


| Basic Information | |
|---|---|
| Family ID | F056098 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 138 |
| Average Sequence Length | 39 residues |
| Representative Sequence | IMYIQRRHWLDYDPVALAVLVIGIGMIELLALII |
| Number of Associated Samples | 113 |
| Number of Associated Scaffolds | 138 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 24.63 % |
| % of genes near scaffold ends (potentially truncated) | 71.74 % |
| % of genes from short scaffolds (< 2000 bps) | 90.58 % |
| Associated GOLD sequencing projects | 109 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.45 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (85.507 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (15.942 % of family members) |
| Environment Ontology (ENVO) | Unclassified (21.739 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (42.754 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 32.26% β-sheet: 0.00% Coil/Unstructured: 67.74% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.45 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 138 Family Scaffolds |
|---|---|---|
| PF00072 | Response_reg | 6.52 |
| PF11026 | DUF2721 | 2.17 |
| PF04392 | ABC_sub_bind | 2.17 |
| PF01925 | TauE | 1.45 |
| PF13545 | HTH_Crp_2 | 1.45 |
| PF12706 | Lactamase_B_2 | 1.45 |
| PF13505 | OMP_b-brl | 0.72 |
| PF00589 | Phage_integrase | 0.72 |
| PF01381 | HTH_3 | 0.72 |
| PF13561 | adh_short_C2 | 0.72 |
| PF09351 | DUF1993 | 0.72 |
| PF08734 | GYD | 0.72 |
| PF02371 | Transposase_20 | 0.72 |
| PF07045 | DUF1330 | 0.72 |
| PF07750 | GcrA | 0.72 |
| PF05598 | DUF772 | 0.72 |
| PF04430 | DUF498 | 0.72 |
| PF02839 | CBM_5_12 | 0.72 |
| COG ID | Name | Functional Category | % Frequency in 138 Family Scaffolds |
|---|---|---|---|
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 2.17 |
| COG0730 | Sulfite exporter TauE/SafE/YfcA and related permeases, UPF0721 family | Inorganic ion transport and metabolism [P] | 1.45 |
| COG1504 | Uncharacterized conserved protein, DUF498 domain | Function unknown [S] | 0.72 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.72 |
| COG3737 | Uncharacterized protein, contains Mth938-like domain | Function unknown [S] | 0.72 |
| COG4274 | Uncharacterized conserved protein, contains GYD domain | Function unknown [S] | 0.72 |
| COG5352 | Uncharacterized conserved protein | Function unknown [S] | 0.72 |
| COG5470 | Uncharacterized conserved protein, DUF1330 family | Function unknown [S] | 0.72 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 85.51 % |
| Unclassified | root | N/A | 14.49 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000156|NODE_c0568689 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1366 | Open in IMG/M |
| 3300000655|AF_2010_repII_A100DRAFT_1039286 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 859 | Open in IMG/M |
| 3300000655|AF_2010_repII_A100DRAFT_1070219 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 618 | Open in IMG/M |
| 3300000956|JGI10216J12902_105079792 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 978 | Open in IMG/M |
| 3300002910|JGI25615J43890_1049611 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 690 | Open in IMG/M |
| 3300004463|Ga0063356_102712738 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 762 | Open in IMG/M |
| 3300005174|Ga0066680_10152962 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1443 | Open in IMG/M |
| 3300005179|Ga0066684_10591967 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 744 | Open in IMG/M |
| 3300005332|Ga0066388_101079202 | All Organisms → cellular organisms → Bacteria | 1356 | Open in IMG/M |
| 3300005332|Ga0066388_102027873 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1032 | Open in IMG/M |
| 3300005437|Ga0070710_10094220 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1771 | Open in IMG/M |
| 3300005447|Ga0066689_10850363 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 565 | Open in IMG/M |
| 3300005467|Ga0070706_101599221 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 595 | Open in IMG/M |
| 3300005540|Ga0066697_10382224 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 818 | Open in IMG/M |
| 3300005543|Ga0070672_102082809 | Not Available | 511 | Open in IMG/M |
| 3300005559|Ga0066700_10667424 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 717 | Open in IMG/M |
