


| Basic Information | |
|---|---|
| Family ID | F056103 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 138 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MSWSWRDLVVLTFMVLLFGAAMMANVSDGPMHEYRGSWVTRASR |
| Number of Associated Samples | 105 |
| Number of Associated Scaffolds | 137 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 75.74 % |
| % of genes near scaffold ends (potentially truncated) | 39.13 % |
| % of genes from short scaffolds (< 2000 bps) | 84.06 % |
| Associated GOLD sequencing projects | 95 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.44 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (55.797 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (13.768 % of family members) |
| Environment Ontology (ENVO) | Unclassified (50.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (73.188 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 36.11% β-sheet: 0.00% Coil/Unstructured: 63.89% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.44 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 137 Family Scaffolds |
|---|---|---|
| PF04311 | DUF459 | 2.19 |
| PF01042 | Ribonuc_L-PSP | 1.46 |
| PF04226 | Transgly_assoc | 1.46 |
| PF00072 | Response_reg | 0.73 |
| PF00196 | GerE | 0.73 |
| PF00534 | Glycos_transf_1 | 0.73 |
| PF06411 | HdeA | 0.73 |
| PF00011 | HSP20 | 0.73 |
| PF03150 | CCP_MauG | 0.73 |
| PF01758 | SBF | 0.73 |
| PF10503 | Esterase_PHB | 0.73 |
| PF00004 | AAA | 0.73 |
| PF13560 | HTH_31 | 0.73 |
| PF02796 | HTH_7 | 0.73 |
| PF02735 | Ku | 0.73 |
| PF04679 | DNA_ligase_A_C | 0.73 |
| PF12844 | HTH_19 | 0.73 |
| PF13193 | AMP-binding_C | 0.73 |
| PF01527 | HTH_Tnp_1 | 0.73 |
| PF03807 | F420_oxidored | 0.73 |
| PF12833 | HTH_18 | 0.73 |
| COG ID | Name | Functional Category | % Frequency in 137 Family Scaffolds |
|---|---|---|---|
| COG2845 | Peptidoglycan O-acetyltransferase, SGNH hydrolase family | Cell wall/membrane/envelope biogenesis [M] | 2.19 |
| COG0251 | Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 family | Defense mechanisms [V] | 1.46 |
| COG2261 | Uncharacterized membrane protein YeaQ/YmgE, transglycosylase-associated protein family | General function prediction only [R] | 1.46 |
| COG0071 | Small heat shock protein IbpA, HSP20 family | Posttranslational modification, protein turnover, chaperones [O] | 0.73 |
| COG1273 | Non-homologous end joining protein Ku, dsDNA break repair | Replication, recombination and repair [L] | 0.73 |
| COG1793 | ATP-dependent DNA ligase | Replication, recombination and repair [L] | 0.73 |
| COG1858 | Cytochrome c peroxidase | Posttranslational modification, protein turnover, chaperones [O] | 0.73 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 55.80 % |
| All Organisms | root | All Organisms | 44.20 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459010|GIO7OMY01EFQ3X | Not Available | 527 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_101897963 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1021 | Open in IMG/M |
| 3300000955|JGI1027J12803_100606985 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 524 | Open in IMG/M |
| 3300000955|JGI1027J12803_101669717 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 613 | Open in IMG/M |
| 3300000955|JGI1027J12803_104477868 | Not Available | 526 | Open in IMG/M |
| 3300000955|JGI1027J12803_104601005 | Not Available | 514 | Open in IMG/M |
| 3300004153|Ga0063455_101093161 | Not Available | 588 | Open in IMG/M |
| 3300004479|Ga0062595_100380003 | Not Available | 1000 | Open in IMG/M |
| 3300005093|Ga0062594_100473179 | Not Available | 1047 | Open in IMG/M |
| 3300005167|Ga0066672_10821307 | Not Available | 583 | Open in IMG/M |
| 3300005330|Ga0070690_100055219 | Not Available | 2544 | Open in IMG/M |
| 3300005330|Ga0070690_100084445 | Not Available | 2081 | Open in IMG/M |
| 3300005339|Ga0070660_100915508 | Not Available | 740 | Open in IMG/M |
| 3300005347|Ga0070668_100564890 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 992 | Open in IMG/M |
| 3300005354|Ga0070675_100354174 | Not Available | 1302 | Open in IMG/M |
