


| Basic Information | |
|---|---|
| Family ID | F056027 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 138 |
| Average Sequence Length | 40 residues |
| Representative Sequence | MIKTIILSMCLAASSLSLNARAQDVRQYTDGPVTEVDYIRV |
| Number of Associated Samples | 129 |
| Number of Associated Scaffolds | 138 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 95.62 % |
| % of genes near scaffold ends (potentially truncated) | 97.83 % |
| % of genes from short scaffolds (< 2000 bps) | 95.65 % |
| Associated GOLD sequencing projects | 124 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.38 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (90.580 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (13.768 % of family members) |
| Environment Ontology (ENVO) | Unclassified (20.290 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (52.899 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 34.78% β-sheet: 0.00% Coil/Unstructured: 65.22% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.38 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 138 Family Scaffolds |
|---|---|---|
| PF05163 | DinB | 14.49 |
| PF12867 | DinB_2 | 6.52 |
| PF00326 | Peptidase_S9 | 5.07 |
| PF03466 | LysR_substrate | 3.62 |
| PF00126 | HTH_1 | 3.62 |
| PF00155 | Aminotran_1_2 | 2.90 |
| PF08546 | ApbA_C | 2.17 |
| PF01042 | Ribonuc_L-PSP | 2.17 |
| PF02633 | Creatininase | 2.17 |
| PF14552 | Tautomerase_2 | 2.17 |
| PF07978 | NIPSNAP | 1.45 |
| PF14534 | DUF4440 | 1.45 |
| PF07883 | Cupin_2 | 1.45 |
| PF02567 | PhzC-PhzF | 0.72 |
| PF00282 | Pyridoxal_deC | 0.72 |
| PF00440 | TetR_N | 0.72 |
| PF04367 | DUF502 | 0.72 |
| PF02129 | Peptidase_S15 | 0.72 |
| PF13614 | AAA_31 | 0.72 |
| PF07676 | PD40 | 0.72 |
| PF07976 | Phe_hydrox_dim | 0.72 |
| PF13417 | GST_N_3 | 0.72 |
| PF00450 | Peptidase_S10 | 0.72 |
| PF11706 | zf-CGNR | 0.72 |
| PF13240 | zinc_ribbon_2 | 0.72 |
| PF13924 | Lipocalin_5 | 0.72 |
| COG ID | Name | Functional Category | % Frequency in 138 Family Scaffolds |
|---|---|---|---|
| COG2318 | Bacillithiol/mycothiol S-transferase BstA/DinB, DinB/YfiT family (unrelated to E. coli DinB) | Secondary metabolites biosynthesis, transport and catabolism [Q] | 14.49 |
| COG0251 | Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 family | Defense mechanisms [V] | 2.17 |
| COG1402 | Creatinine amidohydrolase/Fe(II)-dependent FAPy formamide hydrolase (riboflavin and F420 biosynthesis) | Coenzyme transport and metabolism [H] | 2.17 |
| COG1893 | Ketopantoate reductase | Coenzyme transport and metabolism [H] | 2.17 |
| COG0076 | Glutamate or tyrosine decarboxylase or a related PLP-dependent protein | Amino acid transport and metabolism [E] | 0.72 |
| COG0384 | Predicted epimerase YddE/YHI9, PhzF superfamily | General function prediction only [R] | 0.72 |
| COG2928 | Uncharacterized membrane protein | Function unknown [S] | 0.72 |
| COG2939 | Carboxypeptidase C (cathepsin A) | Amino acid transport and metabolism [E] | 0.72 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 90.58 % |
| Unclassified | root | N/A | 9.42 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000364|INPhiseqgaiiFebDRAFT_100230739 | Not Available | 641 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100508512 | All Organisms → cellular organisms → Bacteria | 1082 | Open in IMG/M |
| 3300004631|Ga0058899_11847114 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 507 | Open in IMG/M |
| 3300005332|Ga0066388_104973328 | All Organisms → cellular organisms → Bacteria | 675 | Open in IMG/M |
| 3300005367|Ga0070667_101510871 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
| 3300005445|Ga0070708_102047060 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300005459|Ga0068867_100148123 | All Organisms → cellular organisms → Bacteria | 1841 | Open in IMG/M |
| 3300005537|Ga0070730_10396392 | All Organisms → cellular organisms → Bacteria | 894 | Open in IMG/M |
| 3300005537|Ga0070730_10418139 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 866 | Open in IMG/M |
| 3300005538|Ga0070731_10493085 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 815 | Open in IMG/M |
| 3300005538|Ga0070731_10893268 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
| 3300005542|Ga0070732_10915232 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300005560|Ga0066670_10890318 | Not Available | 541 | Open in IMG/M |
| 3300005563|Ga0068855_100937935 | All Organisms → cellular organisms → Bacteria | 912 | Open in IMG/M |
| 3300005569|Ga0066705_10709913 | Not Available | 605 | Open in IMG/M |
| 3300005718|Ga0068866_10273679 | All Organisms → cellular organisms → Bacteria | 1043 | Open in IMG/M |
