


| Basic Information | |
|---|---|
| Family ID | F056087 |
| Family Type | Metagenome |
| Number of Sequences | 138 |
| Average Sequence Length | 42 residues |
| Representative Sequence | ANLEQELLAAARGPKIEVSIAEIRKKGLITALRERVRTR |
| Number of Associated Samples | 120 |
| Number of Associated Scaffolds | 138 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 11.03 % |
| % of genes near scaffold ends (potentially truncated) | 85.51 % |
| % of genes from short scaffolds (< 2000 bps) | 83.33 % |
| Associated GOLD sequencing projects | 110 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.54 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (90.580 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil (10.870 % of family members) |
| Environment Ontology (ENVO) | Unclassified (37.681 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (47.826 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 41.79% β-sheet: 0.00% Coil/Unstructured: 58.21% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.54 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 138 Family Scaffolds |
|---|---|---|
| PF05016 | ParE_toxin | 34.06 |
| PF00069 | Pkinase | 3.62 |
| PF04255 | DUF433 | 2.17 |
| PF01329 | Pterin_4a | 2.17 |
| PF03781 | FGE-sulfatase | 2.17 |
| PF02661 | Fic | 2.17 |
| PF01174 | SNO | 2.17 |
| PF01695 | IstB_IS21 | 2.17 |
| PF05977 | MFS_3 | 1.45 |
| PF15919 | HicB_lk_antitox | 1.45 |
| PF01326 | PPDK_N | 1.45 |
| PF07690 | MFS_1 | 1.45 |
| PF01624 | MutS_I | 1.45 |
| PF04365 | BrnT_toxin | 0.72 |
| PF02812 | ELFV_dehydrog_N | 0.72 |
| PF00873 | ACR_tran | 0.72 |
| PF02922 | CBM_48 | 0.72 |
| PF13354 | Beta-lactamase2 | 0.72 |
| PF14559 | TPR_19 | 0.72 |
| PF14903 | WG_beta_rep | 0.72 |
| PF00208 | ELFV_dehydrog | 0.72 |
| PF00589 | Phage_integrase | 0.72 |
| PF01850 | PIN | 0.72 |
| PF01467 | CTP_transf_like | 0.72 |
| PF02683 | DsbD | 0.72 |
| PF12852 | Cupin_6 | 0.72 |
| PF13175 | AAA_15 | 0.72 |
| PF01712 | dNK | 0.72 |
| PF02517 | Rce1-like | 0.72 |
| PF09899 | DUF2126 | 0.72 |
| PF04014 | MazE_antitoxin | 0.72 |
| PF07927 | HicA_toxin | 0.72 |
| PF03725 | RNase_PH_C | 0.72 |
| PF03683 | UPF0175 | 0.72 |
| PF05154 | TM2 | 0.72 |
| PF00312 | Ribosomal_S15 | 0.72 |
| COG ID | Name | Functional Category | % Frequency in 138 Family Scaffolds |
|---|---|---|---|
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 14.49 |
| COG0118 | Imidazoleglycerol phosphate synthase glutamine amidotransferase subunit HisH | Amino acid transport and metabolism [E] | 2.17 |
| COG0311 | Pyridoxal 5'-phosphate synthase subunit PdxT (glutamine amidotransferase) | Coenzyme transport and metabolism [H] | 2.17 |
| COG1262 | Formylglycine-generating enzyme, required for sulfatase activity, contains SUMF1/FGE domain | Posttranslational modification, protein turnover, chaperones [O] | 2.17 |
| COG1484 | DNA replication protein DnaC | Replication, recombination and repair [L] | 2.17 |
| COG2154 | Pterin-4a-carbinolamine dehydratase | Coenzyme transport and metabolism [H] | 2.17 |
| COG2442 | Predicted antitoxin component of a toxin-antitoxin system, DUF433 family | Defense mechanisms [V] | 2.17 |
| COG0249 | DNA mismatch repair ATPase MutS | Replication, recombination and repair [L] | 1.45 |
| COG0334 | Glutamate dehydrogenase/leucine dehydrogenase | Amino acid transport and metabolism [E] | 1.45 |
| COG0574 | Phosphoenolpyruvate synthase/pyruvate phosphate dikinase | Carbohydrate transport and metabolism [G] | 1.45 |
| COG2814 | Predicted arabinose efflux permease AraJ, MFS family | Carbohydrate transport and metabolism [G] | 1.45 |
| COG0184 | Ribosomal protein S15P/S13E | Translation, ribosomal structure and biogenesis [J] | 0.72 |
| COG0689 | Ribonuclease PH | Translation, ribosomal structure and biogenesis [J] | 0.72 |
| COG1185 | Polyribonucleotide nucleotidyltransferase (polynucleotide phosphorylase) | Translation, ribosomal structure and biogenesis [J] | 0.72 |
| COG1266 | Membrane protease YdiL, CAAX protease family | Posttranslational modification, protein turnover, chaperones [O] | 0.72 |
| COG1428 | Deoxyadenosine/deoxycytidine kinase | Nucleotide transport and metabolism [F] | 0.72 |
| COG1724 | Predicted RNA binding protein YcfA, dsRBD-like fold, HicA-like mRNA interferase family | General function prediction only [R] | 0.72 |
| COG2123 | Exosome complex RNA-binding protein Rrp42, RNase PH superfamily | Intracellular trafficking, secretion, and vesicular transport [U] | 0.72 |
| COG2314 | Uncharacterized membrane protein YozV, TM2 domain, contains pTyr | General function prediction only [R] | 0.72 |
| COG2886 | Predicted antitoxin, contains HTH domain | General function prediction only [R] | 0.72 |
| COG2902 | NAD-specific glutamate dehydrogenase | Amino acid transport and metabolism [E] | 0.72 |
| COG2929 | Ribonuclease BrnT, toxin component of the BrnT-BrnA toxin-antitoxin system | Defense mechanisms [V] | 0.72 |
| COG4449 | Predicted protease, Abi (CAAX) family | General function prediction only [R] | 0.72 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 90.58 % |