| 3300005355|Ga0070671_100832712 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 804 | Open in IMG/M |
| 3300005356|Ga0070674_101094497 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 703 | Open in IMG/M |
| 3300005365|Ga0070688_101018121 | Not Available | 659 | Open in IMG/M |
| 3300005367|Ga0070667_100560679 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1050 | Open in IMG/M |
| 3300005434|Ga0070709_10898080 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 700 | Open in IMG/M |
| 3300005437|Ga0070710_10801831 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 673 | Open in IMG/M |
| 3300005456|Ga0070678_100647504 | Not Available | 947 | Open in IMG/M |
| 3300005456|Ga0070678_100647504 | Not Available | 947 | Open in IMG/M |
| 3300005457|Ga0070662_101206680 | Not Available | 650 | Open in IMG/M |
| 3300005457|Ga0070662_101241986 | Not Available | 641 | Open in IMG/M |
| 3300005548|Ga0070665_100094084 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 3002 | Open in IMG/M |
| 3300005614|Ga0068856_101133199 | Not Available | 799 | Open in IMG/M |
| 3300005615|Ga0070702_100073459 | Not Available | 2026 | Open in IMG/M |
| 3300005618|Ga0068864_101632997 | Not Available | 649 | Open in IMG/M |
| 3300005719|Ga0068861_100811407 | Not Available | 879 | Open in IMG/M |
| 3300006163|Ga0070715_10466671 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. URHA0002 | 716 | Open in IMG/M |
| 3300006175|Ga0070712_100861952 | Not Available | 779 | Open in IMG/M |
| 3300006237|Ga0097621_101136519 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 734 | Open in IMG/M |
| 3300006797|Ga0066659_10182788 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1520 | Open in IMG/M |
| 3300006880|Ga0075429_100419701 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1172 | Open in IMG/M |
| 3300006881|Ga0068865_101665758 | Not Available | 574 | Open in IMG/M |
| 3300006953|Ga0074063_12430807 | Not Available | 533 | Open in IMG/M |
| 3300009094|Ga0111539_10505950 | Not Available | 1407 | Open in IMG/M |
| 3300009094|Ga0111539_10912575 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1021 | Open in IMG/M |
| 3300009094|Ga0111539_13195472 | Not Available | 528 | Open in IMG/M |
| 3300009098|Ga0105245_10989137 | Not Available | 885 | Open in IMG/M |
| 3300009098|Ga0105245_12238573 | Not Available | 600 | Open in IMG/M |
| 3300009100|Ga0075418_10526049 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1270 | Open in IMG/M |
| 3300009100|Ga0075418_12158771 | Not Available | 607 | Open in IMG/M |
| 3300009101|Ga0105247_10054410 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. | 2470 | Open in IMG/M |
| 3300009143|Ga0099792_11259597 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium | 504 | Open in IMG/M |
| 3300009148|Ga0105243_11163623 | Not Available | 783 | Open in IMG/M |
| 3300009156|Ga0111538_10133835 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3149 | Open in IMG/M |
| 3300009162|Ga0075423_11760362 | Not Available | 668 | Open in IMG/M |
| 3300009174|Ga0105241_11397670 | Not Available | 670 | Open in IMG/M |
| 3300009176|Ga0105242_11326405 | Not Available | 744 | Open in IMG/M |
| 3300009551|Ga0105238_12295228 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 575 | Open in IMG/M |
| 3300009553|Ga0105249_10249160 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1760 | Open in IMG/M |
| 3300009553|Ga0105249_11380632 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 776 | Open in IMG/M |
| 3300010375|Ga0105239_13641253 | Not Available | 501 | Open in IMG/M |
| 3300010397|Ga0134124_10504784 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1170 | Open in IMG/M |
| 3300011119|Ga0105246_11432572 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 646 | Open in IMG/M |
| 3300012198|Ga0137364_10068035 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2428 | Open in IMG/M |
| 3300012199|Ga0137383_10586371 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 816 | Open in IMG/M |