| 3300005836|Ga0074470_11635029 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 7375 | Open in IMG/M |
| 3300005841|Ga0068863_100541809 | All Organisms → cellular organisms → Bacteria | 1148 | Open in IMG/M |
| 3300005842|Ga0068858_101238366 | All Organisms → cellular organisms → Bacteria | 734 | Open in IMG/M |
| 3300005993|Ga0080027_10058063 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1408 | Open in IMG/M |
| 3300006028|Ga0070717_12144086 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300006046|Ga0066652_100283599 | Not Available | 1464 | Open in IMG/M |
| 3300006172|Ga0075018_10240668 | Not Available | 873 | Open in IMG/M |
| 3300006176|Ga0070765_100697544 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 959 | Open in IMG/M |
| 3300006358|Ga0068871_100944772 | All Organisms → cellular organisms → Bacteria | 801 | Open in IMG/M |
| 3300006796|Ga0066665_10757167 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 768 | Open in IMG/M |
| 3300006800|Ga0066660_11413223 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300006854|Ga0075425_100855359 | Not Available | 1041 | Open in IMG/M |
| 3300006903|Ga0075426_10937956 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 653 | Open in IMG/M |
| 3300006903|Ga0075426_11144544 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
| 3300006914|Ga0075436_101098829 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
| 3300009098|Ga0105245_11202608 | All Organisms → cellular organisms → Bacteria | 806 | Open in IMG/M |
| 3300009137|Ga0066709_101432063 | All Organisms → cellular organisms → Bacteria | 1002 | Open in IMG/M |
| 3300009177|Ga0105248_11902923 | All Organisms → cellular organisms → Bacteria | 675 | Open in IMG/M |
| 3300010048|Ga0126373_12175837 | All Organisms → cellular organisms → Bacteria | 616 | Open in IMG/M |
| 3300010320|Ga0134109_10191279 | All Organisms → cellular organisms → Bacteria | 752 | Open in IMG/M |
| 3300010339|Ga0074046_10039633 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3171 | Open in IMG/M |
| 3300010359|Ga0126376_11513549 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 700 | Open in IMG/M |
| 3300010361|Ga0126378_12240728 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 623 | Open in IMG/M |
| 3300010366|Ga0126379_11291255 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 836 | Open in IMG/M |
| 3300010376|Ga0126381_103283692 | All Organisms → cellular organisms → Bacteria | 638 | Open in IMG/M |
| 3300010396|Ga0134126_10606718 | All Organisms → cellular organisms → Bacteria | 1252 | Open in IMG/M |
| 3300010398|Ga0126383_11152602 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 865 | Open in IMG/M |
| 3300010401|Ga0134121_10183541 | All Organisms → cellular organisms → Bacteria | 1801 | Open in IMG/M |
| 3300012211|Ga0137377_11956872 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300012476|Ga0157344_1004913 | All Organisms → cellular organisms → Bacteria | 813 | Open in IMG/M |
| 3300012582|Ga0137358_10024691 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 3896 | Open in IMG/M |
| 3300012582|Ga0137358_10252210 | All Organisms → cellular organisms → Bacteria | 1200 | Open in IMG/M |
| 3300012683|Ga0137398_10585797 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 771 | Open in IMG/M |
| 3300012931|Ga0153915_13511189 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300012964|Ga0153916_11899423 | All Organisms → cellular organisms → Bacteria | 667 | Open in IMG/M |
| 3300012971|Ga0126369_11189601 | All Organisms → cellular organisms → Bacteria | 852 | Open in IMG/M |
| 3300012971|Ga0126369_13498601 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300012985|Ga0164308_10302516 | All Organisms → cellular organisms → Bacteria | 1271 | Open in IMG/M |
| 3300013100|Ga0157373_10961471 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas kyeonggiensis | 636 | Open in IMG/M |
| 3300013297|Ga0157378_11429801 | All Organisms → cellular organisms → Bacteria | 735 | Open in IMG/M |
| 3300014157|Ga0134078_10201054 | All Organisms → cellular organisms → Bacteria | 813 | Open in IMG/M |
| 3300014489|Ga0182018_10677271 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300014501|Ga0182024_10016768 | All Organisms → cellular organisms → Bacteria | 13841 | Open in IMG/M |
| 3300014657|Ga0181522_10342471 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 890 | Open in IMG/M |
| 3300014657|Ga0181522_10680982 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
| 3300014838|Ga0182030_10711331 | Not Available | 939 | Open in IMG/M |