| Unclassified | root | N/A | 9.42 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300004091|Ga0062387_100149854 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1341 | Open in IMG/M |
| 3300004092|Ga0062389_100545873 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1315 | Open in IMG/M |
| 3300005437|Ga0070710_11416916 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 520 | Open in IMG/M |
| 3300005468|Ga0070707_101066125 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 774 | Open in IMG/M |
| 3300005541|Ga0070733_10492330 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 820 | Open in IMG/M |
| 3300005554|Ga0066661_10512528 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 723 | Open in IMG/M |
| 3300005560|Ga0066670_10505536 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 742 | Open in IMG/M |
| 3300005569|Ga0066705_10124601 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1558 | Open in IMG/M |
| 3300005569|Ga0066705_10742317 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 589 | Open in IMG/M |
| 3300005904|Ga0075280_10064400 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 717 | Open in IMG/M |
| 3300006102|Ga0075015_100281295 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 910 | Open in IMG/M |
| 3300006163|Ga0070715_10948644 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300006173|Ga0070716_101215559 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 606 | Open in IMG/M |
| 3300006174|Ga0075014_100685457 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 594 | Open in IMG/M |
| 3300006176|Ga0070765_100483150 | Not Available | 1163 | Open in IMG/M |
| 3300006176|Ga0070765_100800733 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 890 | Open in IMG/M |
| 3300006794|Ga0066658_10012439 | All Organisms → cellular organisms → Bacteria | 3172 | Open in IMG/M |
| 3300006800|Ga0066660_10453414 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1072 | Open in IMG/M |
| 3300006893|Ga0073928_11187021 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 514 | Open in IMG/M |
| 3300007076|Ga0075435_100168424 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1848 | Open in IMG/M |
| 3300009029|Ga0066793_10174477 | All Organisms → cellular organisms → Bacteria | 1253 | Open in IMG/M |
| 3300009038|Ga0099829_11008550 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 690 | Open in IMG/M |
| 3300009088|Ga0099830_11378812 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 586 | Open in IMG/M |
| 3300009090|Ga0099827_11542701 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 578 | Open in IMG/M |
| 3300009521|Ga0116222_1127483 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1096 | Open in IMG/M |
| 3300009523|Ga0116221_1037165 | All Organisms → cellular organisms → Bacteria | 2353 | Open in IMG/M |
| 3300009523|Ga0116221_1424138 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans | 580 | Open in IMG/M |
| 3300009524|Ga0116225_1416182 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 597 | Open in IMG/M |
| 3300009548|Ga0116107_1003121 | All Organisms → cellular organisms → Bacteria | 8320 | Open in IMG/M |
| 3300009548|Ga0116107_1005105 | All Organisms → cellular organisms → Bacteria | 6102 | Open in IMG/M |
| 3300009616|Ga0116111_1019473 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2417 | Open in IMG/M |
| 3300009618|Ga0116127_1094162 | Not Available | 794 | Open in IMG/M |
| 3300009636|Ga0116112_1120640 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 735 | Open in IMG/M |
| 3300009639|Ga0116122_1004623 | All Organisms → cellular organisms → Bacteria | 5829 | Open in IMG/M |
| 3300009665|Ga0116135_1100582 | All Organisms → cellular organisms → Bacteria | 1046 | Open in IMG/M |
| 3300009698|Ga0116216_10289475 | All Organisms → cellular organisms → Bacteria | 999 | Open in IMG/M |
| 3300009698|Ga0116216_10564972 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 686 | Open in IMG/M |
| 3300009700|Ga0116217_10758392 | Not Available | 599 | Open in IMG/M |
| 3300009759|Ga0116101_1206885 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 503 | Open in IMG/M |
| 3300009824|Ga0116219_10332681 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 853 | Open in IMG/M |
| 3300010343|Ga0074044_10483901 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 809 | Open in IMG/M |
| 3300010379|Ga0136449_100299361 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2935 | Open in IMG/M |
| 3300010379|Ga0136449_102305559 | Not Available | 780 | Open in IMG/M |
| 3300010379|Ga0136449_103476834 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 601 | Open in IMG/M |
| 3300011120|Ga0150983_12223215 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 591 | Open in IMG/M |
| 3300011120|Ga0150983_15676552 | Not Available | 514 | Open in IMG/M |
| 3300011269|Ga0137392_11564231 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300012096|Ga0137389_11468154 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 578 | Open in IMG/M |