| 3300012212|Ga0150985_104806141 | Not Available | 659 | Open in IMG/M |
| 3300012212|Ga0150985_105177924 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 4543 | Open in IMG/M |
| 3300012212|Ga0150985_113496423 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1872 | Open in IMG/M |
| 3300012469|Ga0150984_101714470 | Not Available | 606 | Open in IMG/M |
| 3300012469|Ga0150984_112045668 | Not Available | 615 | Open in IMG/M |
| 3300012469|Ga0150984_120670027 | Not Available | 520 | Open in IMG/M |
| 3300012685|Ga0137397_10258476 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1298 | Open in IMG/M |
| 3300012944|Ga0137410_11683292 | Not Available | 558 | Open in IMG/M |
| 3300012951|Ga0164300_10024572 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Rhodovulum → unclassified Rhodovulum → Rhodovulum sp. PH10 | 2135 | Open in IMG/M |
| 3300012955|Ga0164298_10030203 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2426 | Open in IMG/M |
| 3300012955|Ga0164298_10162181 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi | 1268 | Open in IMG/M |
| 3300012958|Ga0164299_10435497 | All Organisms → cellular organisms → Bacteria | 853 | Open in IMG/M |
| 3300012958|Ga0164299_11478286 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 529 | Open in IMG/M |
| 3300012960|Ga0164301_10046761 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2199 | Open in IMG/M |
| 3300012984|Ga0164309_11078797 | Not Available | 667 | Open in IMG/M |
| 3300012985|Ga0164308_10374504 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1156 | Open in IMG/M |
| 3300012989|Ga0164305_10054377 | All Organisms → cellular organisms → Bacteria | 2362 | Open in IMG/M |
| 3300012989|Ga0164305_11521845 | Not Available | 594 | Open in IMG/M |
| 3300013297|Ga0157378_10991694 | Not Available | 874 | Open in IMG/M |
| 3300013297|Ga0157378_11925368 | Not Available | 640 | Open in IMG/M |
| 3300013306|Ga0163162_10483868 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1369 | Open in IMG/M |
| 3300013306|Ga0163162_10928309 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 982 | Open in IMG/M |
| 3300013306|Ga0163162_11141344 | Not Available | 883 | Open in IMG/M |
| 3300013306|Ga0163162_11271868 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. AUGA SZCCT0283 | 836 | Open in IMG/M |
| 3300013306|Ga0163162_12167223 | Not Available | 638 | Open in IMG/M |
| 3300013308|Ga0157375_11316085 | Not Available | 850 | Open in IMG/M |
| 3300013308|Ga0157375_13657406 | Not Available | 511 | Open in IMG/M |
| 3300014325|Ga0163163_11684150 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 695 | Open in IMG/M |
| 3300014326|Ga0157380_10648236 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1053 | Open in IMG/M |
| 3300014968|Ga0157379_10209271 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1765 | Open in IMG/M |
| 3300014968|Ga0157379_10459948 | Not Available | 1176 | Open in IMG/M |
| 3300015077|Ga0173483_10037309 | All Organisms → cellular organisms → Bacteria | 1802 | Open in IMG/M |
| 3300015371|Ga0132258_10203016 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 4810 | Open in IMG/M |
| 3300015371|Ga0132258_13350940 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi | 1101 | Open in IMG/M |
| 3300015373|Ga0132257_103552957 | Not Available | 567 | Open in IMG/M |
| 3300015374|Ga0132255_100900246 | Not Available | 1323 | Open in IMG/M |
| 3300017792|Ga0163161_10634328 | Not Available | 884 | Open in IMG/M |
| 3300017792|Ga0163161_11570844 | Not Available | 579 | Open in IMG/M |
| 3300018469|Ga0190270_11376955 | Not Available | 751 | Open in IMG/M |
| 3300018476|Ga0190274_11354199 | Not Available | 800 | Open in IMG/M |
| 3300018476|Ga0190274_11733180 | Not Available | 719 | Open in IMG/M |
| 3300018481|Ga0190271_10886369 | Not Available | 1017 | Open in IMG/M |
| 3300018482|Ga0066669_10114331 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1907 | Open in IMG/M |
| 3300018482|Ga0066669_10741954 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 866 | Open in IMG/M |