| 3300005559|Ga0066700_11093640 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 521 | Open in IMG/M |
| 3300005587|Ga0066654_10665819 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 581 | Open in IMG/M |
| 3300005618|Ga0068864_101746599 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 627 | Open in IMG/M |
| 3300005713|Ga0066905_100243240 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1377 | Open in IMG/M |
| 3300005764|Ga0066903_100951632 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1562 | Open in IMG/M |
| 3300005764|Ga0066903_101292217 | Not Available | 1362 | Open in IMG/M |
| 3300005764|Ga0066903_102860109 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 936 | Open in IMG/M |
| 3300005764|Ga0066903_103667429 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 826 | Open in IMG/M |
| 3300005764|Ga0066903_105492796 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 668 | Open in IMG/M |
| 3300005764|Ga0066903_107184443 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 576 | Open in IMG/M |
| 3300005764|Ga0066903_107848428 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 548 | Open in IMG/M |
| 3300005843|Ga0068860_100054979 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Rhodovulum → unclassified Rhodovulum → Rhodovulum sp. PH10 | 3783 | Open in IMG/M |
| 3300006028|Ga0070717_10074789 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2832 | Open in IMG/M |
| 3300006032|Ga0066696_10932887 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 552 | Open in IMG/M |
| 3300006058|Ga0075432_10183985 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 819 | Open in IMG/M |
| 3300006163|Ga0070715_10567087 | Not Available | 660 | Open in IMG/M |
| 3300006175|Ga0070712_100218020 | All Organisms → cellular organisms → Bacteria | 1509 | Open in IMG/M |
| 3300006175|Ga0070712_100932515 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 749 | Open in IMG/M |
| 3300006794|Ga0066658_10545172 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 630 | Open in IMG/M |
| 3300006844|Ga0075428_102495043 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 530 | Open in IMG/M |
| 3300006880|Ga0075429_100347701 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae | 1298 | Open in IMG/M |
| 3300006969|Ga0075419_11464926 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 511 | Open in IMG/M |
| 3300007258|Ga0099793_10151932 | All Organisms → cellular organisms → Bacteria | 1097 | Open in IMG/M |
| 3300007258|Ga0099793_10655570 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 528 | Open in IMG/M |
| 3300009090|Ga0099827_10847572 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 791 | Open in IMG/M |
| 3300009137|Ga0066709_101519466 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 965 | Open in IMG/M |
| 3300009553|Ga0105249_13416673 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 511 | Open in IMG/M |
| 3300009792|Ga0126374_10041278 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2264 | Open in IMG/M |
| 3300010043|Ga0126380_10215700 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1298 | Open in IMG/M |
| 3300010043|Ga0126380_10924003 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 727 | Open in IMG/M |
| 3300010147|Ga0126319_1545921 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 558 | Open in IMG/M |
| 3300010360|Ga0126372_10007239 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 5590 | Open in IMG/M |
| 3300010360|Ga0126372_10637546 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1029 | Open in IMG/M |
| 3300010361|Ga0126378_11379031 | Not Available | 798 | Open in IMG/M |
| 3300010398|Ga0126383_10799165 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1026 | Open in IMG/M |
| 3300012201|Ga0137365_10670987 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 758 | Open in IMG/M |
| 3300012202|Ga0137363_10116082 | All Organisms → cellular organisms → Bacteria | 2058 | Open in IMG/M |
| 3300012204|Ga0137374_10914553 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 643 | Open in IMG/M |
| 3300012205|Ga0137362_10046591 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3513 | Open in IMG/M |
| 3300012209|Ga0137379_10206987 | All Organisms → cellular organisms → Bacteria | 1875 | Open in IMG/M |
| 3300012210|Ga0137378_11172245 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 684 | Open in IMG/M |