| 3300012189|Ga0137388_10097542 | All Organisms → cellular organisms → Bacteria | 2518 | Open in IMG/M |
| 3300012198|Ga0137364_10683777 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 774 | Open in IMG/M |
| 3300012206|Ga0137380_10972900 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 726 | Open in IMG/M |
| 3300012210|Ga0137378_10287209 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1530 | Open in IMG/M |
| 3300012210|Ga0137378_11068744 | Not Available | 721 | Open in IMG/M |
| 3300012353|Ga0137367_10856999 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
| 3300012356|Ga0137371_10827770 | All Organisms → cellular organisms → Bacteria | 705 | Open in IMG/M |
| 3300012357|Ga0137384_10984345 | All Organisms → cellular organisms → Bacteria | 678 | Open in IMG/M |
| 3300012923|Ga0137359_10476025 | All Organisms → cellular organisms → Bacteria | 1103 | Open in IMG/M |
| 3300012925|Ga0137419_10189529 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1515 | Open in IMG/M |
| 3300014152|Ga0181533_1257362 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 648 | Open in IMG/M |
| 3300014492|Ga0182013_10262911 | All Organisms → cellular organisms → Bacteria | 990 | Open in IMG/M |
| 3300014501|Ga0182024_10008363 | All Organisms → cellular organisms → Bacteria | 21851 | Open in IMG/M |
| 3300015193|Ga0167668_1032699 | All Organisms → cellular organisms → Bacteria | 1140 | Open in IMG/M |
| 3300015356|Ga0134073_10333184 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 552 | Open in IMG/M |
| 3300015359|Ga0134085_10052710 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 1630 | Open in IMG/M |
| 3300017823|Ga0187818_10012825 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3590 | Open in IMG/M |
| 3300017925|Ga0187856_1158008 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 849 | Open in IMG/M |
| 3300017925|Ga0187856_1203695 | All Organisms → cellular organisms → Bacteria | 716 | Open in IMG/M |
| 3300017929|Ga0187849_1012304 | All Organisms → cellular organisms → Bacteria | 5498 | Open in IMG/M |
| 3300017931|Ga0187877_1103835 | All Organisms → cellular organisms → Bacteria | 1184 | Open in IMG/M |
| 3300017934|Ga0187803_10187703 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 814 | Open in IMG/M |
| 3300017938|Ga0187854_10206711 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 866 | Open in IMG/M |
| 3300017938|Ga0187854_10252963 | All Organisms → cellular organisms → Bacteria | 764 | Open in IMG/M |
| 3300017940|Ga0187853_10230499 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → unclassified Acidobacterium → Acidobacterium sp. S8 | 856 | Open in IMG/M |
| 3300017940|Ga0187853_10333619 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 680 | Open in IMG/M |
| 3300017947|Ga0187785_10092420 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1199 | Open in IMG/M |
| 3300017970|Ga0187783_10906539 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 635 | Open in IMG/M |
| 3300017975|Ga0187782_10330237 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1153 | Open in IMG/M |
| 3300017975|Ga0187782_10756452 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 750 | Open in IMG/M |
| 3300017975|Ga0187782_10970577 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 660 | Open in IMG/M |
| 3300018008|Ga0187888_1213901 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 761 | Open in IMG/M |
| 3300018016|Ga0187880_1253757 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RIFCSPHIGHO2_02_FULL_38_15 | 774 | Open in IMG/M |
| 3300018021|Ga0187882_1129126 | All Organisms → cellular organisms → Bacteria | 1046 | Open in IMG/M |
| 3300018033|Ga0187867_10097047 | All Organisms → cellular organisms → Bacteria | 1721 | Open in IMG/M |
| 3300018037|Ga0187883_10689181 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 533 | Open in IMG/M |
| 3300018062|Ga0187784_10560500 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 919 | Open in IMG/M |
| 3300018086|Ga0187769_11147518 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 588 | Open in IMG/M |
| 3300018088|Ga0187771_10439975 | All Organisms → cellular organisms → Bacteria | 1101 | Open in IMG/M |
| 3300018090|Ga0187770_10556460 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 910 | Open in IMG/M |
| 3300018090|Ga0187770_11205205 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 612 | Open in IMG/M |
| 3300018433|Ga0066667_12247003 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 509 | Open in IMG/M |
| 3300021168|Ga0210406_10275251 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1375 | Open in IMG/M |
| 3300021402|Ga0210385_10364555 | All Organisms → cellular organisms → Bacteria | 1081 | Open in IMG/M |
| 3300021403|Ga0210397_10539263 | Not Available | 887 | Open in IMG/M |
| 3300021477|Ga0210398_11332246 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 563 | Open in IMG/M |
| 3300021559|Ga0210409_10208022 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1780 | Open in IMG/M |