| 3300020579|Ga0210407_10000780 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 33300 | Open in IMG/M |
| 3300021475|Ga0210392_10000720 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 18983 | Open in IMG/M |
| 3300021479|Ga0210410_10084917 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2785 | Open in IMG/M |
| 3300025315|Ga0207697_10385566 | Not Available | 622 | Open in IMG/M |
| 3300025901|Ga0207688_10316590 | Not Available | 957 | Open in IMG/M |
| 3300025904|Ga0207647_10354393 | Not Available | 831 | Open in IMG/M |
| 3300025906|Ga0207699_11212453 | Not Available | 559 | Open in IMG/M |
| 3300025916|Ga0207663_11631380 | Not Available | 519 | Open in IMG/M |
| 3300025920|Ga0207649_10643283 | Not Available | 819 | Open in IMG/M |
| 3300025930|Ga0207701_10015414 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 7403 | Open in IMG/M |
| 3300025930|Ga0207701_10127071 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 2270 | Open in IMG/M |
| 3300025933|Ga0207706_10179813 | All Organisms → cellular organisms → Bacteria | 1857 | Open in IMG/M |
| 3300025934|Ga0207686_10965334 | Not Available | 690 | Open in IMG/M |
| 3300025936|Ga0207670_11102588 | Not Available | 670 | Open in IMG/M |
| 3300025937|Ga0207669_10678385 | Not Available | 845 | Open in IMG/M |
| 3300025938|Ga0207704_10478364 | Not Available | 999 | Open in IMG/M |
| 3300025939|Ga0207665_10533529 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 910 | Open in IMG/M |
| 3300025944|Ga0207661_10060434 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3058 | Open in IMG/M |
| 3300025960|Ga0207651_11005792 | Not Available | 745 | Open in IMG/M |
| 3300025972|Ga0207668_11742113 | Not Available | 562 | Open in IMG/M |
| 3300025981|Ga0207640_10896021 | Not Available | 774 | Open in IMG/M |
| 3300026041|Ga0207639_10977784 | Not Available | 792 | Open in IMG/M |
| 3300026089|Ga0207648_10281249 | Not Available | 1488 | Open in IMG/M |
| 3300026121|Ga0207683_10173426 | Not Available | 1954 | Open in IMG/M |
| 3300026121|Ga0207683_12122916 | Not Available | 510 | Open in IMG/M |
| 3300028379|Ga0268266_10235137 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi | 1689 | Open in IMG/M |
| 3300028710|Ga0307322_10121434 | Not Available | 682 | Open in IMG/M |
| 3300028802|Ga0307503_10456085 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 680 | Open in IMG/M |
| 3300028802|Ga0307503_10653716 | Not Available | 586 | Open in IMG/M |
| 3300031058|Ga0308189_10099382 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 920 | Open in IMG/M |
| 3300031740|Ga0307468_100385288 | Not Available | 1063 | Open in IMG/M |
| 3300032180|Ga0307471_100166642 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2149 | Open in IMG/M |
| 3300032205|Ga0307472_101282637 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 704 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 13.77% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.80% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 5.80% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.07% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 5.07% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 5.07% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 4.35% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.62% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 3.62% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 2.90% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.90% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.90% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 2.90% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.90% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.90% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.17% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.17% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 2.17% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.17% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.17% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.17% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 