| 3300012210|Ga0137378_11827488 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 511 | Open in IMG/M |
| 3300012212|Ga0150985_106650954 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 519 | Open in IMG/M |
| 3300012212|Ga0150985_109019165 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 773 | Open in IMG/M |
| 3300012212|Ga0150985_114330268 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 571 | Open in IMG/M |
| 3300012212|Ga0150985_114950020 | Not Available | 640 | Open in IMG/M |
| 3300012212|Ga0150985_118715003 | Not Available | 573 | Open in IMG/M |
| 3300012212|Ga0150985_119878672 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Nitrobacter → Nitrobacter hamburgensis → Nitrobacter hamburgensis X14 | 765 | Open in IMG/M |
| 3300012285|Ga0137370_10681624 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 638 | Open in IMG/M |
| 3300012353|Ga0137367_11187052 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 511 | Open in IMG/M |
| 3300012358|Ga0137368_10686537 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 645 | Open in IMG/M |
| 3300012359|Ga0137385_10185088 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1823 | Open in IMG/M |
| 3300012362|Ga0137361_10551806 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1057 | Open in IMG/M |
| 3300012362|Ga0137361_11881241 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 515 | Open in IMG/M |
| 3300012371|Ga0134022_1112339 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 571 | Open in IMG/M |
| 3300012469|Ga0150984_108918861 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 792 | Open in IMG/M |
| 3300012469|Ga0150984_110526205 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1151 | Open in IMG/M |
| 3300012582|Ga0137358_10393731 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 937 | Open in IMG/M |
| 3300012922|Ga0137394_10159051 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1924 | Open in IMG/M |
| 3300012955|Ga0164298_10434386 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 859 | Open in IMG/M |
| 3300012957|Ga0164303_11415182 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 521 | Open in IMG/M |
| 3300012985|Ga0164308_10576983 | Not Available | 953 | Open in IMG/M |
| 3300012987|Ga0164307_10734547 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 777 | Open in IMG/M |
| 3300014325|Ga0163163_11634386 | All Organisms → cellular organisms → Bacteria | 705 | Open in IMG/M |
| 3300014968|Ga0157379_12213092 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 546 | Open in IMG/M |
| 3300015373|Ga0132257_101553031 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 846 | Open in IMG/M |
| 3300016319|Ga0182033_11317525 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 649 | Open in IMG/M |
| 3300016387|Ga0182040_10553341 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 926 | Open in IMG/M |
| 3300017792|Ga0163161_10338332 | All Organisms → cellular organisms → Bacteria | 1193 | Open in IMG/M |
| 3300017965|Ga0190266_11108492 | Not Available | 540 | Open in IMG/M |
| 3300018000|Ga0184604_10057136 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 1097 | Open in IMG/M |
| 3300018067|Ga0184611_1205543 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 700 | Open in IMG/M |
| 3300018469|Ga0190270_10673647 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1021 | Open in IMG/M |
| 3300018482|Ga0066669_11814243 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 564 | Open in IMG/M |
| 3300018482|Ga0066669_12184788 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 524 | Open in IMG/M |
| 3300020001|Ga0193731_1059270 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 1005 | Open in IMG/M |
| 3300020170|Ga0179594_10161392 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 832 | Open in IMG/M |
| 3300020579|Ga0210407_11418629 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 515 | Open in IMG/M |
| 3300021178|Ga0210408_10950944 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 667 | Open in IMG/M |
| 3300025910|Ga0207684_10144661 | Not Available | 2045 | Open in IMG/M |
| 3300025961|Ga0207712_10994665 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 744 | Open in IMG/M |
| 3300026324|Ga0209470_1064212 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1724 | Open in IMG/M |