| 3300025446|Ga0208038_1002560 | All Organisms → cellular organisms → Bacteria | 8380 | Open in IMG/M |
| 3300025446|Ga0208038_1003841 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 6106 | Open in IMG/M |
| 3300025469|Ga0208687_1012164 | All Organisms → cellular organisms → Bacteria | 2614 | Open in IMG/M |
| 3300025905|Ga0207685_10801852 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300025922|Ga0207646_10629608 | Not Available | 962 | Open in IMG/M |
| 3300025928|Ga0207700_10513710 | All Organisms → cellular organisms → Bacteria | 1061 | Open in IMG/M |
| 3300026036|Ga0208650_1025376 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 718 | Open in IMG/M |
| 3300026088|Ga0207641_10871215 | All Organisms → cellular organisms → Bacteria | 893 | Open in IMG/M |
| 3300026305|Ga0209688_1014964 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1484 | Open in IMG/M |
| 3300026309|Ga0209055_1046831 | All Organisms → cellular organisms → Bacteria | 1884 | Open in IMG/M |
| 3300026343|Ga0209159_1094611 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1312 | Open in IMG/M |
| 3300026537|Ga0209157_1080808 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 1596 | Open in IMG/M |
| 3300027570|Ga0208043_1108531 | All Organisms → cellular organisms → Bacteria | 747 | Open in IMG/M |
| 3300027795|Ga0209139_10116198 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 944 | Open in IMG/M |
| 3300027854|Ga0209517_10692423 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 526 | Open in IMG/M |
| 3300027884|Ga0209275_10231997 | All Organisms → cellular organisms → Bacteria | 1007 | Open in IMG/M |
| 3300027905|Ga0209415_10162796 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2207 | Open in IMG/M |
| 3300027908|Ga0209006_10361358 | Not Available | 1229 | Open in IMG/M |
| 3300028013|Ga0265350_100025 | All Organisms → cellular organisms → Bacteria | 3116 | Open in IMG/M |
| 3300028566|Ga0302147_10228619 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 623 | Open in IMG/M |
| 3300028678|Ga0302165_10058392 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1020 | Open in IMG/M |
| 3300028800|Ga0265338_10187044 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1573 | Open in IMG/M |
| 3300028906|Ga0308309_10679298 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 895 | Open in IMG/M |
| 3300029953|Ga0311343_10059935 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4664 | Open in IMG/M |
| 3300030000|Ga0311337_10076904 | All Organisms → cellular organisms → Bacteria | 2620 | Open in IMG/M |
| 3300030520|Ga0311372_11498273 | All Organisms → cellular organisms → Bacteria | 832 | Open in IMG/M |
| 3300030580|Ga0311355_10447095 | All Organisms → cellular organisms → Bacteria | 1253 | Open in IMG/M |
| 3300030580|Ga0311355_11681280 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300030618|Ga0311354_11092340 | Not Available | 729 | Open in IMG/M |
| 3300031231|Ga0170824_100336252 | Not Available | 627 | Open in IMG/M |
| 3300031446|Ga0170820_13409459 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 659 | Open in IMG/M |
| 3300031521|Ga0311364_10088164 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3259 | Open in IMG/M |
| 3300031754|Ga0307475_11575060 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 502 | Open in IMG/M |
| 3300031945|Ga0310913_10563421 | All Organisms → cellular organisms → Bacteria | 808 | Open in IMG/M |
| 3300031962|Ga0307479_11845336 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 556 | Open in IMG/M |
| 3300032160|Ga0311301_11216350 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 963 | Open in IMG/M |
| 3300032261|Ga0306920_102947158 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
| 3300033402|Ga0326728_10011517 | All Organisms → cellular organisms → Bacteria | 20126 | Open in IMG/M |
| 3300033977|Ga0314861_0009279 | All Organisms → cellular organisms → Bacteria | 7225 | Open in IMG/M |
| 3300033977|Ga0314861_0434045 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3 | 571 | Open in IMG/M |
| 3300034819|Ga0373958_0033743 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1017 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 10.87% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 10.87% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 10.87% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 7.25% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 7.25% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 7.97% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.07% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.35% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.90% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 2.90% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.17% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.17% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 