| 3300015197|Ga0167638_1061551 | Not Available | 793 | Open in IMG/M |
| 3300015356|Ga0134073_10227432 | Not Available | 633 | Open in IMG/M |
| 3300016294|Ga0182041_11544758 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
| 3300016371|Ga0182034_10298029 | All Organisms → cellular organisms → Bacteria | 1291 | Open in IMG/M |
| 3300017930|Ga0187825_10304539 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
| 3300017961|Ga0187778_10240093 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1161 | Open in IMG/M |
| 3300017970|Ga0187783_10691240 | All Organisms → cellular organisms → Bacteria | 737 | Open in IMG/M |
| 3300017993|Ga0187823_10080344 | All Organisms → cellular organisms → Bacteria | 946 | Open in IMG/M |
| 3300017994|Ga0187822_10244177 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
| 3300018029|Ga0187787_10207443 | All Organisms → cellular organisms → Bacteria | 695 | Open in IMG/M |
| 3300018037|Ga0187883_10178843 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1089 | Open in IMG/M |
| 3300018040|Ga0187862_10153751 | All Organisms → cellular organisms → Bacteria | 1548 | Open in IMG/M |
| 3300018044|Ga0187890_10717357 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 565 | Open in IMG/M |
| 3300018062|Ga0187784_11612189 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300018468|Ga0066662_11046003 | All Organisms → cellular organisms → Bacteria | 812 | Open in IMG/M |
| 3300019890|Ga0193728_1187475 | All Organisms → cellular organisms → Bacteria | 879 | Open in IMG/M |
| 3300020580|Ga0210403_10452912 | All Organisms → cellular organisms → Bacteria | 1045 | Open in IMG/M |
| 3300021168|Ga0210406_11120871 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
| 3300021171|Ga0210405_10760017 | All Organisms → cellular organisms → Bacteria | 745 | Open in IMG/M |
| 3300021180|Ga0210396_10496814 | All Organisms → cellular organisms → Bacteria | 1068 | Open in IMG/M |
| 3300021441|Ga0213871_10129534 | All Organisms → cellular organisms → Bacteria | 757 | Open in IMG/M |
| 3300021479|Ga0210410_11766499 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300021560|Ga0126371_10943916 | All Organisms → cellular organisms → Bacteria | 1006 | Open in IMG/M |
| 3300022712|Ga0242653_1029279 | All Organisms → cellular organisms → Bacteria | 816 | Open in IMG/M |
| 3300024049|Ga0233359_1045666 | Not Available | 516 | Open in IMG/M |
| 3300024290|Ga0247667_1090786 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300025903|Ga0207680_11195243 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300025916|Ga0207663_11216169 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 607 | Open in IMG/M |
| 3300025938|Ga0207704_10166396 | All Organisms → cellular organisms → Bacteria | 1576 | Open in IMG/M |
| 3300025960|Ga0207651_10649054 | All Organisms → cellular organisms → Bacteria | 926 | Open in IMG/M |
| 3300026088|Ga0207641_11118358 | All Organisms → cellular organisms → Bacteria | 786 | Open in IMG/M |
| 3300026142|Ga0207698_10394048 | All Organisms → cellular organisms → Bacteria | 1321 | Open in IMG/M |
| 3300026315|Ga0209686_1233319 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300026328|Ga0209802_1227551 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Terriglobus → unclassified Terriglobus → Terriglobus sp. TAA 43 | 676 | Open in IMG/M |
| 3300026330|Ga0209473_1151140 | All Organisms → cellular organisms → Bacteria | 940 | Open in IMG/M |
| 3300026490|Ga0257153_1087211 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 624 | Open in IMG/M |
| 3300026552|Ga0209577_10337299 | All Organisms → cellular organisms → Bacteria | 1114 | Open in IMG/M |
| 3300027545|Ga0209008_1098543 | Not Available | 653 | Open in IMG/M |
| 3300027575|Ga0209525_1081061 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 776 | Open in IMG/M |
| 3300027745|Ga0209908_10228553 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300027853|Ga0209274_10104154 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Azospirillaceae → Azospirillum → unclassified Azospirillum → Azospirillum sp. B4 | 1402 | Open in IMG/M |
| 3300027857|Ga0209166_10270149 | All Organisms → cellular organisms → Bacteria | 899 | Open in IMG/M |
| 3300027889|Ga0209380_10214290 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1131 | Open in IMG/M |
| 3300028047|Ga0209526_10667597 | All Organisms → cellular organisms → Bacteria | 658 | Open in IMG/M |
| 3300028047|Ga0209526_10976945 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300028146|Ga0247682_1091100 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 565 | Open in IMG/M |