| 3300026343|Ga0209159_1276101 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300026377|Ga0257171_1016209 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1244 | Open in IMG/M |
| 3300026528|Ga0209378_1067863 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1652 | Open in IMG/M |
| 3300027874|Ga0209465_10308701 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 792 | Open in IMG/M |
| 3300027882|Ga0209590_10706286 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 645 | Open in IMG/M |
| 3300028047|Ga0209526_10389520 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 927 | Open in IMG/M |
| 3300028721|Ga0307315_10078477 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 951 | Open in IMG/M |
| 3300028809|Ga0247824_10623710 | Not Available | 650 | Open in IMG/M |
| 3300028819|Ga0307296_10492117 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 671 | Open in IMG/M |
| 3300028878|Ga0307278_10294096 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 718 | Open in IMG/M |
| 3300028881|Ga0307277_10003696 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 5875 | Open in IMG/M |
| 3300029636|Ga0222749_10312864 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 815 | Open in IMG/M |
| 3300030829|Ga0308203_1033059 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 729 | Open in IMG/M |
| 3300031058|Ga0308189_10357240 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 590 | Open in IMG/M |
| 3300031091|Ga0308201_10161958 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 710 | Open in IMG/M |
| 3300031094|Ga0308199_1168189 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 534 | Open in IMG/M |
| 3300031446|Ga0170820_16204282 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 539 | Open in IMG/M |
| 3300031545|Ga0318541_10260315 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 964 | Open in IMG/M |
| 3300031573|Ga0310915_10044994 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2827 | Open in IMG/M |
| 3300031736|Ga0318501_10694756 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 561 | Open in IMG/M |
| 3300031777|Ga0318543_10349681 | Not Available | 662 | Open in IMG/M |
| 3300031796|Ga0318576_10047341 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1851 | Open in IMG/M |
| 3300031835|Ga0318517_10105929 | Not Available | 1237 | Open in IMG/M |
| 3300031835|Ga0318517_10426665 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 599 | Open in IMG/M |
| 3300031880|Ga0318544_10041574 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1635 | Open in IMG/M |
| 3300031890|Ga0306925_10632537 | Not Available | 1127 | Open in IMG/M |
| 3300031893|Ga0318536_10449212 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
| 3300031912|Ga0306921_10964287 | Not Available | 964 | Open in IMG/M |
| 3300031945|Ga0310913_10736559 | Not Available | 696 | Open in IMG/M |
| 3300031945|Ga0310913_11033089 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 575 | Open in IMG/M |
| 3300031946|Ga0310910_11453981 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 526 | Open in IMG/M |
| 3300031947|Ga0310909_11087071 | Not Available | 650 | Open in IMG/M |
| 3300031954|Ga0306926_10466494 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Parcubacteria group → Candidatus Kaiserbacteria → Candidatus Kaiserbacteria bacterium RIFCSPHIGHO2_02_FULL_55_25 | 1554 | Open in IMG/M |
| 3300031981|Ga0318531_10212277 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 872 | Open in IMG/M |
| 3300032065|Ga0318513_10073706 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Parcubacteria group → Candidatus Kaiserbacteria → Candidatus Kaiserbacteria bacterium RIFCSPHIGHO2_02_FULL_55_25 | 1566 | Open in IMG/M |
| 3300033290|Ga0318519_10856688 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 560 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 15.22% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 15.