2.17% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 2.17% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.45% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.45% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.45% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 1.45% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.45% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 1.45% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.72% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.72% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.72% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.72% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.72% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.72% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459010 | Grass soil microbial communities from Rothamsted Park, UK - December 2009 direct MP BIO1O1 lysis 0-9cm (no DNA from 10 to 21cm!!!) | Environmental | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300004153 | Grasslands soil microbial communities from Hopland, California, USA (version 2) | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Environmental | Open in IMG/M |
| 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300006953 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015077 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028710 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_380 | Environmental | Open in IMG/M |
| 3300028802 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_S | Environmental | Open in IMG/M |
| 3300031058 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_184 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| F62_01072920 | 2170459010 | Grass Soil | LLWSWRDLDVLTFLMLLFGAAMMANVSDGPMHEYRGSWVTRASR |
| INPhiseqgaiiFebDRAFT_1018979631 | 3300000364 | Soil | MRKSWLDLAVLAFLVLLFVAAIMANISDGPMHEYRGAWV |
| JGI1027J12803_1006069851 | 3300000955 | Soil | MRKSWLDLAVLAFLVLLFVAAIMANISDGPMHEYRGAWVTRA |
| JGI1027J12803_1016697172 | 3300000955 | Soil | MSWGWRDLVMLTFLVLLFGAAMIANVSDGPMREHRGSWV |
| JGI1027J12803_1044778681 | 3300000955 | Soil | MWRNLVALTFSVFLLGAALMANVGDGPMSQYRGSWLTR |
| JGI1027J12803_1046010051 | 3300000955 | Soil | MWRELIALTFLGLLLGAAMIANVSDGPMREYRGSWAQPLRQAP |
| Ga0063455_1010931612 | 3300004153 | Soil | MLRRLRDLLVLMFLVLLLGAAMIANVSDGPMPEYRGSWVSRASRF* |
| Ga0062595_1003800031 | 3300004479 | Soil | MRKKDRTVMCWRDRVVLIFFVLLFGAAIMANLNEGPMHEYRGAWVTRVSR* |
| Ga0062594_1004731791 | 3300005093 | Soil | MSWSWRDLVALTHFVLLFGATMIANVSDGPMHEYRGSWVTRASR* |
| Ga0066672_108213072 | 3300005167 | Soil | MAWNWRDLVVLIFFVLLFGAAMMAHVSDGPLAEHRGTWVTHALR* |
| Ga0070690_1000552193 | 3300005330 | Switchgrass Rhizosphere | MSWSWRDLVVLTFMVVLFGAAMMANVSDGPMHEYRGSWVARASR* |
| Ga0070690_1000844451 | 3300005330 | Switchgrass Rhizosphere | MSWSWRDLVALTLFVLLFGATMIANVSDGPMHEYRGSWVTRASR* |
| Ga0070660_1009155081 | 3300005339 | Corn Rhizosphere | RMSWSWRDLFALTFFVQLFGAAMMANVSDGPMHEYRGSWVARASR* |
| Ga0070668_1005648902 | 3300005347 | Switchgrass Rhizosphere | MWRQLVGLIFWGLLFGAALMANVTDGPMRDHRGSWVTHASIGR* |
| Ga0070675_1003541743 | 3300005354 | Miscanthus Rhizosphere | MWRDLVALTFSVLLLGAAVMANLSGGPLPEHRGSWVTHASR* |
| Ga0070671_1008327122 | 3300005355 | Switchgrass Rhizosphere | MSWNWRNLVVLTFLVFLFGAAMMANVSDGPFHEYRGSWARHAL* |
| Ga0070674_1010944971 | 3300005356 | Miscanthus Rhizosphere | GSMSWNWRDLVVMAFFVLLFGAAMIANMVDGPMREHRGSWVTHALR* |
| Ga0070688_1010181212 | 3300005365 | Switchgrass Rhizosphere | GEGRMSWSWRDLVVLTFMVVLFGAAMMANVSDGPMHEYRGSWVARASR* |
| Ga0070667_1005606792 | 3300005367 | Switchgrass Rhizosphere | SWSWRDLVALTFLVLLFGTAMMANMSDGPMHEYRGSWVSRASR* |
| Ga0070709_108980803 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MWRELVGLSLLVVLLGAAMVANVTDGSMRDYRGSWLTHASK* |
| Ga0070710_108018312 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MWRDLVALTLAALLLGAAIVANVSDGPMRDFRGSWVTHASQ* |
| Ga0070678_1006475041 | 3300005456 | Miscanthus Rhizosphere | MSWSWRDLVVLTFLVLLFGAAMMANVSDGPMHEYRGSWVSRASR* |