| 3300028379|Ga0268266_10767482 | All Organisms → cellular organisms → Bacteria | 931 | Open in IMG/M |
| 3300029910|Ga0311369_10684138 | All Organisms → cellular organisms → Bacteria | 844 | Open in IMG/M |
| 3300030007|Ga0311338_10507559 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1263 | Open in IMG/M |
| 3300030058|Ga0302179_10194266 | All Organisms → cellular organisms → Bacteria | 896 | Open in IMG/M |
| 3300030520|Ga0311372_10368462 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2204 | Open in IMG/M |
| 3300030520|Ga0311372_12607454 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 563 | Open in IMG/M |
| 3300030580|Ga0311355_10372467 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1407 | Open in IMG/M |
| 3300030617|Ga0311356_11638780 | Not Available | 578 | Open in IMG/M |
| 3300030677|Ga0302317_10176785 | All Organisms → cellular organisms → Bacteria | 989 | Open in IMG/M |
| 3300031028|Ga0302180_10313198 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 805 | Open in IMG/M |
| 3300031028|Ga0302180_10524014 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
| 3300031234|Ga0302325_12905423 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 557 | Open in IMG/M |
| 3300031525|Ga0302326_12674747 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
| 3300031543|Ga0318516_10108884 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1571 | Open in IMG/M |
| 3300031544|Ga0318534_10472896 | All Organisms → cellular organisms → Bacteria | 717 | Open in IMG/M |
| 3300031545|Ga0318541_10287612 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 915 | Open in IMG/M |
| 3300031561|Ga0318528_10730079 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300031708|Ga0310686_100806498 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
| 3300031715|Ga0307476_10165118 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Azospirillaceae → Azospirillum → unclassified Azospirillum → Azospirillum sp. B4 | 1596 | Open in IMG/M |
| 3300031763|Ga0318537_10112761 | All Organisms → cellular organisms → Bacteria | 1009 | Open in IMG/M |
| 3300031765|Ga0318554_10442596 | All Organisms → cellular organisms → Bacteria | 737 | Open in IMG/M |
| 3300031793|Ga0318548_10238911 | All Organisms → cellular organisms → Bacteria | 893 | Open in IMG/M |
| 3300031879|Ga0306919_11431150 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300031910|Ga0306923_10549524 | All Organisms → cellular organisms → Bacteria | 1301 | Open in IMG/M |
| 3300031947|Ga0310909_10866267 | All Organisms → cellular organisms → Bacteria | 743 | Open in IMG/M |
| 3300031954|Ga0306926_10648971 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1284 | Open in IMG/M |
| 3300032055|Ga0318575_10484616 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 628 | Open in IMG/M |
| 3300032174|Ga0307470_11957045 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300034815|Ga0373906_173140 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 13.77% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 8.70% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 7.25% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 6.52% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 4.35% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.35% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.62% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.90% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.90% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.90% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.90% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 2.17% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.17% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.17% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.17% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.17% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.17% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.17% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.17% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.45% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 1.45% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.45% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.45% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.45% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.45% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 0.72% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.72% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.72% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.72% |