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 10.87% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 9.42% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 8.70% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.07% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.07% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 4.35% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.62% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.90% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.90% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.17% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.45% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.45% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.45% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 1.45% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.72% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.72% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.72% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.72% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.72% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.72% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.72% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.72% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.72% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.72% |
| Sugar Cane Bagasse Incubating Bioreactor | Engineered → Solid Waste → Grass → Composting → Bioreactor → Sugar Cane Bagasse Incubating Bioreactor | 0.72% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000156 | Sugar cane bagasse incubating bioreactor microbial communities from Sao Carlos, Brazil, that are aerobic and semianaerobic | Engineered | Open in IMG/M |
| 3300000655 | Forest soil microbial communities from Amazon forest - 2010 replicate II A100 | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002910 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006058 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Host-Associated | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
| 3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010147 | Soil microbial communities from California, USA to study soil gas exchange rates - BB-CA-RED metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012371 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_0_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300017965 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 T | Environmental | Open in IMG/M |
| 3300018000 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coex | Environmental | Open in IMG/M |
| 3300018067 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_coex | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020001 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a2 | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026324 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes) | Environmental | Open in IMG/M |
| 3300026343 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 (SPAdes) | Environmental | Open in IMG/M |
| 3300026377 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-B | Environmental | Open in IMG/M |
| 3300026528 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes) | Environmental | Open in IMG/M |
| 3300027680 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 80 (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028721 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_355 | Environmental | Open in IMG/M |
| 3300028809 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_PalmiticAcid_Day48 | Environmental | Open in IMG/M |
| 3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
| 3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
| 3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030829 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_357 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031058 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_184 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031091 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_355 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031094 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_203 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
| 3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
| 3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
| 3300031880 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031981 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25 | Environmental | Open in IMG/M |
| 3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| NODE_05686895 | 3300000156 | Sugar Cane Bagasse Incubating Bioreactor | RIMYIQRRHWLDYDPVAFTVLVLGIGVVELLALII* |
| AF_2010_repII_A100DRAFT_10392863 | 3300000655 | Forest Soil | ETSNRLTATMYVQRPHWLDYDPVALAVLVIGIGIIELLALII* |