| Ga0070678_1006475043 | 3300005456 | Miscanthus Rhizosphere | MSWSWRDLVVVTFLVMLLGGAMVANVSDGPMHQYRGSWVTRASR* |
| Ga0070662_1012066802 | 3300005457 | Corn Rhizosphere | MSWSWRDLVVVTFLVMLLGAAMVANVSDGLMHQYRGSWVTRASR* |
| Ga0070662_1012419861 | 3300005457 | Corn Rhizosphere | MWRDLVALTFSVLLLGAAVMANLSGGPLPEHRGSWVTHAS |
| Ga0070665_1000940843 | 3300005548 | Switchgrass Rhizosphere | MSWSWRDLFALTFFVLLFGAAMMANVSDGPMHEYRGSWVARASR* |
| Ga0068856_1011331993 | 3300005614 | Corn Rhizosphere | MWRNLVALTFSVFLLGAALMANVGDGPMSQYRGSW |
| Ga0070702_1000734591 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | MSWSWRDLVALTLFVLLFGVTMIANVSDGPMHEYRGSWVTRASR* |
| Ga0068864_1016329971 | 3300005618 | Switchgrass Rhizosphere | WRDLVALTFSVLLLGAAVMANLSGGPLPEHRGSWVTHASR* |
| Ga0068861_1008114071 | 3300005719 | Switchgrass Rhizosphere | MSWSWRDLVVVTFLVMLLGAAMVANVSDGPMHQYRGSWVT |
| Ga0070715_104666711 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | MSWNWRDLVELTFLVLLFGAAMIANVSDGPMREHRGSWVTHALR* |
| Ga0070712_1008619521 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MWRQMVGLIFWGLLFGAALMANVTDGPMRDHRGSWVTHASIGR* |
| Ga0097621_1011365192 | 3300006237 | Miscanthus Rhizosphere | MSWNWRDLVVMAFFVLLFGAAMIANMVDGPMREHRGSWVTHALR* |
| Ga0066659_101827885 | 3300006797 | Soil | MAWNWWDLVVLIFFVLLFGAAMMAHVSDGPLAEHRGTWVTHALR* |
| Ga0075429_1004197014 | 3300006880 | Populus Rhizosphere | MSWRWRELVVLTFLVLLLGAAMIANVSDGPMSEYRGSWVTRASRF* |
| Ga0068865_1016657581 | 3300006881 | Miscanthus Rhizosphere | MWRDLVALTFSVLLLGAAVMANLSGGPMPEHRGSWVTHASR* |
| Ga0074063_124308072 | 3300006953 | Soil | MWRELVGLTFLVLLFGAALMANVADGPMRDHRGSWVTHASIGR* |
| Ga0111539_105059502 | 3300009094 | Populus Rhizosphere | MSWSWRDLVVLTFLVMLLGAAMVANVSDGPMYEYQVRG* |
| Ga0111539_109125752 | 3300009094 | Populus Rhizosphere | MSWRWRDLVVLTFLVLLLGAAMIANVSDGPMSEYRGSWVTRASRF* |
| Ga0111539_131954721 | 3300009094 | Populus Rhizosphere | MSWSWRDLVVLTFMVLLFGAAMMANVSDGPMHEYRGSWVARASR* |
| Ga0105245_109891372 | 3300009098 | Miscanthus Rhizosphere | MWRNLVTLTLSVFLLGAALMANVGDGPMSQYRGSWLTRASR* |
| Ga0105245_122385731 | 3300009098 | Miscanthus Rhizosphere | MWRDLVALTFSVLLLGAAVMANLSGGPMPEHRGSWVTHASR |
| Ga0075418_105260491 | 3300009100 | Populus Rhizosphere | ESRMSSRWRELVGLTFLVLLLGAAMIANVSDGPMSEYRGSWVTRASRF* |
| Ga0075418_121587711 | 3300009100 | Populus Rhizosphere | MSWNWRDLVVLTFMVLLFGAAMMANVSDGPMHEYRGSWVARASR* |
| Ga0105247_100544101 | 3300009101 | Switchgrass Rhizosphere | MSWSWRDLVALTFLVLLFGTAMMANMSDGPMHEYRGSWV |
| Ga0099792_112595972 | 3300009143 | Vadose Zone Soil | MSWGWRDLVVLTFLVLVFGAAMIANVSDGPMREHRGSWVTHVLR* |
| Ga0105243_111636231 | 3300009148 | Miscanthus Rhizosphere | EGSMSWNWRDLVVMAFFVLLFGAAMIANMVDGPMREHRGSWVTHALR* |
| Ga0111538_101338353 | 3300009156 | Populus Rhizosphere | MSSRWRELVGLTFLVLLLGAAMIANVSDGPMSEYRGSWVTRASRF* |
| Ga0075423_117603621 | 3300009162 | Populus Rhizosphere | MELVGLGVLTFMVLLFGAAMMANVSDGPMHECRGSWVARASR* |
| Ga0105241_113326312 | 3300009174 | Corn Rhizosphere | VIRWRRTKRDKKGEAAMWRDLVALTFSVLLLGAAVMANLSGGPMPEHRGSWVTHASR* |
| Ga0105241_113976702 | 3300009174 | Corn Rhizosphere | EGRMSWSWRDLVVLTRVVVLLGAAMMARVSHGPMHEYRGSWVARASR* |
| Ga0105242_113264051 | 3300009176 | Miscanthus Rhizosphere | RQTFAYSDKCEKREGSMSWNWRDLVVMAFFVLLFGAAMIANMVDGPMREHRGSWVTHALR |
| Ga0105238_122952281 | 3300009551 | Corn Rhizosphere | MSWNWRNLVVLTFLVFLFGAAMMANVSDGPFHEYRGSWARHALR* |
| Ga0105249_102491602 | 3300009553 | Switchgrass Rhizosphere | MSRSWRDLVALTFFVLLFGAAMVANVSDGPLHEYRGSWVARAR* |
| Ga0105249_113806321 | 3300009553 | Switchgrass Rhizosphere | WRWRDLVVLTLLVLLLGAAMIANVSDGPMSEYRGSWVTRASRF* |
| Ga0105239_136412531 | 3300010375 | Corn Rhizosphere | MWRNLVALTFSVLLLGAALMANVGDGPMSQYRGSWLTRASR* |
| Ga0134124_105047841 | 3300010397 | Terrestrial Soil | EGSMSWNWRNLVVLTFLVFLFGAAMMANVSDGPFHEYRGSWARHALR* |
| Ga0134123_111686382 | 3300010403 | Terrestrial Soil | MWRDVVALTLAALLLGAAIIANVGDGPMREHRGSWVTHASKLSR* |
| Ga0105246_114325722 | 3300011119 | Miscanthus Rhizosphere | MWRDLVALTLAALLLGAAIVANVSDGPMRDHRGSWVTHASQ* |
| Ga0137364_100680354 | 3300012198 | Vadose Zone Soil | MSWGWRDLVVLTFLVLVFGAAMIANVSDGPMREHRGSWVTHGLR* |