| Thawing Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Thawing Permafrost | 0.72% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.72% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.72% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.72% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.72% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.72% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.72% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.72% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.72% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.72% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.72% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.72% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.72% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.72% |
| Sediment Slurry | Engineered → Bioremediation → Metal → Unclassified → Unclassified → Sediment Slurry | 0.72% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300004631 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF234 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
| 3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300005836 | Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBB | Environmental | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300005993 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012476 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.yng.070610 | Host-Associated | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
| 3300012964 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 4 metaG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300014489 | Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014657 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaG | Environmental | Open in IMG/M |
| 3300014838 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015197 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G6B, Proglacial plain, adjacent to northern proglacial tributary) | Environmental | Open in IMG/M |
| 3300015356 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017993 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_3 | Environmental | Open in IMG/M |
| 3300017994 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2 | Environmental | Open in IMG/M |
| 3300018029 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP06_20_MG | Environmental | Open in IMG/M |
| 3300018037 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10 | Environmental | Open in IMG/M |
| 3300018040 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150 | Environmental | Open in IMG/M |
| 3300018044 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10 | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300019890 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1 | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Host-Associated | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022712 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-32-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300024049 | Soil microbial communities from Shasta-Trinity National Forest, California, United States - GEON-P30 | Environmental | Open in IMG/M |
| 3300024290 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK08 | Environmental | Open in IMG/M |
| 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026315 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 (SPAdes) | Environmental | Open in IMG/M |
| 3300026328 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes) | Environmental | Open in IMG/M |
| 3300026330 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes) | Environmental | Open in IMG/M |
| 3300026490 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-A | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300027545 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027575 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027745 | Thawing permafrost microbial communities from the Arctic, studying carbon transformations - Permafrost 812P2M | Environmental | Open in IMG/M |
| 3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028146 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK23 | Environmental | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300029910 | III_Palsa_E2 coassembly | Environmental | Open in IMG/M |
| 3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300030058 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_1 | Environmental | Open in IMG/M |