2.17% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.45% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.45% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.45% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.45% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.45% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 1.45% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 1.45% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 1.45% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.72% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.72% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.72% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.72% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.72% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.72% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.72% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.72% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.72% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.72% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.72% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.72% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.72% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.72% |
| Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 0.72% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.72% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005904 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_0N_404 | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009029 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 1 DNA2013-189 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
| 3300009523 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG | Environmental | Open in IMG/M |
| 3300009524 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG | Environmental | Open in IMG/M |
| 3300009548 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_100 | Environmental | Open in IMG/M |
| 3300009616 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_100 | Environmental | Open in IMG/M |
| 3300009618 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_100 | Environmental | Open in IMG/M |
| 3300009636 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_150 | Environmental | Open in IMG/M |
| 3300009639 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_40 | Environmental | Open in IMG/M |
| 3300009665 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 | Environmental | Open in IMG/M |
| 3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300009759 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_10 | Environmental | Open in IMG/M |
| 3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014152 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_60_metaG | Environmental | Open in IMG/M |
| 3300014492 | Permafrost microbial communities from Stordalen Mire, Sweden - 612S2M metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015193 | Arctic soil microbial communities from a glacier forefield, Rabots glacier, Tarfala, Sweden (Sample Rb6, proglacial stream) | Environmental | Open in IMG/M |
| 3300015356 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015359 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015 | Environmental | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017925 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_40 | Environmental | Open in IMG/M |
| 3300017929 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_100 | Environmental | Open in IMG/M |
| 3300017931 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_100 | Environmental | Open in IMG/M |
| 3300017934 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3 | Environmental | Open in IMG/M |
| 3300017938 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_150 | Environmental | Open in IMG/M |
| 3300017940 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_100 | Environmental | Open in IMG/M |
| 3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
| 3300017947 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018008 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_40 | Environmental | Open in IMG/M |
| 3300018016 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_40 | Environmental | Open in IMG/M |
| 3300018021 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_150 | Environmental | Open in IMG/M |
| 3300018033 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_10 | Environmental | Open in IMG/M |
| 3300018037 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10 | Environmental | Open in IMG/M |
| 3300018042 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10 | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300025446 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_100 (SPAdes) | Environmental | Open in IMG/M |
| 3300025469 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_100 (SPAdes) | Environmental | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026036 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_0N_404 (SPAdes) | Environmental | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026305 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 (SPAdes) | Environmental | Open in IMG/M |