| Ga0137383_105863711 | 3300012199 | Vadose Zone Soil | MRKREGSMAWNWRDLVVLTFLALVFGAAMIANVSDGPMHEHRG |
| Ga0150985_1048061411 | 3300012212 | Avena Fatua Rhizosphere | VALTLAALQLGAAIIANVGDGPMREHRGSWVTHASKLSR* |
| Ga0150985_1051779243 | 3300012212 | Avena Fatua Rhizosphere | MCRWRDLVVLTILILLLGAAMIANVSDGPMSEYRGSWVTRASRF* |
| Ga0150985_1134964232 | 3300012212 | Avena Fatua Rhizosphere | MSWRWRELVVLTFLILLLGAAMIVNVSDGPMSEYRGSWVTRASRF* |
| Ga0150984_1017144701 | 3300012469 | Avena Fatua Rhizosphere | MSATKTKGSVMWRELVGLSLMVVLLGAAIVANVTDGPMRDYRGSWLTHASK* |
| Ga0150984_1120456681 | 3300012469 | Avena Fatua Rhizosphere | MLRRLRDLLVLMFLVLLLGAAMIANVSDGPMPEYR |
| Ga0150984_1206700271 | 3300012469 | Avena Fatua Rhizosphere | MWRELVGLIFWVLLFGAALMANFTDGPMREHRGSWVARASQLSR* |
| Ga0137397_102584762 | 3300012685 | Vadose Zone Soil | MLSGWRALVVLTFLVLLIGAATIVNVSDGPMRQHRGSWVTYALR* |
| Ga0137410_116832921 | 3300012944 | Vadose Zone Soil | MLSGWRALVVLTFLVFLFGAAMIANVSDGPMRERRGSWVTHALR* |
| Ga0164300_100245724 | 3300012951 | Soil | MSWNWRDLVVLTFLVFLFGAAMLANVSDGPLHEHRGSWVTHGLAIAQWYTSL |
| Ga0164298_100302032 | 3300012955 | Soil | MSWNWRDLVVLTFLVFLFGAAMLANVSDGPLHEHRGSWVTHALR* |
| Ga0164298_101621812 | 3300012955 | Soil | MWRDLVALTVSVLLLGAAVMANLSGGPLPEHRGSWVTHASR* |
| Ga0164299_104354973 | 3300012958 | Soil | SWSWRDLVVLTFMVLLFGAAMMANVSDGPMQEYRGSWVARASR* |
| Ga0164299_114782861 | 3300012958 | Soil | MEFADLVALTFSALLLGAAIMANVSDGPMREHRGSWVTHALR* |
| Ga0164301_100467613 | 3300012960 | Soil | KREGSMSWNWRDLVVLTFLVFLFGAAMLANVSDGPLHEHRGSWVTHALR* |
| Ga0164309_110787972 | 3300012984 | Soil | MWRELVGLIFLVLLFGAALMANVTDGPMRDHRGAWVTQASK* |
| Ga0164308_103745042 | 3300012985 | Soil | MSWNWKNLVILTFLVFLFGAAMVANLSDGPLHEHRGSWARH |
| Ga0164305_100543771 | 3300012989 | Soil | EGSMSWGWRDLVVLTFLVPLFGAAMIANVSDGPMREHRGSWVTHALR* |
| Ga0164305_115218451 | 3300012989 | Soil | MSWGWRDLVVLTFLVLLFGAAMIANVSDGPMREHRGSWVTHALR* |
| Ga0157378_109916941 | 3300013297 | Miscanthus Rhizosphere | MSWNWRDLVVMAFFLLLFGAAMIANMVDGPMREHRGSWVTHALR* |
| Ga0157378_119253682 | 3300013297 | Miscanthus Rhizosphere | MSWNWRNLVVLTFLVFLFGAAIMANVSDGPFHEYRGSWARHALR* |
| Ga0163162_104838682 | 3300013306 | Switchgrass Rhizosphere | MWRELVGLIFWLLLFGAALMANVTDGPMREHRGSWVTHALQLSR* |
| Ga0163162_109283092 | 3300013306 | Switchgrass Rhizosphere | MKGRKGGMWRELVGLTFLGLLLGAAMIANVGDGAMREYRGAWVTH |
| Ga0163162_111413442 | 3300013306 | Switchgrass Rhizosphere | MWRELVGLIFLVLLFGAALMANVTDGPMRDHRGSWVTQVSK* |
| Ga0163162_112718684 | 3300013306 | Switchgrass Rhizosphere | MWRDWVALTVSVLLLGAAIIANVTDGPMREHRGAWVARASR* |
| Ga0163162_121672231 | 3300013306 | Switchgrass Rhizosphere | MWRELVGLIFLALLFGAALMANVTDGPMRDHRASWVTHASVGR* |
| Ga0157375_113160851 | 3300013308 | Miscanthus Rhizosphere | KKEGSMSWNWRDLVVMAFFVLLFGAAMIANMVDGPMREHRGSWVTHALR* |
| Ga0157375_136574061 | 3300013308 | Miscanthus Rhizosphere | MSRSWRDLVALTFFVLLFGAAMVANVSDGPLHEYRGSWVARASR* |
| Ga0163163_116841501 | 3300014325 | Switchgrass Rhizosphere | QTRLEKKEGSMSWNWRNLVVLTFLVFLFGAAMMANVSDGPFHEYRGSWARHALR* |
| Ga0157380_106482363 | 3300014326 | Switchgrass Rhizosphere | RDLFALTFFVLLFGAAMMANVSDVPMHEYRGSWVARASR* |
| Ga0157379_102092712 | 3300014968 | Switchgrass Rhizosphere | MSWRWRDLVVLTLLVLLLGAAMIANVSDGPMSEYRGSWVTRASRF* |
| Ga0157379_104599482 | 3300014968 | Switchgrass Rhizosphere | MSWSWRDLVVLTFMVLLFGAAMMANVSDGPMHEYRGSWVTRASR* |
| Ga0173483_100373095 | 3300015077 | Soil | ELVALGFLVLLLGAALMANVTDGPMPEQRGSWLTYASK* |
| Ga0132258_102030162 | 3300015371 | Arabidopsis Rhizosphere | MWRDLIALTFSVLLLGAAVMANLTKGPMPEHRGSWVTHASR* |
| Ga0132258_133509403 | 3300015371 | Arabidopsis Rhizosphere | MWRDLVALTFSVLLLGAAVMANLSGGPLPEHRGSWVTHA |
| Ga0132257_1035529571 | 3300015373 | Arabidopsis Rhizosphere | MWRELVGLIFLALLFGAALMANVNDGPMREYRGSWVTYASK* |
| Ga0132255_1009002462 | 3300015374 | Arabidopsis Rhizosphere | MSWSWRDLVVLTFMVLLFGAAMMANVSDGPMHEYRGAWVTRASR* |
| Ga0163161_106343282 | 3300017792 | Switchgrass Rhizosphere | MSWSWRDLVALTHFVLLFGATMIANVSDGPMHEYRGSWVTRASR |
| Ga0163161_115708441 | 3300017792 | Switchgrass Rhizosphere | MSWSWRDLVVVTFLVMLLGAAMVANVSDGPMHEYRGSWVARSSR |