| AF_2010_repII_A100DRAFT_10702191 | 3300000655 | Forest Soil | VQTTYVQKPHWLDYDPVALAVLVIGIGIIELLALII* |
| JGI10216J12902_1050797922 | 3300000956 | Soil | MTGRRVMYIQRRHWLDYDPVALAVLVIGIAIIELLALII* |
| JGI25615J43890_10496112 | 3300002910 | Grasslands Soil | MYIRTDVNRRTGWRIMYIQRRHWLDYDPVALAVLVIGIGMIELLALII* |
| Ga0063356_1027127382 | 3300004463 | Arabidopsis Thaliana Rhizosphere | NRRTGWRIMYIQRRHWLDYDSVALAVLVIGIGVIELLAWGI* |
| Ga0066680_101529623 | 3300005174 | Soil | VNRRTGWRIMYIQRRHWLDYDPVALAVLVIGIGMIELLAMII* |
| Ga0066684_105919671 | 3300005179 | Soil | RTGWRIMYIQRRHWLDYDPVALAVLVIGIGMIELLALII* |
| Ga0066388_1010792021 | 3300005332 | Tropical Forest Soil | TGNRSRATMYVQKPHWLDYDPVALAVLVIGIGIIELLALII* |
| Ga0066388_1020278731 | 3300005332 | Tropical Forest Soil | ATTYVQTMHVQKPHWLDYDPVALAVLVIGIGIIELLALII* |
| Ga0070710_100942203 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | VNRRTGWRIMYIQRWHWLDYDPVALAVLAIGIGMIEVLALII* |
| Ga0066689_108503632 | 3300005447 | Soil | VNRRTGWRIMYIQRRHWLDYDSVALAVLVIGIGVIELLAWGI* |
| Ga0070706_1015992211 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | RTGWRIMYIQRRHWLDYDPVAFAVLVLGIGMVELLALII* |
| Ga0066697_103822241 | 3300005540 | Soil | RIMYIQRRHWLDYDPVALAALVIGIGIIELLALII* |
| Ga0070672_1020828091 | 3300005543 | Miscanthus Rhizosphere | DSFKGRFQVMHTQRQHWLDYDPVALAVLVIGMIGLLALTI* |
| Ga0066700_106674242 | 3300005559 | Soil | VNRRTGQRIMYIQRRHWLDYDPVALAALVIGIGIIELLALII* |
| Ga0066700_110936402 | 3300005559 | Soil | VNRRTGWRIMYIQRRHWLDYDPVALAVLVIGIGVIELLAWGI* |
| Ga0066654_106658192 | 3300005587 | Soil | NRRTGWRIMYIQRRHWLDYDPVALAVLVIGIGMIELLALII* |
| Ga0068864_1017465991 | 3300005618 | Switchgrass Rhizosphere | MHILRRHWLDYDPVALAVLVIGIGMIELLAWGIW* |
| Ga0066905_1002432402 | 3300005713 | Tropical Forest Soil | VTHDLVGHVNRRTGRRIVYIQRRHWLDYDPVALAVLAIGIGMVELLALIL* |
| Ga0066903_1009516323 | 3300005764 | Tropical Forest Soil | MYAQGPHWLDYDPIALAVLVIGIASFELLALMMI* |
| Ga0066903_1012922173 | 3300005764 | Tropical Forest Soil | MDHPQKRYLLDYDPVAFAVLVIGIGMVELLALSW* |
| Ga0066903_1028601092 | 3300005764 | Tropical Forest Soil | MMSRVRVTRRTGWRIMYIERRHWLDYDPVAFTVLVLGIGMVELLALII* |
| Ga0066903_1036674291 | 3300005764 | Tropical Forest Soil | HVNRRTGWCIMYIQRPHWLDYDPVALAVLVIGIGIIELLALII* |
| Ga0066903_1054927962 | 3300005764 | Tropical Forest Soil | MGNRLTATMYAQRPHWLDYDPVALAVLVIGIGIIELLALII* |
| Ga0066903_1071844432 | 3300005764 | Tropical Forest Soil | MYAQTMHVQKPHWLDYDPVAPAVLVIGIGIIELLALII* |
| Ga0066903_1078484281 | 3300005764 | Tropical Forest Soil | VMYIQRRHWLDYDPVALAVLVIGIGIIELLALII* |
| Ga0068860_1000549796 | 3300005843 | Switchgrass Rhizosphere | MHLLRRHWLDYDPVALAVLVIGIGMIELLAWGIW* |
| Ga0070717_100747899 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MYAQTMHVQKPHWLDYDPVALAVLVIGIGIIELLALII* |
| Ga0066696_109328871 | 3300006032 | Soil | IRMNLQKRYWLDYDPVALAVLVVGIGMIELLAFNI* |
| Ga0075432_101839852 | 3300006058 | Populus Rhizosphere | MHILRRHWLDYDPVALAVLVIGIGMIELLAWGFW* |
| Ga0070715_105670874 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | RIMYIQRWHWLDYDPVALAVLAIGIGMIELLALII* |
| Ga0070712_1002180203 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MHILRRHWLDYDPVALAVLVIGIGMIELLAWSIW* |
| Ga0070712_1009325151 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | DDVNRRTGWRIMYIQRWHWLDYDPVALAVLAIGIGMIEVLALII* |
| Ga0066658_105451722 | 3300006794 | Soil | PTHVNRRTGKRIMYIQRRHWLDYDPVALAALVIGIGIIELLALII* |
| Ga0075428_1024950432 | 3300006844 | Populus Rhizosphere | VNRRTGWRIMYMQRWHWLDYDPVALAVLAIGIGMIELLALII* |
| Ga0075429_1003477014 | 3300006880 | Populus Rhizosphere | RFQVMHTQKQHWLDYDPVALAVLVIGMIGLLALTI* |
| Ga0075419_114649262 | 3300006969 | Populus Rhizosphere | MYILQRRHWLDYDPVALAVLVIGIGIIELLALII* |
| Ga0099793_101519324 | 3300007258 | Vadose Zone Soil | HDLSRTDVNRRTGWRIMYIQRRHWLDYDPVAFAVLVLGIGMVELLALII* |
| Ga0099793_106555701 | 3300007258 | Vadose Zone Soil | MHTQRRHWLDYDPVALAVLVIGIGTIELLAWGIW* |
| Ga0099827_108475721 | 3300009090 | Vadose Zone Soil | IMYIQRRHWLDYDPVALAVLVIGIGIIELLALII* |
| Ga0066709_1015194663 | 3300009137 | Grasslands Soil | MYAQTMHVQKPHWLDYNPVAPAVLVIRIGIIELLALII* |
| Ga0105249_134166731 | 3300009553 | Switchgrass Rhizosphere | IMYIQRRHWLDYDPVALAVLVIGIGMIELLALII* |
| Ga0126374_100412784 | 3300009792 | Tropical Forest Soil | RRTGWRIMYIQRRHWLDYDPVAFAAVVVGFAMIELLAFII* |
| Ga0126380_102157001 | 3300010043 | Tropical Forest Soil | MMYIQRRHWLDYDPVAFAAVVVGFAMIELLAFII* |