| 3300026309 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes) | Environmental | Open in IMG/M |
| 3300026343 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 (SPAdes) | Environmental | Open in IMG/M |
| 3300026537 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 (SPAdes) | Environmental | Open in IMG/M |
| 3300027570 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027795 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028013 | Soil microbial communities from Maridalen valley, Oslo, Norway - NSE2 | Environmental | Open in IMG/M |
| 3300028566 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E3_2 | Environmental | Open in IMG/M |
| 3300028678 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E3_2 | Environmental | Open in IMG/M |
| 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Host-Associated | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029953 | II_Bog_E3 coassembly | Environmental | Open in IMG/M |
| 3300030000 | I_Fen_N3 coassembly | Environmental | Open in IMG/M |
| 3300030520 | III_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300030580 | II_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300030618 | II_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031521 | III_Fen_E2 coassembly | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300033402 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MN | Environmental | Open in IMG/M |
| 3300033977 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - SJ75 | Environmental | Open in IMG/M |
| 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0062387_1001498541 | 3300004091 | Bog Forest Soil | RRLHSLEQELLAAVKGPKIELAVTEIRKKGLIGALRNQTGRR* |
| Ga0062389_1005458732 | 3300004092 | Bog Forest Soil | RQDKERRLHSLEQELLAAVKGPKIELAVTEIRKKGLIGALRNQTGRR* |
| Ga0070710_114169162 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MTIRRNKERRLAQLEQELIVAAKGPKIELTVAELRKKGLMAVLRERIP |
| Ga0070707_1010661252 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | KERRLSNLEQELVAAAKGPKIELPIAEIRRKGLIPALRERARKR* |
| Ga0070733_104923302 | 3300005541 | Surface Soil | RQDKERRLGNLEQELVAAAKGPKIEIPLAEIRRKGLISALRERTRSR* |
| Ga0066661_105125281 | 3300005554 | Soil | EQELLAAAKGPKIELSISEIRKKGLVTALRERARRA* |
| Ga0066670_105055362 | 3300005560 | Soil | ELLAAAKGPKIEVSIREIRKKGLVTALRERVRRA* |
| Ga0066705_101246012 | 3300005569 | Soil | MANLEQELLAAAKGPKIEVSIREIRKKGLVTALRERVRRA* |
| Ga0066705_107423172 | 3300005569 | Soil | QDKERRMTNLEQELLAAAKGPKIEVSISQIRKKGLISALRERARARRA* |
| Ga0075280_100644001 | 3300005904 | Rice Paddy Soil | LSNLEQELVAAVKGPKIELSVADIRKKGLLRTLRERTQR* |
| Ga0075015_1002812953 | 3300006102 | Watersheds | LGDLEASLVAAANGPKIELSVAEIRRKGLVRALRERTMRR* |
| Ga0070715_109486442 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | NAALGNLEQELVAAARGATVELSIADIRKKGLLAVLRERTRRK* |
| Ga0070716_1012155593 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | ELVAAARGATVELSIADIRKKGLLAVLRERTRRR* |
| Ga0075014_1006854573 | 3300006174 | Watersheds | NLEQDLLAAVKSERIEIPVAEIRKKGLVAALRERAREK* |
| Ga0070765_1004831503 | 3300006176 | Soil | VNLEQELVAAAKGQKIEIPLAEIRRKGLISALRERARGR* |
| Ga0070765_1008007332 | 3300006176 | Soil | ERRLGNLEQELVAAAKGPKIEIPLAEIRRKGLISALRERARSR* |
| Ga0066658_100124397 | 3300006794 | Soil | MANLEQALLAAAKGPKIELSISEIRKKGLVTALRERARRA* |
| Ga0066660_104534144 | 3300006800 | Soil | LEQELLAAAKGPKIELSISEIRKKGLVTALRERARRA* |
| Ga0073928_111870213 | 3300006893 | Iron-Sulfur Acid Spring | DKERRLGNLEQDLIAAAKGPKIELPVAEIRKKGLISTLRERARRR* |
| Ga0075435_1001684243 | 3300007076 | Populus Rhizosphere | TLENDLVTAAKGPTIEVSLADIRKKGLVAALRDRIRRP* |
| Ga0066793_101744771 | 3300009029 | Prmafrost Soil | KERRLGNLERELVVAADGPKIEIPVAEIRRKGLIPALRERARRR* |
| Ga0099829_110085503 | 3300009038 | Vadose Zone Soil | EQELVAAAKGTKIELPVAEIRRKGLITVLRERTRRR* |
| Ga0099830_113788121 | 3300009088 | Vadose Zone Soil | KERRLGHLEQELIAAAKGPKIEVSLAEIRRKGLIAALREQARRR* |
| Ga0099827_115427012 | 3300009090 | Vadose Zone Soil | QELMAAHRGARIEISIDEIRKKGLVRALRERAKR* |
| Ga0116222_11274831 | 3300009521 | Peatlands Soil | LRGLERDLLAGLQGEKIEIPVAEIRKKGLVAALREKARRK* |
| Ga0116221_10371651 | 3300009523 | Peatlands Soil | ELIRQDKGRRRHTLEQDLSAAAKGSKIEIPVAELRRKGLVAALRDRTQRR* |
| Ga0116221_14241381 | 3300009523 | Peatlands Soil | RRFAELEQGLLQAARGKRLEVPVSEIRKKGLVAALREGIRRR* |
| Ga0116225_14161823 | 3300009524 | Peatlands Soil | DKERRLGNLEQELIAAAKGAKIELRVAEIRQKGLVTVLRERSRRR* |
| Ga0116107_10031211 | 3300009548 | Peatland | KERRMANLEQELLAAARGPKIEVSIAEIRKKGLITALRERVRTR* |
| Ga0116107_10051051 | 3300009548 | Peatland | KERRMANLEQELLAAARGPKIEVSIAEIRKKGLITALRERGRTR* |
| Ga0116111_10194731 | 3300009616 | Peatland | NLEQELLAAARGPKIEVSIAEIRKKGLITALRERGRTR* |
| Ga0116127_10941622 | 3300009618 | Peatland | MANLEQELLAAAKGPKIEVSIAEIRKKELITALRERVRRA* |
| Ga0116112_11206401 | 3300009636 | Peatland | MANLEQELLAAARGPKIEVSIAEIRKKGLITALRERVRTR* |
| Ga0116122_10046238 | 3300009639 | Peatland | RMANLEQELLAAARGPKIEVSIAEIRKKGLITALRERVRTR* |
