGIKLKNDKKFVRKIVRKK |
| Ga0208791_10030186 | 3300025083 | Marine | MLLEKKLTQRRNNSLSGGVKSGPPPKRGPNPQGIKIQDAKKLLRKSVRKK |
| Ga0208157_10069663 | 3300025086 | Marine | MRSEEQNKRKGLSGGVKSGPPPKKGPNSQGITVKDAKKVLRKSKRNK |
| Ga0208157_10289813 | 3300025086 | Marine | MQSERQNKRRGLSGGVKFGPPPKRGPNPQGIKIVRSKNAKKLVRKSTKKS |
| Ga0208157_10291024 | 3300025086 | Marine | MRLEKQKKRKGLSGGVRYGPPPKKGPNPQGIKVSERKKLLRKLAGKA |
| Ga0208669_10860441 | 3300025099 | Marine | EDTIKMRKGLSGGVKSGPPPKRGPNPQGIKLKHAKKLLRKAVRKK |
| Ga0208159_10107222 | 3300025101 | Marine | MRKGLSGGVKSGPPPKKGPNPQGIKLKNAKKLLRKVVRKK |
| Ga0208159_10428253 | 3300025101 | Marine | MRSEEQNKRKGLSGGVRSGPPPKRGPNPQGITVKHAKKVLQKSKRN |
| Ga0208159_10988443 | 3300025101 | Marine | YLRQEKMQSERQNKRRGLSGGVKFGPPPKRGPNPQGIKIVRSKNAKKLVRKSTKKS |
| Ga0208666_10125055 | 3300025102 | Marine | MLQERNLRKNNEKGLSGGVKSGPPPKKGPNPQGIVVKNAKKVLQKSQRKK |
| Ga0208666_10843591 | 3300025102 | Marine | LTRNNEKGLSGGVRSGPPPKRGPNPQGISVKHAKKVLRKSQ |
| Ga0208158_10090062 | 3300025110 | Marine | MRKNNEKGLSGGVKSGPPPKKGPNSQGISVKDAKKVLRKLKRKK |
| Ga0209535_10240053 | 3300025120 | Marine | MRKGLSGGVKSGPPPKKGPNPQGIKLKDAKKLLRKAVRKK |
| Ga0209348_10018533 | 3300025127 | Marine | MQSGRRNVRKGLSGGVKFGPPPKRGPNPQGLQMMRSKDGKKRLRKSIRKK |
| Ga0209348_10108518 | 3300025127 | Marine | MRSEEQNKRKGLSGGVKSGPPPKRGPNPQGITVKHAKKVLRKFKRNK |
| Ga0209348_101138110 | 3300025127 | Marine | MRQGLSGGKKYGPPPKKGPNPQGIKLKNAKKLLRKSLKKK |
| Ga0209348_10786313 | 3300025127 | Marine | MRSEKQKKRKGLSGGVRYGPPPKKGPNPQGIKVSERKKLLRKL |
| Ga0209348_11719712 | 3300025127 | Marine | MQSERQTKRKGLSGGVKFGPPPKRGPNPQGINMGGSQNAKKLLRKPSKKK |
| Ga0208919_100021664 | 3300025128 | Marine | DKGLSGGVRSGPPPKKGPNPQGISIKHAKKILRKSKQHK |
| Ga0208919_10368302 | 3300025128 | Marine | MRSEEQSKRKGLSGGVKSGPPPKRGPNPQGITVKDAKRVLRKLKRNK |
| Ga0208919_11603703 | 3300025128 | Marine | GLSGGVKSGPPPKKGPNPQGITVKDAKRVLRKLKRNK |
| Ga0209336_101249421 | 3300025137 | Marine | RKGLSGGVKSGPPPKKGPNPQGIKLRDAKKLLRKAVRKK |
| Ga0209645_10126773 | 3300025151 | Marine | MNKRKGLSGGVKSGPPPKKGPNPQGITVKDAKRVLRKLKRNK |
| Ga0209645_10443973 | 3300025151 | Marine | MRSEEQKKRKGLSGGVKSGPPPKRGPNPQGITVKNAKKILRKSYKKK |
| Ga0209645_10756093 | 3300025151 | Marine | MRSEEQNKRKGLSGGVKSGPPPKRGPNPQGITLKDAKRVLRKSKRNK |
| Ga0209645_12193213 | 3300025151 | Marine | QYLKQEKMRSEKQKKRKGLSGGVRYGPPPKRGPNPQGLKVSDAKKLLRKSSGKA |
| Ga0208160_10452391 | 3300025647 | Aqueous | MRKGLSGGKKYGPPPKKGPNPQGIKLKDAKKLLRK |
| Ga0208162_10129682 | 3300025674 | Aqueous | MRKGLSGGVKSGPPPKKGPNPQGITLKNAKKFLRKSFRKK |
| Ga0208162_11212991 | 3300025674 | Aqueous | MRKGLSGGVRSGPPPKRGPNPQGIKLKHAKKLLRKSFK |
| Ga0208019_10229701 | 3300025687 | Aqueous | TRKNKGKGLSGGVKYGPPPKKGPNPQGIELNRVKKLLRKAIGKK |
| Ga0208899_11449402 | 3300025759 | Aqueous | MRKGLSGGKKYGPPPKKGPNPQGIKLKDAKKLLRKSLKKK |
| Ga0208899_11487001 | 3300025759 | Aqueous | MRKGLSGGVRSGPPPKRGPNPQGIKLKHAKKLLRKSFKK |
| Ga0208543_10361012 | 3300025810 | Aqueous | MRKGLSGGVKSGPPPKKGPNPQGIKLKNAKKLLRKT |
| Ga0208785_10467794 | 3300025815 | Aqueous | KRSTRKNKGKGLSGGVKYGPPPKKGPNPQGIELNRVKKLLRKAIGKK |
| Ga0208785_10679611 | 3300025815 | Aqueous | MRKGLSGGKKYGPPPKKGPNPQGIKLKDAKKLLRKT |
| Ga0209425_100596952 | 3300025897 | Pelagic Marine | MTRSNEKGLSGGKRYGPPPKRGPNPQGITIAKAKKLLRKAVKKK |
| Ga0209951_10508451 | 3300026138 | Pond Water | MRKGLSGGVRSGPPPKRGPNPQGIKIKHAKKLLRKAVRKK |
| Ga0209929_10099142 | 3300026187 | Pond Water | MRKGLSGGKKYGPPPKKGPNPQGIKLKDAKKLLRKAHKKK |
| Ga0183683_100008481 | 3300029309 | Marine | MRSEKQKKRKGLSGGVRYGPPPKKGPNPQGIKVSERKKLLRKLAGKV |
| Ga0183683_10052742 | 3300029309 | Marine | MRSEKQNKRKGLSGGVKSGPPPKRGPNPQGITVKNAKKILHKSYKKK |
| Ga0183826_10217502 | 3300029792 | Marine | MQSERRNVRKGLSGGVKFGPPPKKGPNPQGIKIMRSSNGKKRLRKSTRKK |
| Ga0348335_111379_1_126 | 3300034374 | Aqueous | MRKGLSGGVKYGPPPKRGPNPQGIKILNKGSKNKNIYKKRKS |
| Ga0348336_020819_3_119 | 3300034375 | Aqueous | MRKGLSGGKKYGPPPKKGPNPQGIKLKDAKKILRKTLKK |
| ⦗Top⦘ |