| Ga0126380_109240032 | 3300010043 | Tropical Forest Soil | TMYLQRPHWLDYDPVALAVLVIGIGIIELLALII* |
| Ga0126319_15459211 | 3300010147 | Soil | VMHLLRRHWLDYDPVALAVLVIGIGMIELLAWGIW* |
| Ga0126372_100072399 | 3300010360 | Tropical Forest Soil | MMYIQRRHWFDYDPVAFAAVVVGFAMIELLAFII* |
| Ga0126372_106375462 | 3300010360 | Tropical Forest Soil | WRATMYVQTMDVQKPHWLDYDPVALAVLVIGIGIIELLALII* |
| Ga0126378_113790311 | 3300010361 | Tropical Forest Soil | RATMYVQKPHWLDYDPVALAVLVIGIGIIELLALII* |
| Ga0126383_107991651 | 3300010398 | Tropical Forest Soil | TTYVQKPHWLDYDPVALAVLVIGIGIIELLALII* |
| Ga0137389_116269161 | 3300012096 | Vadose Zone Soil | MKSNRVGDIMLKQSRYWLDYDPVALVVLVIGIGAIELLALSI* |
| Ga0137365_106709873 | 3300012201 | Vadose Zone Soil | GRQHDLGPTHVNRRTGKRIMYIPRRHWLDYDPVALAALVIGIGIIELLALII* |
| Ga0137363_101160821 | 3300012202 | Vadose Zone Soil | LGRTDVNRRTGWRIMYIQRRHWLDYDPIALAVLVLGIGMIELLAMII* |
| Ga0137374_109145531 | 3300012204 | Vadose Zone Soil | MHTLRRHWLDYDPVALAVLVIGIGMIELLAWGIW* |
| Ga0137362_100465914 | 3300012205 | Vadose Zone Soil | MHAQRRHWLEYDPVALAVLVIGIGMIELLAWGIW* |
| Ga0137379_102069871 | 3300012209 | Vadose Zone Soil | MHAQGRHWLDYDPVALAVLVIGIGMIELLAWGIW* |
| Ga0137378_111722452 | 3300012210 | Vadose Zone Soil | VNRRTGWRIMYIQRRHWLDYDPVALAVLVIGIGIIELLALII* |
| Ga0137378_118274882 | 3300012210 | Vadose Zone Soil | RRTGWRIMYIQRRHWLDYDPVALAVLVIGIGMIELLALII* |
| Ga0150985_1066509541 | 3300012212 | Avena Fatua Rhizosphere | MHLLRRHWLDYDPVALAALVIGIGMIELLAWGIW* |
| Ga0150985_1090191652 | 3300012212 | Avena Fatua Rhizosphere | MHIQSRHWLDYDPVALAVLVIGIGMIELLAWGIW* |
| Ga0150985_1143302681 | 3300012212 | Avena Fatua Rhizosphere | TGRRVMHIQSRHWLDYDPVALAVLVIGIGMIELLAWGIW* |
| Ga0150985_1149500202 | 3300012212 | Avena Fatua Rhizosphere | FRSVMHTQRQHWLDYDPVALAVLVIGMIGLLALTI* |
| Ga0150985_1187150031 | 3300012212 | Avena Fatua Rhizosphere | RFQVMHTQRQHWLDYDPVALAVLVIGMIGLLALTI* |
| Ga0150985_1198786724 | 3300012212 | Avena Fatua Rhizosphere | EGFQIMHTQRQHWLDYDPVALAVLVIGMIGLLALTI* |
| Ga0137370_106816241 | 3300012285 | Vadose Zone Soil | NREGIRMNLQKRYWLDYDPVALAVLVVGIGMIELLAFNI* |
| Ga0137367_111870521 | 3300012353 | Vadose Zone Soil | NRRTGWRIMYIQRRHWLDYDPVALAVLVIGIGIIELLALII* |
| Ga0137368_106865371 | 3300012358 | Vadose Zone Soil | WRIMYIQRRHWLDYDPVAFAALVLGIGMVELLALII* |
| Ga0137385_101850881 | 3300012359 | Vadose Zone Soil | THDLGRTDVNRRTGWRIMYIQRRHWLDYDPVALAVLVIGIGMIELLALII* |
| Ga0137361_105518061 | 3300012362 | Vadose Zone Soil | DLGRTDVNRRTGQRIMYIQRRHWLDYDPVALAVPVIGIGIIELLALII* |
| Ga0137361_118812411 | 3300012362 | Vadose Zone Soil | HDLGRTDVNRRTGWRIMYIQRRHWLDYDPVALAVLVIGIGIIELLALII* |
| Ga0134022_11123391 | 3300012371 | Grasslands Soil | RTGWRIMYIQRRHWLDYDPVALAALVIGIGIIELLALII* |
| Ga0150984_1089188611 | 3300012469 | Avena Fatua Rhizosphere | TGRRVMHLLRRHWLDYDPVALAVLVIGIGMIELLAWGIW* |
| Ga0150984_1105262051 | 3300012469 | Avena Fatua Rhizosphere | RFHVMHTQRQHWLDYDPVALAVLVIGMIGLLALTI* |
| Ga0137358_103937311 | 3300012582 | Vadose Zone Soil | ATIYVQRPHWLDYDPLALAVLVIGIGIIELLALII* |
| Ga0137394_101590511 | 3300012922 | Vadose Zone Soil | MHAQRRHWLEYDPVALAVLVIGIGTIELLAWGIW* |
| Ga0164298_104343862 | 3300012955 | Soil | ETLNRASVYEQKPHWLDYDPLALAVLVIGIGIIELLALII* |
| Ga0164303_114151822 | 3300012957 | Soil | IMYMQRRHWLDYDPVALAVLVIGIGMIELLALII* |
| Ga0164308_105769832 | 3300012985 | Soil | VCYKGLVEGRFQVMHTQRQHWLDYDPVALAVLVIGMIGLLVLTI* |
| Ga0164307_107345471 | 3300012987 | Soil | TWFGQVNRRTGWRIMYIQRRHWLDYDPVALAVLVIGIGMIELLALII* |
| Ga0163163_116343862 | 3300014325 | Switchgrass Rhizosphere | MHIQSRHWLDYDPVALAVLLIGIGMIELLAWGIW* |
| Ga0157379_122130921 | 3300014968 | Switchgrass Rhizosphere | MHLLRRHWLDYDPVALAILVIGMGMIELLAWGIW* |
| Ga0132257_1015530311 | 3300015373 | Arabidopsis Rhizosphere | RTGWRIMYIRRRHWLDYDPVALAVLVIGIGMIELFALII* |
| Ga0182033_113175252 | 3300016319 | Soil | RLMYIQRRHWLEYDPVALAVLVIGIGIIELLALII |
| Ga0182040_105533412 | 3300016387 | Soil | MYAQTMHVQKSHWLDYDPVALAVLVIGIGIIELLALII |
| Ga0163161_103383321 | 3300017792 | Switchgrass Rhizosphere | RQNLGLPRRHWLDYDPVALAVLVIGIATIELLALMI |
| Ga0190266_111084921 | 3300017965 | Soil | MRGTVEGSFLIMHTQRQHWLDYDPVALAVLVIGMVGLLALTI |
| Ga0184604_100571361 | 3300018000 | Groundwater Sediment | AGTGRRVMHLLRRHWLDYDPVALAVLVIGIGMIELLAWGIW |
| Ga0184611_12055431 | 3300018067 | Groundwater Sediment | SKTGWRIMYIQRRHWLDYDPVALAVLVIGIGMIELLALII |