| Ga0116135_11005821 | 3300009665 | Peatland | NLEQDLLAAARGKKIEVSVADIRKKGLVTALREKARRA* |
| Ga0116216_102894751 | 3300009698 | Peatlands Soil | NLEQDLLAGVKSGRIEISVAEIRKKGLVGALRERARRK* |
| Ga0116216_105649723 | 3300009698 | Peatlands Soil | QDKERRLGNLEQELIAAAKGAKIELRVAEIRQKGLVTVLRERSRRR* |
| Ga0116217_107583921 | 3300009700 | Peatlands Soil | DKSRRLGDLEASLVAAAKGPKIELTVAEIRRKGLVRALRERTMKK* |
| Ga0116101_12068851 | 3300009759 | Peatland | RQDKERRLGNLEQDLLAAAKGPKIELPIAEIRRKGLIPALRERSRRR* |
| Ga0116219_103326812 | 3300009824 | Peatlands Soil | RQDKERRMANLEQELLAAARGPKIEVSIAEIRKKGLITALRERVRTR* |
| Ga0074044_104839011 | 3300010343 | Bog Forest Soil | RQDKERRLANLVQDLLAAVKGPKIEVSLREIRNKGLITALRERARRR* |
| Ga0136449_1002993611 | 3300010379 | Peatlands Soil | NLERELVAAARGPKIEIPLAEIRRKGLIPALRERARLR* |
| Ga0136449_1023055592 | 3300010379 | Peatlands Soil | MANLEQELLAAARGPKIEVSIAEIRKKGLITALRE |
| Ga0136449_1034768342 | 3300010379 | Peatlands Soil | RRLGDLEQELVAAAKGPKIEIPLAEIRRKGLIPALRERARRR* |
| Ga0150983_122232151 | 3300011120 | Forest Soil | QELLAAAKGPKIEVSISEIRKKGLITALRERARRA* |
| Ga0150983_156765521 | 3300011120 | Forest Soil | DLITAAKGRKIELSVTEIRKKGLVAALRERTRRR* |
| Ga0137392_115642312 | 3300011269 | Vadose Zone Soil | LSNLEQELIAATKGPKIELSVADVRKKGLLRVLREHKQR* |
| Ga0137389_114681541 | 3300012096 | Vadose Zone Soil | RLGHLEQELIAAAKGPKIEVSLAEIRRKGLIAALREQARRR* |
| Ga0137388_100975421 | 3300012189 | Vadose Zone Soil | ERRLGNLEQELVAAAKGTKIELPVAEIRRKGLITVLRERTRRR* |
| Ga0137364_106837773 | 3300012198 | Vadose Zone Soil | TLEAELVEAAKGNKIELSVAEVRRKGLVNVLRERARRK* |
| Ga0137380_109729001 | 3300012206 | Vadose Zone Soil | ERRLGNLEQELIAAAKGRKVEVSIADIRKKGLVAALRERTRR* |
| Ga0137378_102872091 | 3300012210 | Vadose Zone Soil | NLEQDLITAARGPKIEISVTEIRKKGLVAALRDRTRRK* |
| Ga0137378_110687442 | 3300012210 | Vadose Zone Soil | LGNLEQELVAAAKGRKIEVSVADIRKKGLMAALRERARLR* |
| Ga0137367_108569991 | 3300012353 | Vadose Zone Soil | DKERRLGNLEQELLAAAKGKTIEVSLAEIRKKGLIAALRARARRA* |
| Ga0137371_108277701 | 3300012356 | Vadose Zone Soil | DKERRLGNLEQELITAAKGRKVTIPVAEIRKKGLVTALRERTRR* |
| Ga0137384_109843451 | 3300012357 | Vadose Zone Soil | QDKERRLGNLERELAAAKGPKIEIRLAEIRRKGFVTAVRERARPP* |
| Ga0137359_104760253 | 3300012923 | Vadose Zone Soil | KERRLVGLEQELVAAHRGAKIEISIDEIRKKGLVRALRERAKR* |
| Ga0137419_101895291 | 3300012925 | Vadose Zone Soil | MTNLEQELLAAAKGPKIEVSISQIRKKGLISALRERARRA* |
| Ga0181533_12573621 | 3300014152 | Bog | RLGNLEQDLVAAAKGRKIEIPLAEIRRKGLISALRERARRR* |
| Ga0182013_102629111 | 3300014492 | Bog | NLEQELLAATRGPKIEVSIAEIRKKGLITALRERVRTR* |
| Ga0182024_100083635 | 3300014501 | Permafrost | MANLEQQLLAAVKGPKIEVSISEIRKKGLITALRERARRA* |
| Ga0167668_10326991 | 3300015193 | Glacier Forefield Soil | RRLGDLEASLVAAAKGPKIELSVAEIRRKGLVRVLRERTMKR* |
| Ga0134073_103331842 | 3300015356 | Grasslands Soil | TNLEQELLAAAKGPKIEVSISQIRKKGLISALRERARARRA* |
| Ga0134085_100527103 | 3300015359 | Grasslands Soil | EQELLAAAKGPKIEVSIREIRKKGLVTALRERVRRA* |
| Ga0187818_100128251 | 3300017823 | Freshwater Sediment | RNLEQDLLAGVKGEKIEIPVAEIRKKGLVAALRERARRK |
| Ga0187856_11580081 | 3300017925 | Peatland | MANLEQELLAAAKGPKIEVSIAEIRKKELITALRERVRRA |
| Ga0187856_12036952 | 3300017925 | Peatland | RMANLEQELLAAARGPKIELSIAEIRKKGLITVLRERVRTR |
| Ga0187849_10123041 | 3300017929 | Peatland | KERRMANLEQELLAAARGPKIEVSIAEIRKKGLITALRERGRTR |
| Ga0187877_11038351 | 3300017931 | Peatland | KERRMANLEQELLAAARGPKIEVSIAEIRKKGLITALRERVRTR |
| Ga0187803_101877032 | 3300017934 | Freshwater Sediment | NLEQELLAAARGPKIEVSIAAIRKKGLITALRERVQTR |
| Ga0187854_102067111 | 3300017938 | Peatland | MANLEQELLAAAKGPKIEVSITEIRKKGLITALRERVRRG |
| Ga0187854_102529633 | 3300017938 | Peatland | ANLEQELLAAARGPKIEVSIAEIRKKGLITALRERGRTR |
| Ga0187853_102304991 | 3300017940 | Peatland | LEQELLAAARGPKIEVSIAEIRKKGLITALRERVRTR |
| Ga0187853_103336191 | 3300017940 | Peatland | NLEQELLAAARGPKIEVSIAEIRRKGLIAALRERVRTR |
| Ga0187879_102731341 | 3300017946 | Peatland | LQSREYVRELIRQDQERRMANLEQELLAAARGPKIEVSIAEIRKKGFITALRERVRTR |
| Ga0187785_100924204 | 3300017947 | Tropical Peatland | NLEQELVAAAKGRKIELPVAEIRRKGLVAALRERARRR |
| Ga0187783_109065392 | 3300017970 | Tropical Peatland | LEEDLIAATKGPKIELSIAEIRRKGLLTLLRERTRSR |
| Ga0187782_103302371 | 3300017975 | Tropical Peatland | KEGRLGNLEQELVAAAKGRKIELPVAEIRRKGLVAALRERARHR |
| Ga0187782_107564522 | 3300017975 | Tropical Peatland | LIRQDEERRLASLERELLAAAKGPKTEVPVSAIRKKGLIAALRERVRRP |
| Ga0187782_109705773 | 3300017975 | Tropical Peatland | DKERRMANLEQELLAAARGPKIEVPIAEIRKKGLIRALRERVQRR |
| Ga0187888_12139013 | 3300018008 | Peatland | PSEYVRELIRRDKERRLSNLEQELTAAAKGPKIEIPVDKIRRKGLIAALREHARRR |
| Ga0187880_12537571 | 3300018016 | Peatland | LEQELLAAAKGPKIEVSIAEIRKKELITALRERVRRA |
| Ga0187882_11291261 | 3300018021 | Peatland | ANLEQELLAAARGPKIEVSIAEIRKKGLITALRERVRTR |
| Ga0187867_100970471 | 3300018033 | Peatland | LHTLEQDLIAAAKGSKIEIPVADLRRKGLVAALRDRTLRR |
| Ga0187883_106891812 | 3300018037 | Peatland | DKERRLGDLEHELVAAAKGRKIELPVAEIRRKGLVAVLRERPRGR |
| Ga0187871_102736232 | 3300018042 | Peatland | LQSREYVRELIRQDQERRMANLEQELLAAARGPKIEVSIAEIRKKGLITALRERVRTR |