| Ga0190270_113769552 | 3300018469 | Soil | MSWNWQDLVALTFSALLLGAAIIANVGDGPMRDHRGSWVTQASR |
| Ga0190274_113541991 | 3300018476 | Soil | RMLRRLRDLLVLMFLVLLLGAAMIANVSDGPMPEYRGS |
| Ga0190274_117331802 | 3300018476 | Soil | MSWKWQDLVVLTVSTLLLGAAMLATVSDGPMRDHRGWWVTRAL |
| Ga0190271_108863692 | 3300018481 | Soil | MWRDVVALTLGALLLGAAILANVTDGPMREHRGSWVTRASIGR |
| Ga0066669_101143314 | 3300018482 | Grasslands Soil | VVVTFLVLVFGAAMIANVSDGPMREHRGSWVTHVLR |
| Ga0066669_107419541 | 3300018482 | Grasslands Soil | MAWNWRDLVVLIFFVLLFGAAMMAHVSDGPLAEHRGTWVTHALR |
| Ga0210407_1000078014 | 3300020579 | Soil | MWRDLVALTVSVLLLGAAIIANVSDGPMREHRGAWVTRASR |
| Ga0210392_1000072020 | 3300021475 | Soil | MWRDLVALTVSVPLLGAAIIANVSDGPMREHRGAWVTRASR |
| Ga0210410_100849172 | 3300021479 | Soil | MSWNWRDLVELTFLVLLFGAAMIANVSDGPMREHRGSWVTHALR |
| Ga0207697_103855661 | 3300025315 | Corn, Switchgrass And Miscanthus Rhizosphere | MSWSWRDLVVLTFMVVLFGAAMMANVSDGPMHEYRGSWVARASR |
| Ga0207688_103165902 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | MSWSWRDLVALTFLVLLFGTAMMANMSDGPMHEYRGSWVSRASR |
| Ga0207647_103543932 | 3300025904 | Corn Rhizosphere | MSWSWRDLVALTLFVLLFGATMIANVSDGPMHEYRGSWVTRASR |
| Ga0207699_112124532 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MWRELIFWVLLFGAALMANVTGGPMREHRGSWVTHASQL |
| Ga0207663_116313801 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MAWNWRDLVVLTFLVFLFGAAMLANVSDGPLHEHRGSWVTHALR |
| Ga0207649_106432833 | 3300025920 | Corn Rhizosphere | MSWSWRDLVALTLFVLLFGATMIANVSDGPMHEYRGSWVT |
| Ga0207701_1001541415 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | MSWSWRDLFALTFFVLLFGAAMMANVSDGPMHEYRGSWVARASR |
| Ga0207701_101270714 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | MSWSWRDLVALTFFVLLFGAAMVANVSDGPLHEYRGSWVARASR |
| Ga0207706_101798131 | 3300025933 | Corn Rhizosphere | KRIMWWYVVTWSFSVLLLGAAILVNLGDGPMREHRGSWVTHASR |
| Ga0207686_109653342 | 3300025934 | Miscanthus Rhizosphere | MSWRWRDLVVLTLLVLLLGAAMIANVSDGPMSEYRGSWVTRAS |
| Ga0207670_111025881 | 3300025936 | Switchgrass Rhizosphere | MSWSWRDLFALTFFVLLFGAAMMANVSDGPMHEYRGSWVA |
| Ga0207669_106783851 | 3300025937 | Miscanthus Rhizosphere | MSWRWRDLVVLTLLVLLLGAAMIANVSDGPMSEYRGSWVTRALRF |
| Ga0207704_104783641 | 3300025938 | Miscanthus Rhizosphere | WRDLVALTLFVLLFGATMIANVSDGPMHEYRGSWVTRASR |
| Ga0207665_105335292 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MWREFVGLTFLGLLLGAAMIANVGDGAMREYRGAWVTHASK |
| Ga0207661_100604343 | 3300025944 | Corn Rhizosphere | MWRDLVALTFSVLLLGAAVMANLSGGPMPEHRSSWVTHASR |
| Ga0207651_110057922 | 3300025960 | Switchgrass Rhizosphere | MSRSWRDLVALTFFVLLFGAAMVANVSDGPLHEYRGSWVARASR |
| Ga0207668_117421132 | 3300025972 | Switchgrass Rhizosphere | WVALTVLVLLLGAAIIANVTDGPMREHRGAWVARASR |
| Ga0207640_108960212 | 3300025981 | Corn Rhizosphere | MSWSWRDLFALTFFVLLFGAAMMANVSDGPMHEYRGSWVAR |
| Ga0207639_109777841 | 3300026041 | Corn Rhizosphere | EKGGRMSWSWRDLFALTFFVLLFGAAMMANVSDGPMHEYRGSWVARASR |
| Ga0207648_102812491 | 3300026089 | Miscanthus Rhizosphere | MSWSWRDLVAVTVLLFGAAMMANVSDGPLHEYRGSWVARASR |
| Ga0207683_101734264 | 3300026121 | Miscanthus Rhizosphere | MSWSWRDLVALTHFVLLFGATMIANVSDGPMHEYRG |
| Ga0207683_121229163 | 3300026121 | Miscanthus Rhizosphere | ALTVSVLLLGAAIIANVTDGPMREHRGAWVARASR |
| Ga0268266_102351371 | 3300028379 | Switchgrass Rhizosphere | MWRDLVALTFSVLLLGAAVMANLSGGPLPEHRGSWVTHASR |
| Ga0307322_101214341 | 3300028710 | Soil | MSWSWRDLVVLTFSVLLFGAAMMANVSDGPMREYRGSWV |
| Ga0307503_104560852 | 3300028802 | Soil | GMWRNLVALTFSVLLLGAALMANVGEGPMSEYRGSWLTRASR |
| Ga0307503_106537162 | 3300028802 | Soil | MSWSWRDLFALTFFVLLFGAAMMANVSDGPMHEYRGSW |
| Ga0308189_100993822 | 3300031058 | Soil | MSWRWRELVVLTFLVLLLGAAMIANVSDGPMSEYRGSWVTRASRF |
| Ga0307468_1003852882 | 3300031740 | Hardwood Forest Soil | MEGSMSWNWRNLVVLTFLVFLFGAAMMANVSDGPFHEYRGSWARHALR |
| Ga0307471_1001666425 | 3300032180 | Hardwood Forest Soil | MWRELVALAFLVLLLGAALMANVTDGPMPEQRGSWLTYASK |
| Ga0307472_1012826371 | 3300032205 | Hardwood Forest Soil | MWRQLVGLIFWGLLFGAALMANVTDGPMRDHRGSWVTHA |
| ⦗Top⦘ |