| 3300030520 | III_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300030580 | II_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300030617 | II_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300030677 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N3_3 | Environmental | Open in IMG/M |
| 3300031028 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031763 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300034815 | Uranium-contaminated sediment microbial communities from bioreactor in Oak Ridge, Tennessee, United States - B3A4.1 | Engineered | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| INPhiseqgaiiFebDRAFT_1002307391 | 3300000364 | Soil | MTKTIILFICVAASSLSLNASAQNARAQDLRQYTEGPVT |
| JGIcombinedJ26739_1005085124 | 3300002245 | Forest Soil | MIKIIVLSMGLAISAVSLNARAQDVRGYSYGPVTEVDCVHVEYGHF |
| Ga0058899_118471142 | 3300004631 | Forest Soil | MNKTIILSMCLAASSLSLNARAQDERAYTEGPVTEEDYIQVEYGHF |
| Ga0066388_1049733282 | 3300005332 | Tropical Forest Soil | MVKAAVLSMCLAVSSLSLNALAQDVRGYSYGPVTEVDYIHV |
| Ga0070667_1015108711 | 3300005367 | Switchgrass Rhizosphere | MIKTIVLSMCLAASSLSFAHAQNGRAYSYGPVTQVDYIRVE |
| Ga0070708_1020470601 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MTKAIVVSMCLAASSLSLKPRAQDERGYGYGPVTEVDYIHVEYGH |
| Ga0068867_1001481231 | 3300005459 | Miscanthus Rhizosphere | MKNRGEEKMIKAAIFSVCLAVSSLSLNARAEDVRQYTDGPVTEVDYI |
| Ga0070730_103963921 | 3300005537 | Surface Soil | MIKTIILSMCLSSLSLNAHAQDVRQYSEGPVTEVNYI |
| Ga0070730_104181392 | 3300005537 | Surface Soil | MNKTLILSMCLAASLSVNARAQTERAYTYGPVTEVDYIHV |
| Ga0070731_104930852 | 3300005538 | Surface Soil | MTKTIALSLCLAASVLSLSARAQDERQYTDGPVTEVD |
| Ga0070731_108932682 | 3300005538 | Surface Soil | MIKTIILSMGLAASSLSLDARAQDARQYIDGPVTLVQEIGV |
| Ga0070732_109152322 | 3300005542 | Surface Soil | MTKAIVVSMCLAASSLSLKPRAQDERGYGYGPVTEVDYIHVEYG |
| Ga0066670_108903181 | 3300005560 | Soil | VIKTIVFSMCLAALSLSGNARAQGARAYSYGPVTEVDYI |
| Ga0068855_1009379353 | 3300005563 | Corn Rhizosphere | MKNRGEEKMIKAAIFSVCLAVSSLSLNARAEDVRQYTDGPVTEVDYIY |
| Ga0066705_107099132 | 3300005569 | Soil | MIKTIILSMGLAASSFSLNARAQDERQYTEGPVTLVQ |
| Ga0066708_110426102 | 3300005576 | Soil | MIKTIMLSMCLAASLSLDARAQDVNAGAKDERQYTDGPVTLVQEIA |
| Ga0068866_102736792 | 3300005718 | Miscanthus Rhizosphere | MIKTIVLSMCLAASSLSFAHAQNGRAYSYGPVTQVDYIRVEYGHF |
| Ga0074470_116350291 | 3300005836 | Sediment (Intertidal) | MIKTIVVSMCLAGSTLSLNARAADERWYTYGPVTEVDYVAVEYGHF |
| Ga0068863_1005418091 | 3300005841 | Switchgrass Rhizosphere | MIKAAIFSVCLAVSSLSLNARAEDVRQYTDGPVTEVDYI |
| Ga0068858_1012383662 | 3300005842 | Switchgrass Rhizosphere | MMRTIVLTMCLAVSSLALNARAEDERHYTEGPVTL |
| Ga0080027_100580631 | 3300005993 | Prmafrost Soil | MIKTIILSMCLAASSLSLNARAQDEPAYTEGPVTEVDYIQVE |
| Ga0070717_121440862 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MTKTIFLSICLVASSLSLRASAQDERGYSYGPVTEVDYIHV |
| Ga0066652_1002835991 | 3300006046 | Soil | MIKTIVLSMCLAASSLSLAGAQNGRAYSYGPVTEVDYI |
| Ga0075018_102406681 | 3300006172 | Watersheds | MTKIIILSMCLAFSALSLNASAQDERKYSEGPVTLVQEIGVE |
| Ga0070765_1006975441 | 3300006176 | Soil | MTKTTILSMCLAASLLSLDARAQDERQYTEGPVTLVQEIGV |
| Ga0068871_1009447722 | 3300006358 | Miscanthus Rhizosphere | MIKTIVLSMCLAASSLSFAHAQNGRAYSYGPVTQVDY |
| Ga0066665_107571671 | 3300006796 | Soil | MIKTIILSMCFAVCSLSLDARAQDVRQYTDGPITE |
| Ga0066660_114132231 | 3300006800 | Soil | MIKTIMLSMGLAASSFSLNAGAQDERQYTEGPVTFVQEIA |
| Ga0075425_1008553593 | 3300006854 | Populus Rhizosphere | MIKTIALSLCLASSLSLSTRAQDERGYSYGPVTEVDYIHVEYGHFG |
| Ga0075426_109379562 | 3300006903 | Populus Rhizosphere | MTKTIILSVCLAAAALSLGAPAQDVRQYTEGPVTL |
| Ga0075426_111445441 | 3300006903 | Populus Rhizosphere | MIKTIIVSMCLAVFTLSPNARAEDERHYTEGPVTLVQEIAVEY |
| Ga0075436_1010988291 | 3300006914 | Populus Rhizosphere | MTKTIILSVCLAVSPLSLNARADDTRHYTEGPVTLVQEIAV |
| Ga0105245_112026082 | 3300009098 | Miscanthus Rhizosphere | MIKTIILSMCLAAYSLSPNALAQDERHYTDGPVTEVDYIQVEYG |
| Ga0066709_1014320633 | 3300009137 | Grasslands Soil | MNKAAIFSMCLAISALSLNARAQDVRGYSYGPVTEVDY |
| Ga0105248_119029231 | 3300009177 | Switchgrass Rhizosphere | MIKALTLSMCLAASSLSLNAGAQHVRRYSDGPVTNVTYI |
| Ga0126373_121758372 | 3300010048 | Tropical Forest Soil | MIKTIILSMCLAVSSLSPNARAQDERQYTEGPVTFVQEIAV |
| Ga0134109_101912791 | 3300010320 | Grasslands Soil | MIKTIVLSMCLAFSALSLNSDAQDQRGYTDGPVTEVD |
| Ga0074046_100396334 | 3300010339 | Bog Forest Soil | MTKPIILSMCLAASSLSLNARAQNERQYTDGPVTD |
| Ga0126376_115135491 | 3300010359 | Tropical Forest Soil | MIKTVISSVCLAASLLPLNVRAQDVRQYTDGPVTEVSYIQVQYGHF |
| Ga0126378_122407282 | 3300010361 | Tropical Forest Soil | MTKTIILSICLAAAALSLEPRAEDERQYTEGPVTFVQEIA |