| Ga0187784_105605002 | 3300018062 | Tropical Peatland | MALRSTSREYRLGNLEQELVAAAKGGKIELPVAEIRRKGLVAALRERAHRR |
| Ga0187769_111475181 | 3300018086 | Tropical Peatland | RQDKERRLGNLEQELVAAARGPKIEIPLAEIRRKGLIRTLRERSRR |
| Ga0187771_104399752 | 3300018088 | Tropical Peatland | MVSKSSSEKRRLGNLEQELVAAAKGKKIELPVAEIRRKGLIAVLRERAHRR |
| Ga0187770_105564601 | 3300018090 | Tropical Peatland | LEQELVAAARGPKIEIPLAEIRRKGLIPALRERARRR |
| Ga0187770_112052052 | 3300018090 | Tropical Peatland | EQDLIAAARGAKIELPLAEIRRKGLVAVLREQTLRERARRR |
| Ga0066667_122470031 | 3300018433 | Grasslands Soil | LGNLEQELIAAARGPKIEVSVADIRKKGLVKALRERTRSR |
| Ga0210406_102752511 | 3300021168 | Soil | MANLEQELLAAAKGPKIEVSISEIRKKGLMTALRERARRA |
| Ga0210385_103645553 | 3300021402 | Soil | RRLGVLEEELLAASKGRQIEIPLAEIRRKGLIAALRQRARRR |
| Ga0210397_105392631 | 3300021403 | Soil | DKERRLGNLEQELVAAAKGPKIELSVAAIRKKGLIGALREGTSRR |
| Ga0210398_113322461 | 3300021477 | Soil | LEQELTAAAKGSKIEISVAEIRRKGLIAALREHARRR |
| Ga0210409_102080221 | 3300021559 | Soil | LGHLEQELIAAARGPKIEVSLAEIRRKGLLAALREQARRR |
| Ga0208038_10025601 | 3300025446 | Peatland | QDKERRMANLEQELLAAARGPKIEVSIAEIRKKGLITALRERVRTR |
| Ga0208038_100384110 | 3300025446 | Peatland | QDKERRMANLEQELLAAARGPKIEVSIAEIRKKGLITALRERGRTR |
| Ga0208687_10121641 | 3300025469 | Peatland | MANLEQELLAAARGPKIEVSIAEIRKKGLITALRERVRTR |
| Ga0207685_108018522 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | GTLEQELLAAVTRSKIEVPISEIRKKGLVAALRERTRRR |
| Ga0207646_106296082 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | LEQELIAAAKGPKIEVSLAEIRRKGLVAALREQARRR |
| Ga0207700_105137104 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | EQELLAAAKGPKIEVSLAEIRRKGLIRALRDRARP |
| Ga0208650_10253763 | 3300026036 | Rice Paddy Soil | LSNLEQELVAAVKGPKIELSVADIRKKGLLRTLRERTQR |
| Ga0207641_108712152 | 3300026088 | Switchgrass Rhizosphere | IRSAEEDLVAAAKGPKIEVCVSEIRKKGLMNALRERTRRR |
| Ga0209688_10149643 | 3300026305 | Soil | QDKERRLGNLEQDLIAAARGARIELPVADIRKKGLVPALRARARRK |
| Ga0209055_10468311 | 3300026309 | Soil | NLEQELLAAAKGPKIELSISEIRKKGLVTALRERARRA |
| Ga0209159_10946113 | 3300026343 | Soil | TNLEQELLAAAKGPKIEVSISQIRKKGLISALRERARRA |
| Ga0209157_10808083 | 3300026537 | Soil | LEQELLAAAKGPKIEVSIREIRKKGLVTALRERVRRA |
| Ga0208043_11085311 | 3300027570 | Peatlands Soil | QELIAAAKGAKIELRVAEIRQKGLVTVLRERSRRR |
| Ga0209139_101161982 | 3300027795 | Bog Forest Soil | RRLHSLEQELLAAVKGPKIELAVTEIRKKGLIGALRNQTGRR |
| Ga0209517_106924231 | 3300027854 | Peatlands Soil | EQDLLAGVKSEKIEIPVAEIRKKGLVAALRERARRK |
| Ga0209275_102319971 | 3300027884 | Soil | GHLEQSLVAAAKGQKIEIPVAEIRHKGLISTLRQRARVR |
| Ga0209415_101627965 | 3300027905 | Peatlands Soil | LRGLERDLLAGLQGEKIEIPVAEIRKKGLVAALREKARRK |
| Ga0209006_103613582 | 3300027908 | Forest Soil | LIRQDKERRLGNLEKELVAAANGPKIETPVAEIRHKGPIPALRGRARRR |
| Ga0265350_1000251 | 3300028013 | Soil | DKERRLHTLEQDLIAAAKGPKIELAVTEIRKKGLVAALRSQTGRR |
| Ga0302147_102286193 | 3300028566 | Bog | RRMGNLEQDLLAAARGKKIEVSVADIRRKGLVTALREKARRA |
| Ga0302165_100583921 | 3300028678 | Fen | RLGDLEASLVAAAKGPKIELSVAEIRRKGLVRTLRERTMKR |
| Ga0265338_101870441 | 3300028800 | Rhizosphere | RQYKERCLSDLEQELVAAARGRKIEIPVVEIRRKGLVAALRARARRR |
| Ga0308309_106792981 | 3300028906 | Soil | RRDKERRMANLEQELLAAVKGPKIEVSISEIRKKGLITALRERARRA |
| Ga0311343_100599351 | 3300029953 | Bog | RDKERRLSNLEQELTAAAKGPKIEIPVDEIRRKGLIAALREHARRR |
| Ga0311337_100769044 | 3300030000 | Fen | KARRLGDLEASLVAAAKGPKIELSVAEIRRKGLVRTLRERTMKR |
| Ga0311372_114982732 | 3300030520 | Palsa | RSLEQELLAGVKSDRIEIPVAEIRKKGLVAALRERARRK |
| Ga0311355_104470951 | 3300030580 | Palsa | KERRLHSLEQDLIAAAKGPTIELAVTEIRKKGLVAALRSQTGRR |
| Ga0311355_116812801 | 3300030580 | Palsa | RLRSLEQELLAGVKSDKIEIPVAEIRKKGLVAALRERARRK |
| Ga0311354_110923402 | 3300030618 | Palsa | KERRLGNLEQELVAAAKGPKIEIPLAEIRRKGLIAALRDHARR |
| Ga0170824_1003362521 | 3300031231 | Forest Soil | HEQELLAAAKGQKIEVSVSEIRKKGLVAALRQHTQRRF |
| Ga0170820_134094591 | 3300031446 | Forest Soil | LSNLEQELVAAATGPKIELPVAEIRRKGLIPALRERARKR |
| Ga0311364_100881644 | 3300031521 | Fen | RQDKARRLGDLEASLVAAAKGPKIELSVAEIRRKGLVRTLRERTMKR |
| Ga0307475_115750601 | 3300031754 | Hardwood Forest Soil | LHNLERDLIAAAKGRKIELTVAEVRQKGLVAALRDRTRRR |
| Ga0310913_105634211 | 3300031945 | Soil | ERRLATLEQELLAAARGPKIEVLLSEIRKKGLITALREKARRG |
| Ga0307479_118453361 | 3300031962 | Hardwood Forest Soil | SSLEQELVAAAMGPKIELPVAEIRRKGLIPALRERARKR |
| Ga0311301_112163501 | 3300032160 | Peatlands Soil | QDKSRRLGDLEASLVAAAKGPKIELTVAEIRRKGLVRALRERTMKK |
| Ga0306920_1029471583 | 3300032261 | Soil | MANLEQELLSAAKGPKIEVSISEIRKKGLVTALRERVRRV |
| Ga0326728_1001151712 | 3300033402 | Peat Soil | MANLEQELLAAARGPKIELSIAEIRKKGLITALRERVRTR |
| Ga0314861_0009279_1935_2081 | 3300033977 | Peatland | MFSSKERRMANLEQELPAAARGTKIEVPTAEIRKKGLIRALRERVRRP |
| Ga0314861_0434045_286_408 | 3300033977 | Peatland | MANLKQELLAAARGPKIELSISEIRKKGLVRVLRERAQRP |
| Ga0373958_0033743_890_1015 | 3300034819 | Rhizosphere Soil | RLGNLERDLVAAAKGPKIEVSVSEIRKKGLVNALRERTRQR |
| ⦗Top⦘ |