| Ga0190270_106736471 | 3300018469 | Soil | TGWCIMYIQKRHWLDYDPVAFAALVIGIGMIELLALII |
| Ga0066669_118142431 | 3300018482 | Grasslands Soil | NRRTGWRIMYIQRRHWLDYDPVALAVLVIGIGMIELLALII |
| Ga0066669_121847881 | 3300018482 | Grasslands Soil | RRTGWRIMYIQGRHWLDYDPVALAVLVIGIGMVELLASII |
| Ga0137408_13202022 | 3300019789 | Vadose Zone Soil | MAVMRILNRHWLDYDLVALAVLLIGIGIIELLALSI |
| Ga0193731_10592703 | 3300020001 | Soil | GRRVMHILRRHWLDYDPVALAVLVIGIGMIELLAWGIW |
| Ga0179594_101613923 | 3300020170 | Vadose Zone Soil | TEEQGRRIMYIQRRHWLDYDPVALAVLVMGIGIIELLALII |
| Ga0210407_114186291 | 3300020579 | Soil | RIMYIQRRHWLDYDPVALAVLVIGIGMIELLASII |
| Ga0210408_109509442 | 3300021178 | Soil | RTGQRIMYIQRRHWLDYDPVALAVLVIGIGMIELLALII |
| Ga0207684_101446615 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MYAQTMHVQKPHWLDYDPVALAVLVIGIGIIELLALII |
| Ga0207712_109946651 | 3300025961 | Switchgrass Rhizosphere | HDLGRTDVNRRTGWRIMYIQRRHWLDYDPVALAVLVIGIGMIELLASII |
| Ga0209470_10642123 | 3300026324 | Soil | RTGWRIMYIQRRHWLDYDPVALAVLVIGIGMIELLALII |
| Ga0209159_12761012 | 3300026343 | Soil | HVNRRTGKRIMYIQRRHWLDYDPVALAALVIGIGIIELLALII |
| Ga0257171_10162091 | 3300026377 | Soil | WRIMYIQRRHWLDYDPVALAVLVIGIGMIELLALII |
| Ga0209378_10678631 | 3300026528 | Soil | TDVNRRTGWRIMYIQRRHWLDYDSVALAVLVIGIGVIELLAWGI |
| Ga0207826_11895961 | 3300027680 | Tropical Forest Soil | QRLNQQNKGDVMRKQSRYWLDYDPVALVVLLVGIGMVELLALSI |
| Ga0209465_103087011 | 3300027874 | Tropical Forest Soil | VRVTRRTGWRIMYIERRHWLDYDPVAFTVLVLGIGMVELLALII |
| Ga0209590_107062861 | 3300027882 | Vadose Zone Soil | WGAGHIMYIQRRHWLDYDPVALAVLVIGIGMIELLALII |
| Ga0209526_103895201 | 3300028047 | Forest Soil | MGGMDIMRRHWLDYDPVALAVLIIGMGIVELLALII |
| Ga0307315_100784771 | 3300028721 | Soil | GRFHVMHTQRQHWLDYDPVALAVLVIGMVGLLALTI |
| Ga0247824_106237101 | 3300028809 | Soil | YKGLVEGRFQVMHTQRQHWLDYDPVALAVLVIGMIGLLVLTI |
| Ga0307296_104921172 | 3300028819 | Soil | GRRVMHLLRRHWLDYDPLALAVLVIGIGMIELLAWGIW |
| Ga0307278_102940962 | 3300028878 | Soil | VMHTQRRHWLDYDPVALAVLVIGIGTIELLAWGIW |
| Ga0307277_1000369611 | 3300028881 | Soil | TVNRATTYVQKPHWLDYDPLALAVLVIGIGIVELLALII |
| Ga0222749_103128642 | 3300029636 | Soil | DVNRRTGWRIMYIQRWHWLDYDPVALAVLAIGIGMIELLALII |
| Ga0308203_10330592 | 3300030829 | Soil | VNRRTGWRIMYIQRWHWLDYDPVALAVLVIGIGMIELLASII |
| Ga0308189_103572401 | 3300031058 | Soil | RTGWRIMYIQRWHWLDYDPVAFAVLVIGIGMIELLASII |
| Ga0308201_101619582 | 3300031091 | Soil | PEAGTGRRVMHLLRRHWLDYDPVALAVLVIGIGMIELLAWGIW |
| Ga0308199_11681892 | 3300031094 | Soil | RIMYIKSRHWLDYDPVALAVLVIGIGVIELVALII |
| Ga0170820_162042821 | 3300031446 | Forest Soil | GWRIMYIQRRHWLDYDPVAFAVLVLGIGMVELLALII |
| Ga0318541_102603152 | 3300031545 | Soil | MYAQTMHVQKPHWLDYDPVAPAVLVIGIGIIELLALII |
| Ga0310915_100449941 | 3300031573 | Soil | NRWRATMYVQTTYVQKPHWLDYDPVALAVLVIGIGIIELLALII |
| Ga0318501_106947561 | 3300031736 | Soil | VQTTYVQKPHWLDYDPVALAVLVIGIGIIELLALII |
| Ga0318543_103496811 | 3300031777 | Soil | DKGDVMRKYWQWLDYDPVALIVLLVGIGIVELLALSI |
| Ga0318576_100473411 | 3300031796 | Soil | VQTMHVQKPHWLDYDPVALAVLVIGIGIIELLALII |
| Ga0318517_101059294 | 3300031835 | Soil | GSVMNLRKRYWLDYDPVALVVLMIGIGMIELIAFSM |
| Ga0318517_104266652 | 3300031835 | Soil | RVRLMYIQRRHWLEYDPVALAVLVIGIGIIELLALII |
| Ga0318544_100415745 | 3300031880 | Soil | RAMMNVQWPHWLDYDPVALAVLVIGIGIIELLALII |
| Ga0306925_106325372 | 3300031890 | Soil | ATMYVQTTYVQKPHWLDYDPVALAVLVIGIGIIELLALII |
| Ga0318536_104492122 | 3300031893 | Soil | YVQTMHVQKPHWLDYDPVALAVLVIGIGIIELLALII |
| Ga0306921_109642871 | 3300031912 | Soil | RWRATMYVQTTYVQKPHWLDYDPVALAVLVIGIGIIELLALII |
| Ga0310913_107365592 | 3300031945 | Soil | VRLMYIQRRHWLEYDPVALAVLVIGIGIIELLALII |
| Ga0310913_110330891 | 3300031945 | Soil | GWRATMYVQTTYVQKPHWLDYDPVALAVLVIGIGIIELLALII |
| Ga0310910_114539812 | 3300031946 | Soil | NRWRATMYVQTMHVQKPHWLDYDPVALAVLVIGIGIIELLALII |
| Ga0310909_106249691 | 3300031947 | Soil | LNMVDIMHRHWLDYDLVALVVLIIGMGLVELLALSI |
| Ga0310909_110870711 | 3300031947 | Soil | GDVMRKYWQWLDYDPVALIVLLVGIGIVELLALSI |
| Ga0306926_104664941 | 3300031954 | Soil | MYVQTMHVQKPHWLDYDPVALAVLVIGIGIIELLALII |
| Ga0318531_102122772 | 3300031981 | Soil | WRSTMYVQTMHVQKPHWLDYDPVALAVLVIGIGIIELLALII |
| Ga0318513_100737063 | 3300032065 | Soil | NRWRAMMSVQTMHVQKPHWLDYDPVALAVLVIGIGIIELLALII |
| Ga0318519_108566881 | 3300033290 | Soil | TGNRWRATMYAQTMHVQKPHWLDYDPVAPAVLVIGIGIIELLALII |
| ⦗Top⦘ |