| Ga0126379_112912553 | 3300010366 | Tropical Forest Soil | MIKTIILSMCLAASSLSLNAHAQDVRQYSEGPVTEVD |
| Ga0126381_1032836922 | 3300010376 | Tropical Forest Soil | MIKAITVSICLAASSLSLNAAAQDVRQYSDGPVTNVTYIHV |
| Ga0134126_106067183 | 3300010396 | Terrestrial Soil | MCLAISALSHIAYAQGERGYGYGPVTEVDYIHVEYGHFDE |
| Ga0126383_111526021 | 3300010398 | Tropical Forest Soil | MIKTIILSMCLAVSSLFLNARAQDVRQYTDGPVTEVAY |
| Ga0134121_101835411 | 3300010401 | Terrestrial Soil | MIKALTLSMCLAASSLSLNAGAQDVRRYSDGPVTNVTYIHVDY |
| Ga0137377_119568721 | 3300012211 | Vadose Zone Soil | MTKAIILSICLAASSLSLNVHAQDVRQYTEGPVTEVDYIHVE |
| Ga0157344_10049131 | 3300012476 | Arabidopsis Rhizosphere | MIKTIILSMCLAASTLSLDARAQDTLTRDALAQNDRQYTDGPVT |
| Ga0137358_100246917 | 3300012582 | Vadose Zone Soil | MIKTIILSMCLAASSLSLNARAQDTLSRDAVAQNDRQYTDGPVTEV |
| Ga0137358_102522101 | 3300012582 | Vadose Zone Soil | MIKTIILSMGLAASSFSLNARAQDERQYTDGPVTLVSYIG |
| Ga0137398_105857972 | 3300012683 | Vadose Zone Soil | MIKTITLSMCLAAASLSLSARAEDQRQYTEGPVTFVQE |
| Ga0153915_135111891 | 3300012931 | Freshwater Wetlands | MIRATALSMCLAASSLSLNAGAQDVRQYSDGPVTYV |
| Ga0153916_118994232 | 3300012964 | Freshwater Wetlands | MTKAIVVSMCLAASSLSLQPRAQDERGYGYGPVTEVDYIHVEYGHLVNT* |
| Ga0126369_111896012 | 3300012971 | Tropical Forest Soil | MTKIIILSMCLAASSLSLAARAQDVRHYSEGPVTEVDYIQVEYGHF |
| Ga0126369_134986011 | 3300012971 | Tropical Forest Soil | MLKTIILSMCLAVASSLNARAQDVRQYTDGPVTEVVYIQV |
| Ga0164308_103025162 | 3300012985 | Soil | MIKALTLSMCLAASSLSLNAGAQDVRQYSDGPVTNVTY |
| Ga0157373_109614711 | 3300013100 | Corn Rhizosphere | MALAASSISLNARAQDTRAYSYGPVTEVDYIHVEYGHF |
| Ga0157378_114298011 | 3300013297 | Miscanthus Rhizosphere | MIKTIILSMCLAACSLSLNAHAQDVRQYSEGPVTE |
| Ga0134078_102010542 | 3300014157 | Grasslands Soil | MIKTIVLSMCLAISALALNARAQQQDKGKSTYSNGPVTLVSYI |
| Ga0182018_106772712 | 3300014489 | Palsa | MIKTITLSMCLAASSLSLNARAQDERQYTDGPVTEVD |
| Ga0182024_1001676811 | 3300014501 | Permafrost | MMKMIMINAIILSMCLAAYSLALNARAQDDRQYTDGPVT* |
| Ga0181522_103424711 | 3300014657 | Bog | MPKTIVLSMCLAASALSLNARAQDERAYTEGPVTEVNYIRVEYGHF |
| Ga0181522_106809822 | 3300014657 | Bog | MIKTIILSMSLIGSSLLLNASAEDERRYTDGPVTEVNYIRVEYGHF |
| Ga0182030_107113311 | 3300014838 | Bog | MIKTITLSVCLAASVLSLNARAQDERQYTDGPVTEVAYIHVEYGH |
| Ga0167638_10615513 | 3300015197 | Glacier Forefield Soil | MIKTIILSMCLAASSLSLNARAQDERAYTEGPVTEV |
| Ga0134073_102274321 | 3300015356 | Grasslands Soil | MGLAASSFSLNARAQDERQYTEGPVTLVQEIAIEY |
| Ga0182041_115447581 | 3300016294 | Soil | MIKTIVLSMCLAASLLSLNAHAQDVRQYSEGPVTEVSYIQVE |
| Ga0182034_102980291 | 3300016371 | Soil | MIKAITLLMCLAAASLSLNAGAQDVRQYSDGPVTR |
| Ga0187825_103045391 | 3300017930 | Freshwater Sediment | MMQITKTIILSICLAASSLSLNARAQDERQYTEGPVTEEDYIQV |
| Ga0187778_102400933 | 3300017961 | Tropical Peatland | MIKTIILSVCLAASSLSLTARAQDVRQYTDGPVTEVAYI |
| Ga0187783_106912402 | 3300017970 | Tropical Peatland | MIKAIILSTCFAASSLSLNARAQDVRQYSEGPVTEVDYIQ |
| Ga0187823_100803442 | 3300017993 | Freshwater Sediment | MTKTIILSMCLAASSLSLAAPAQDVRHYSEGPVTEVDY |
| Ga0187822_102441771 | 3300017994 | Freshwater Sediment | MIKTIFFSACLAACSLSLHASAQGERGYRYGPVTEVDYIHVE |
| Ga0187787_102074431 | 3300018029 | Tropical Peatland | MMKITKTIILSICLAVSSLSLNARAQDVRQYSDGPVTELA |
| Ga0187883_101788433 | 3300018037 | Peatland | MTKTIILSMCLAASSLSFSARAQDVNAGTKDERQYTDGPVTEVDYIG |
| Ga0187862_101537511 | 3300018040 | Peatland | MIKTIILSMCLAASSLSLDARAQDERQYTEGPVTL |
| Ga0187890_107173572 | 3300018044 | Peatland | MIKTLILSMCLAASSLSLNARAQDERQYSEGPVTEVDEVH |
| Ga0187784_116121892 | 3300018062 | Tropical Peatland | MIKTIILSMCLAVSTLSLDARAQDVRQYTDGPVTE |
| Ga0066662_110460031 | 3300018468 | Grasslands Soil | MIKAAIFSMCLAISALSLNARAQDVRGYSYGPVTEVDYIH |
| Ga0193728_11874751 | 3300019890 | Soil | MIKTIILSMCLAASSLSLNARAQDERQYTDGPVTEVDYLH |
| Ga0210403_104529122 | 3300020580 | Soil | MPKTIILSICLAAAALSLGARAQDERQYTEGPVTFVQEIAVEY |
| Ga0210406_111208711 | 3300021168 | Soil | MCLAASSLSLNARAQDERAYTEGPVTDVNYLRVEYG |
| Ga0210405_107600171 | 3300021171 | Soil | MIKAAIFSMCLAISALSLNARAQDVRGYSYGPVTE |
| Ga0210396_104968141 | 3300021180 | Soil | MIKTIILSVCLAASSLSINARAQQDDERQYTDGPVT |
| Ga0213871_101295341 | 3300021441 | Rhizosphere | MIKTIILSMCLAASSLSLNARAQDVRQYTDGPVTEVDYIRV |
| Ga0210410_117664992 | 3300021479 | Soil | MKITKTIILSICLAVSSLSLNARAQDVRQYSDGPVTEL |
| Ga0126371_109439163 | 3300021560 | Tropical Forest Soil | MVKAIVLSMCLAISALPLNARAQDVRQYTDGPVTEVDYIQVEYGHFE |
| Ga0242653_10292791 | 3300022712 | Soil | MIKTAIFSMCLAISALSLNARAQEVRGYSYGPVTEVDYVHVEY |
| Ga0233359_10456662 | 3300024049 | Soil | MTKTITLYMCLAASSLSLDARAQDERKYTEGPVTLV |
| Ga0247667_10907862 | 3300024290 | Soil | VTKTIILSICLAAAALSLGAHAEDERQYTEGSVTF |
| Ga0207680_111952432 | 3300025903 | Switchgrass Rhizosphere | MKNRGEEKMIKAAIFSVCLAVSSLSLNARAEDVRQYTDGPVTEVD |
| Ga0207663_112161692 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MIKTIILSICLVASSLSLNARAEDERGYSQGPVTQV |
| Ga0207704_101663963 | 3300025938 | Miscanthus Rhizosphere | MTKAAIFSMCLAVSALSLNARAQDARRYNYGPVTLVNYIH |
| Ga0207651_106490543 | 3300025960 | Switchgrass Rhizosphere | MIKAAIFSVCLAVSSLSLNARAEDVRQYTDGPVTEVDYIYVEYGH |
| Ga0207641_111183581 | 3300026088 | Switchgrass Rhizosphere | MIKAAIFSVCLAVSSLSLNARAEDVRQYTDGPVTEVDYIHVEYGH |
| Ga0207698_103940481 | 3300026142 | Corn Rhizosphere | MKNRGEEKMIKAAIFSVCLAVSSLSLNARAEDVRQYTDGPVTEVDYIYV |
| Ga0209686_12333191 | 3300026315 | Soil | MIKTIILSMGLAASSFSLNARAQDERQYTEGPVTLVQYIGVEY |
| Ga0209802_12275511 | 3300026328 | Soil | MIKAAIFSMCLAISALSLNARAQDVRGYSYGPVTEVDY |
| Ga0209473_11511403 | 3300026330 | Soil | MIKAAIFSMCLAISALSLNASAQDVRGYSYGPVTEV |
| Ga0257153_10872111 | 3300026490 | Soil | MIKTIILSMCLAASSLSLNARAQQQDKDERAYTEGPVTLV |
| Ga0209577_103372992 | 3300026552 | Soil | MIKTIILSMGLAASSFSLNARAQDERQYTEGPVTFVQEIAVE |
| Ga0209008_10985432 | 3300027545 | Forest Soil | MIKTIILSMCLAASSLSLNARAEDERHYTDGPVTEVDY |
| Ga0209525_10810612 | 3300027575 | Forest Soil | MTKTIILSMCLAASSLSLNARAQDERRYTEGPVTLVTYIRIEYG |
| Ga0209908_102285533 | 3300027745 | Thawing Permafrost | MMKMIKTIILSMCLAASSLSLSARAQDERAYTDGP |
| Ga0209274_101041543 | 3300027853 | Soil | MIKTIIILSMCLAASSLSLNARAQDERQYADGPVTEVDYIHVEYGHF |
| Ga0209166_102701491 | 3300027857 | Surface Soil | MNKTLILSMCLAASLSVNARAQTERAYTYGPVTEVDYIH |
| Ga0209380_102142903 | 3300027889 | Soil | MIKTVILFMCFAASSLSLNARAQDERAYTDGPVTEVDYIRVEYG |
| Ga0209526_106675972 | 3300028047 | Forest Soil | MIKTIILSMCLAASSLSLNARAQDERAYTDGPVTEVDYIRVEY |
| Ga0209526_109769451 | 3300028047 | Forest Soil | MIKTIILSMCLTVSSLSLNAPAANERGYTYGPVTQVDYIHVEY |
| Ga0247682_10911001 | 3300028146 | Soil | MIKTIILSMCLAASSLSLNARAQDERQYTDGPVTEIDYIH |
| Ga0268266_107674821 | 3300028379 | Switchgrass Rhizosphere | MIKALTLSMCLAASSLSLNAGAQDVRRYSDGPVTNVTYIHV |
| Ga0311369_106841382 | 3300029910 | Palsa | MCFAASLLSLNARAQDARQYTDGPVTEVAYIHVEYG |
| Ga0311338_105075591 | 3300030007 | Palsa | MNKATILSMCLAAFSVSRNARAQDERAYTEGPVTEEDYIRVE |
| Ga0302179_101942661 | 3300030058 | Palsa | MIKTIILSMCLAAASLSLNARAQDERQYTDGPVTEADY |
| Ga0311372_103684622 | 3300030520 | Palsa | MCLAASSLSLNARAQDERQYTDGPVTTVTYIKVEY |
| Ga0311372_126074542 | 3300030520 | Palsa | MIKTIILSTCLAASSLSLNARAQDERQYTDGPVTEVDYIQVEY |
| Ga0311355_103724671 | 3300030580 | Palsa | MIKTVILSVCFAASSLSLNARAQDERAYTEGPVTEVDNIQV |
| Ga0311356_116387801 | 3300030617 | Palsa | MIKAIILPMCLAASSLSIDARAQDERAYTEGPVTEVTYNHV |
| Ga0302317_101767852 | 3300030677 | Palsa | MNKAIILAMCLAASSLSLNARAQDERAYTEGPVTEVNYIR |
| Ga0302180_103131981 | 3300031028 | Palsa | MNKAIILSMCLAASSVSLNARAQDERAYTEGPVTEEDYIHVE |
| Ga0302180_105240142 | 3300031028 | Palsa | MIKTVILSVCFAASSLSLNARAQDERAYTEGPVTEVDNIQVEY |
| Ga0302325_129054231 | 3300031234 | Palsa | MTKTIILSMCLAASSLSLDARAQDERHYTDGPVTEVAYI |
| Ga0302326_126747471 | 3300031525 | Palsa | MIKTIILSMCLAASSLSLDARAQDERQYTEGPVTLVQEI |
| Ga0318516_101088841 | 3300031543 | Soil | MTKTLILSLSLAASSLAFSARAQDVRQYTDGPVTEMDYIRVEYGH |
| Ga0318534_104728962 | 3300031544 | Soil | MTKTIILSMCLAASSLSLTARAQDVRHYSEGAVTEVDYIQV |
| Ga0318541_102876122 | 3300031545 | Soil | MTKTLVLSLSLAASSLAFSARAQDVRQYTDGPVTEMDYIRVEYG |
| Ga0318528_107300792 | 3300031561 | Soil | MTKTLVLSLSLAASSLAFSARAQDVRQYTDGPVTEMDYIRVEYGH |
| Ga0310686_1008064983 | 3300031708 | Soil | MIKTIVLSMCLAASSLSLNAGAQDERQYTDGPVTEVDY |
| Ga0307476_101651181 | 3300031715 | Hardwood Forest Soil | MIKTIILSMCLAASSLALNARAQDARQYADGPVTEAN |
| Ga0318537_101127611 | 3300031763 | Soil | MIKAVALSMCLAASSLSLTAGAQDVRQYSDGPVTLVTYVHVDY |
| Ga0318554_104425961 | 3300031765 | Soil | MTKTLILSLSLAASSLAFSARAQDVRQYTDGPVTEMDYIR |
| Ga0318548_102389111 | 3300031793 | Soil | MIKTIILSMCLAVSSLSLNARAQDERQYTEGPVTFVQEIA |
| Ga0306919_114311501 | 3300031879 | Soil | MIKTIILSMCLAVSTLSLDARAQDVRQYTDGPVTELDYIQ |
| Ga0306923_105495243 | 3300031910 | Soil | MIKAVALSMCLAASSLSLTAGAQDVRQYSDGPVTLVTYVHVDYGS |
| Ga0310909_108662672 | 3300031947 | Soil | MIKTIVLMCLAISALSLNARAQDVRQYTDGPVTELDY |
| Ga0306926_106489711 | 3300031954 | Soil | MTKTLVLSLSLAASALAFSARAQDVRQYADGPVTEMDYIR |
| Ga0318575_104846161 | 3300032055 | Soil | MTKTLILSLSLAASSLAFSARAQDVRQYTDGPVTEMDYIRVEYGR |
| Ga0307470_119570452 | 3300032174 | Hardwood Forest Soil | MIKALTLSMCLAASSLSLNSDAQDVRRYSDGPVTNVTYI |
| Ga0373906_173140_410_520 | 3300034815 | Sediment Slurry | MTKAIVVSMCLAASSLSLTPRAQDERGYDYGPVTEVD |
| ⦗Top⦘ |